| Basic Information | |
|---|---|
| Family ID | F024202 |
| Family Type | Metagenome |
| Number of Sequences | 207 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKTIKYNNKEYKLPFDVELPEDPTAEVEVKNRFSGQSTTMPE |
| Number of Associated Samples | 151 |
| Number of Associated Scaffolds | 207 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 97.09 % |
| % of genes near scaffold ends (potentially truncated) | 99.03 % |
| % of genes from short scaffolds (< 2000 bps) | 96.14 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.377 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (44.927 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.159 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (84.058 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.57% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 207 Family Scaffolds |
|---|---|---|
| PF03592 | Terminase_2 | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 207 Family Scaffolds |
|---|---|---|---|
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.62 % |
| Unclassified | root | N/A | 46.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10095177 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10262730 | Not Available | 500 | Open in IMG/M |
| 3300000949|BBAY94_10045518 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
| 3300001460|JGI24003J15210_10171073 | All Organisms → Viruses → environmental samples → uncultured virus | 535 | Open in IMG/M |
| 3300001472|JGI24004J15324_10148154 | Not Available | 545 | Open in IMG/M |
| 3300001830|ACM40_1033027 | All Organisms → Viruses → environmental samples → uncultured virus | 614 | Open in IMG/M |
| 3300002242|KVWGV2_10414847 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 548 | Open in IMG/M |
| 3300002483|JGI25132J35274_1096622 | Not Available | 602 | Open in IMG/M |
| 3300002483|JGI25132J35274_1113105 | All Organisms → Viruses → environmental samples → uncultured virus | 546 | Open in IMG/M |
| 3300002514|JGI25133J35611_10194870 | All Organisms → Viruses → environmental samples → uncultured virus | 534 | Open in IMG/M |
| 3300005514|Ga0066866_10271942 | Not Available | 582 | Open in IMG/M |
| 3300005522|Ga0066861_10182208 | Not Available | 722 | Open in IMG/M |
| 3300005612|Ga0070723_10629466 | Not Available | 539 | Open in IMG/M |
| 3300006029|Ga0075466_1045150 | All Organisms → Viruses → environmental samples → uncultured virus | 1319 | Open in IMG/M |
| 3300006164|Ga0075441_10364191 | All Organisms → Viruses → environmental samples → uncultured virus | 524 | Open in IMG/M |
| 3300006352|Ga0075448_10210617 | All Organisms → Viruses → environmental samples → uncultured virus | 593 | Open in IMG/M |
| 3300006565|Ga0100228_1033568 | Not Available | 2257 | Open in IMG/M |
| 3300006735|Ga0098038_1198166 | Not Available | 651 | Open in IMG/M |
| 3300006737|Ga0098037_1118029 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 909 | Open in IMG/M |
| 3300006737|Ga0098037_1138828 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 822 | Open in IMG/M |
| 3300006749|Ga0098042_1153735 | Not Available | 563 | Open in IMG/M |
| 3300006749|Ga0098042_1154863 | Not Available | 560 | Open in IMG/M |
| 3300006749|Ga0098042_1174123 | Not Available | 521 | Open in IMG/M |
| 3300006751|Ga0098040_1096077 | Not Available | 895 | Open in IMG/M |
| 3300006751|Ga0098040_1253395 | Not Available | 509 | Open in IMG/M |
| 3300006752|Ga0098048_1152492 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 689 | Open in IMG/M |
| 3300006752|Ga0098048_1187691 | Not Available | 612 | Open in IMG/M |
| 3300006752|Ga0098048_1191077 | Not Available | 605 | Open in IMG/M |
| 3300006754|Ga0098044_1199767 | Not Available | 786 | Open in IMG/M |
| 3300006789|Ga0098054_1107719 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
| 3300006789|Ga0098054_1173994 | Not Available | 790 | Open in IMG/M |
| 3300006789|Ga0098054_1294304 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 581 | Open in IMG/M |
| 3300006793|Ga0098055_1129167 | Not Available | 979 | Open in IMG/M |
| 3300006793|Ga0098055_1130763 | Not Available | 972 | Open in IMG/M |
| 3300006793|Ga0098055_1167556 | Not Available | 842 | Open in IMG/M |
| 3300006802|Ga0070749_10567520 | All Organisms → Viruses → environmental samples → uncultured virus | 614 | Open in IMG/M |
| 3300006802|Ga0070749_10592119 | Not Available | 599 | Open in IMG/M |
| 3300006803|Ga0075467_10102725 | All Organisms → Viruses → environmental samples → uncultured virus | 1699 | Open in IMG/M |
| 3300006810|Ga0070754_10151689 | All Organisms → Viruses → environmental samples → uncultured virus | 1107 | Open in IMG/M |
| 3300006870|Ga0075479_10130494 | All Organisms → Viruses → Predicted Viral | 1032 | Open in IMG/M |
| 3300006920|Ga0070748_1332910 | All Organisms → Viruses → environmental samples → uncultured virus | 537 | Open in IMG/M |
| 3300006921|Ga0098060_1158520 | Not Available | 626 | Open in IMG/M |
| 3300006922|Ga0098045_1129642 | Not Available | 586 | Open in IMG/M |
| 3300006924|Ga0098051_1081795 | All Organisms → Viruses → environmental samples → uncultured virus | 873 | Open in IMG/M |
| 3300006925|Ga0098050_1030106 | All Organisms → Viruses → Predicted Viral | 1476 | Open in IMG/M |
| 3300006928|Ga0098041_1151255 | Not Available | 747 | Open in IMG/M |
| 3300006928|Ga0098041_1176617 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 685 | Open in IMG/M |
| 3300006947|Ga0075444_10383683 | All Organisms → Viruses → environmental samples → uncultured virus | 530 | Open in IMG/M |
| 3300007229|Ga0075468_10060604 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
| 3300007231|Ga0075469_10071326 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
| 3300007231|Ga0075469_10189643 | All Organisms → Viruses → environmental samples → uncultured virus | 551 | Open in IMG/M |
| 3300007346|Ga0070753_1273567 | All Organisms → Viruses → environmental samples → uncultured virus | 608 | Open in IMG/M |
| 3300007542|Ga0099846_1098603 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300007542|Ga0099846_1207680 | All Organisms → Viruses → environmental samples → uncultured virus | 689 | Open in IMG/M |
| 3300007647|Ga0102855_1214866 | Not Available | 513 | Open in IMG/M |
| 3300007764|Ga0102950_1273572 | Not Available | 523 | Open in IMG/M |
| 3300008050|Ga0098052_1099860 | All Organisms → Viruses → Predicted Viral | 1183 | Open in IMG/M |
| 3300008050|Ga0098052_1123156 | Not Available | 1042 | Open in IMG/M |
| 3300008050|Ga0098052_1214333 | Not Available | 744 | Open in IMG/M |
| 3300009074|Ga0115549_1299833 | Not Available | 507 | Open in IMG/M |
| 3300009126|Ga0118723_1054597 | All Organisms → Viruses → Predicted Viral | 2675 | Open in IMG/M |
| 3300009149|Ga0114918_10729874 | Not Available | 518 | Open in IMG/M |
| 3300009409|Ga0114993_11181913 | All Organisms → Viruses → environmental samples → uncultured virus | 539 | Open in IMG/M |
| 3300009433|Ga0115545_1261479 | Not Available | 580 | Open in IMG/M |
| 3300009436|Ga0115008_11377102 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 542 | Open in IMG/M |
| 3300009437|Ga0115556_1265592 | Not Available | 608 | Open in IMG/M |
| 3300009447|Ga0115560_1111468 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300009481|Ga0114932_10406376 | Not Available | 807 | Open in IMG/M |
| 3300009481|Ga0114932_10550731 | Not Available | 677 | Open in IMG/M |
| 3300009495|Ga0115571_1405308 | Not Available | 531 | Open in IMG/M |
| 3300009497|Ga0115569_10388998 | Not Available | 602 | Open in IMG/M |
| 3300009515|Ga0129286_10256443 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 614 | Open in IMG/M |
| 3300009529|Ga0114919_10346990 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300009601|Ga0114914_1073594 | Not Available | 522 | Open in IMG/M |
| 3300009790|Ga0115012_10571832 | All Organisms → Viruses → environmental samples → uncultured virus | 892 | Open in IMG/M |
| 3300009790|Ga0115012_11440527 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 589 | Open in IMG/M |
| 3300010148|Ga0098043_1099505 | Not Available | 849 | Open in IMG/M |
| 3300010148|Ga0098043_1209822 | Not Available | 537 | Open in IMG/M |
| 3300010149|Ga0098049_1197683 | Not Available | 616 | Open in IMG/M |
| 3300010150|Ga0098056_1217741 | Not Available | 636 | Open in IMG/M |
| 3300010151|Ga0098061_1158850 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 816 | Open in IMG/M |
| 3300010151|Ga0098061_1336449 | All Organisms → Viruses → environmental samples → uncultured virus | 515 | Open in IMG/M |
| 3300010153|Ga0098059_1199123 | Not Available | 780 | Open in IMG/M |
| 3300010153|Ga0098059_1329316 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 581 | Open in IMG/M |
| 3300010155|Ga0098047_10260904 | Not Available | 657 | Open in IMG/M |
| 3300010155|Ga0098047_10354218 | Not Available | 551 | Open in IMG/M |
| 3300010392|Ga0118731_112739758 | All Organisms → Viruses → environmental samples → uncultured virus | 539 | Open in IMG/M |
| 3300012919|Ga0160422_10232452 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300012919|Ga0160422_10887760 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 574 | Open in IMG/M |
| 3300012920|Ga0160423_10889245 | Not Available | 598 | Open in IMG/M |
| 3300017705|Ga0181372_1072663 | All Organisms → Viruses → environmental samples → uncultured virus | 582 | Open in IMG/M |
| 3300017714|Ga0181412_1039702 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1230 | Open in IMG/M |
| 3300017718|Ga0181375_1023880 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
| 3300017719|Ga0181390_1081525 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 892 | Open in IMG/M |
| 3300017721|Ga0181373_1049904 | Not Available | 761 | Open in IMG/M |
| 3300017735|Ga0181431_1133056 | Not Available | 553 | Open in IMG/M |
| 3300017737|Ga0187218_1160341 | All Organisms → Viruses → environmental samples → uncultured virus | 530 | Open in IMG/M |
| 3300017741|Ga0181421_1075691 | Not Available | 882 | Open in IMG/M |
| 3300017749|Ga0181392_1218578 | Not Available | 543 | Open in IMG/M |
| 3300017751|Ga0187219_1227152 | All Organisms → Viruses → environmental samples → uncultured virus | 508 | Open in IMG/M |
| 3300017760|Ga0181408_1154267 | Not Available | 591 | Open in IMG/M |
| 3300017950|Ga0181607_10639218 | All Organisms → Viruses → environmental samples → uncultured virus | 556 | Open in IMG/M |
| 3300017986|Ga0181569_10797435 | Not Available | 619 | Open in IMG/M |
| 3300019728|Ga0193996_1046166 | Not Available | 578 | Open in IMG/M |
| 3300020336|Ga0211510_1053284 | Not Available | 986 | Open in IMG/M |
| 3300020447|Ga0211691_10335620 | All Organisms → Viruses → environmental samples → uncultured virus | 602 | Open in IMG/M |
| 3300020478|Ga0211503_10411364 | Not Available | 724 | Open in IMG/M |
| 3300021959|Ga0222716_10197176 | All Organisms → Viruses → Predicted Viral | 1277 | Open in IMG/M |
| 3300022065|Ga0212024_1015751 | All Organisms → Viruses → Predicted Viral | 1189 | Open in IMG/M |
| 3300022065|Ga0212024_1086669 | Not Available | 557 | Open in IMG/M |
| 3300022072|Ga0196889_1093223 | All Organisms → Viruses → environmental samples → uncultured virus | 553 | Open in IMG/M |
| 3300022072|Ga0196889_1106965 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 506 | Open in IMG/M |
| 3300022074|Ga0224906_1137118 | Not Available | 698 | Open in IMG/M |
| 3300022164|Ga0212022_1076413 | Not Available | 513 | Open in IMG/M |
| 3300022169|Ga0196903_1026803 | Not Available | 687 | Open in IMG/M |
| 3300022178|Ga0196887_1038752 | All Organisms → Viruses → Predicted Viral | 1278 | Open in IMG/M |
| 3300022178|Ga0196887_1072542 | Not Available | 823 | Open in IMG/M |
| 3300022178|Ga0196887_1078415 | All Organisms → Viruses → environmental samples → uncultured virus | 777 | Open in IMG/M |
| 3300022187|Ga0196899_1082947 | Not Available | 977 | Open in IMG/M |
| 3300022187|Ga0196899_1159057 | Not Available | 623 | Open in IMG/M |
| 3300022202|Ga0224498_10211999 | Not Available | 575 | Open in IMG/M |
| 3300023180|Ga0255768_10105020 | All Organisms → Viruses → Predicted Viral | 1882 | Open in IMG/M |
| (restricted) 3300024057|Ga0255051_10350581 | Not Available | 545 | Open in IMG/M |
| 3300024313|Ga0228624_1100191 | Not Available | 513 | Open in IMG/M |
| 3300024344|Ga0209992_10446802 | Not Available | 504 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10091457 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
| 3300025048|Ga0207905_1020640 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300025048|Ga0207905_1025717 | Not Available | 968 | Open in IMG/M |
| 3300025048|Ga0207905_1042031 | All Organisms → Viruses → environmental samples → uncultured virus | 719 | Open in IMG/M |
| 3300025048|Ga0207905_1062633 | All Organisms → Viruses → environmental samples → uncultured virus | 555 | Open in IMG/M |
| 3300025070|Ga0208667_1025719 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
| 3300025071|Ga0207896_1047031 | Not Available | 711 | Open in IMG/M |
| 3300025071|Ga0207896_1067229 | All Organisms → Viruses → environmental samples → uncultured virus | 563 | Open in IMG/M |
| 3300025072|Ga0208920_1075932 | All Organisms → Viruses → environmental samples → uncultured virus | 641 | Open in IMG/M |
| 3300025079|Ga0207890_1021124 | All Organisms → Viruses → Predicted Viral | 1256 | Open in IMG/M |
| 3300025085|Ga0208792_1078520 | Not Available | 590 | Open in IMG/M |
| 3300025086|Ga0208157_1037295 | All Organisms → Viruses → Predicted Viral | 1368 | Open in IMG/M |
| 3300025097|Ga0208010_1100078 | All Organisms → Viruses → environmental samples → uncultured virus | 597 | Open in IMG/M |
| 3300025098|Ga0208434_1063565 | Not Available | 780 | Open in IMG/M |
| 3300025099|Ga0208669_1111577 | Not Available | 561 | Open in IMG/M |
| 3300025102|Ga0208666_1015689 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 2494 | Open in IMG/M |
| 3300025102|Ga0208666_1063327 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 996 | Open in IMG/M |
| 3300025103|Ga0208013_1069259 | Not Available | 926 | Open in IMG/M |
| 3300025103|Ga0208013_1152152 | Not Available | 551 | Open in IMG/M |
| 3300025108|Ga0208793_1156523 | Not Available | 598 | Open in IMG/M |
| 3300025110|Ga0208158_1080950 | Not Available | 774 | Open in IMG/M |
| 3300025110|Ga0208158_1092494 | Not Available | 714 | Open in IMG/M |
| 3300025120|Ga0209535_1032029 | Not Available | 2468 | Open in IMG/M |
| 3300025120|Ga0209535_1083288 | All Organisms → Viruses → Predicted Viral | 1203 | Open in IMG/M |
| 3300025120|Ga0209535_1114763 | Not Available | 930 | Open in IMG/M |
| 3300025120|Ga0209535_1136095 | All Organisms → Viruses → environmental samples → uncultured virus | 804 | Open in IMG/M |
| 3300025127|Ga0209348_1151007 | All Organisms → Viruses → environmental samples → uncultured virus | 682 | Open in IMG/M |
| 3300025128|Ga0208919_1084336 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300025131|Ga0209128_1074823 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1153 | Open in IMG/M |
| 3300025131|Ga0209128_1130469 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 774 | Open in IMG/M |
| 3300025132|Ga0209232_1074774 | Not Available | 1185 | Open in IMG/M |
| 3300025132|Ga0209232_1203468 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 603 | Open in IMG/M |
| 3300025133|Ga0208299_1180085 | Not Available | 641 | Open in IMG/M |
| 3300025133|Ga0208299_1206569 | All Organisms → Viruses → environmental samples → uncultured virus | 579 | Open in IMG/M |
| 3300025137|Ga0209336_10161166 | Not Available | 585 | Open in IMG/M |
| 3300025141|Ga0209756_1256047 | Not Available | 639 | Open in IMG/M |
| 3300025151|Ga0209645_1055878 | Not Available | 1371 | Open in IMG/M |
| 3300025151|Ga0209645_1089234 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
| 3300025168|Ga0209337_1250495 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 678 | Open in IMG/M |
| 3300025168|Ga0209337_1278796 | Not Available | 620 | Open in IMG/M |
| 3300025266|Ga0208032_1063306 | All Organisms → Viruses → environmental samples → uncultured virus | 818 | Open in IMG/M |
| 3300025270|Ga0208813_1049228 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 934 | Open in IMG/M |
| 3300025483|Ga0209557_1065249 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 856 | Open in IMG/M |
| 3300025508|Ga0208148_1034758 | All Organisms → Viruses → environmental samples → uncultured virus | 1333 | Open in IMG/M |
| 3300025543|Ga0208303_1028713 | All Organisms → Viruses → Predicted Viral | 1497 | Open in IMG/M |
| 3300025570|Ga0208660_1129219 | Not Available | 530 | Open in IMG/M |
| 3300025632|Ga0209194_1093635 | Not Available | 771 | Open in IMG/M |
| 3300025645|Ga0208643_1066248 | All Organisms → Viruses → environmental samples → uncultured virus | 1063 | Open in IMG/M |
| 3300025645|Ga0208643_1094891 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 826 | Open in IMG/M |
| 3300025645|Ga0208643_1099950 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 796 | Open in IMG/M |
| 3300025680|Ga0209306_1170061 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 609 | Open in IMG/M |
| 3300025751|Ga0208150_1228104 | Not Available | 568 | Open in IMG/M |
| 3300025759|Ga0208899_1201273 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 633 | Open in IMG/M |
| 3300025769|Ga0208767_1275981 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 508 | Open in IMG/M |
| 3300025806|Ga0208545_1023065 | All Organisms → Viruses → Predicted Viral | 2087 | Open in IMG/M |
| 3300025840|Ga0208917_1094750 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300025840|Ga0208917_1279381 | Not Available | 525 | Open in IMG/M |
| 3300025886|Ga0209632_10207594 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300025889|Ga0208644_1332068 | All Organisms → Viruses → environmental samples → uncultured virus | 589 | Open in IMG/M |
| 3300026263|Ga0207992_1130882 | Not Available | 641 | Open in IMG/M |
| 3300027791|Ga0209830_10218422 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 880 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10198383 | All Organisms → Viruses → environmental samples → uncultured virus | 843 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10122876 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
| 3300028125|Ga0256368_1047235 | All Organisms → Viruses → environmental samples → uncultured virus | 760 | Open in IMG/M |
| 3300028196|Ga0257114_1069092 | All Organisms → Viruses → Predicted Viral | 1509 | Open in IMG/M |
| 3300028198|Ga0257121_1006665 | Not Available | 6623 | Open in IMG/M |
| 3300031519|Ga0307488_10092448 | All Organisms → Viruses → Predicted Viral | 2224 | Open in IMG/M |
| 3300031519|Ga0307488_10319184 | Not Available | 992 | Open in IMG/M |
| 3300031519|Ga0307488_10365401 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 904 | Open in IMG/M |
| 3300031519|Ga0307488_10538393 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 689 | Open in IMG/M |
| 3300031519|Ga0307488_10804965 | Not Available | 519 | Open in IMG/M |
| 3300031594|Ga0302131_1165794 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 737 | Open in IMG/M |
| 3300032254|Ga0316208_1081580 | Not Available | 851 | Open in IMG/M |
| 3300032277|Ga0316202_10245555 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 832 | Open in IMG/M |
| 3300032277|Ga0316202_10357845 | All Organisms → Viruses → environmental samples → uncultured virus | 681 | Open in IMG/M |
| 3300032373|Ga0316204_11149121 | Not Available | 543 | Open in IMG/M |
| 3300032373|Ga0316204_11191741 | Not Available | 531 | Open in IMG/M |
| 3300033742|Ga0314858_082655 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 806 | Open in IMG/M |
| 3300033742|Ga0314858_129670 | Not Available | 645 | Open in IMG/M |
| 3300033742|Ga0314858_134822 | All Organisms → Viruses → environmental samples → uncultured virus | 632 | Open in IMG/M |
| 3300034418|Ga0348337_182883 | All Organisms → Viruses → environmental samples → uncultured virus | 545 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 44.93% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.36% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.83% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.86% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.90% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 2.42% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.42% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.93% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.45% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.45% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.45% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.45% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.97% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.97% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.97% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.97% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.48% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.48% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.48% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.48% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.48% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.48% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.48% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.48% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.48% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.48% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.48% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.48% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.48% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.48% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.48% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.48% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001830 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM40, ROCA_DNA028_0.2um_3l | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007764 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009126 | Combined Assembly of Gp0139357, Gp0139356 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009515 | Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009601 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019728 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_2-3_MG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020336 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860) | Environmental | Open in IMG/M |
| 3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300024057 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_9 | Environmental | Open in IMG/M |
| 3300024313 | Seawater microbial communities from Monterey Bay, California, United States - 29D | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026263 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028198 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031594 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_20m | Environmental | Open in IMG/M |
| 3300032254 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100951771 | 3300000117 | Marine | MKTIKYNNKDYKLPFDVELPDDPTVEVEIKNRFTGQSTTMPEF |
| DelMOWin2010_102627303 | 3300000117 | Marine | MKTIKYNNKEYKMPFDVELPEDPTVEVEVKNRFTGEATTM |
| BBAY94_100455185 | 3300000949 | Macroalgal Surface | MKTIKYNNKEYKLPFDVALPEDATAEDTVKNRFGGESCTLPAFA |
| JGI24003J15210_101710732 | 3300001460 | Marine | MKTIKYNNKDYKLPFDVELPEDPTVEVEVKNRFTGEAT |
| JGI24004J15324_101481542 | 3300001472 | Marine | MKTIKYNNKEYKLPFDVQLPEDPTAEVEVKNRFSGQSTTMPEFAAA |
| ACM40_10330273 | 3300001830 | Marine Plankton | MKTIKYNNKEYKLPFDVELPEDPTAEVEVANRFSGEKTTMPEFAA |
| KVWGV2_104148471 | 3300002242 | Marine Sediment | MKTITYNNKQYKLPFDVELPEDPTAEVEIANRFSGEKT |
| JGI25132J35274_10966221 | 3300002483 | Marine | MKTIKYNNKEYKLPFDVALPDDPTATDTVRNRFGGESCTLPAF |
| JGI25132J35274_11131052 | 3300002483 | Marine | MKTITYNNKQYKLPFEVELPEDPTAEVEIANRFSGEKTTMPEFAA |
| JGI25133J35611_101948702 | 3300002514 | Marine | MKTITYNNKQYKLPFDVELPDNPIAEVEIANRFSGEKTTMPEFAA |
| Ga0066866_102719423 | 3300005514 | Marine | MKTIKYKNKEYKLPFDVELPEDPTAEVVIANRFSGQKTTMP |
| Ga0066861_101822083 | 3300005522 | Marine | MKTIKYNDKEYKLPFDVALPEDPTATDTVRNRFGGE |
| Ga0070723_106294661 | 3300005612 | Marine Sediment | MKTITYNNKQYKLPFDVALPDDPTAEVEIANRFSG |
| Ga0075466_10451501 | 3300006029 | Aqueous | MKTIKYKNKDYKLPFDVELPDDPTVEVTVKNRFSG |
| Ga0075441_103641912 | 3300006164 | Marine | METIKYNNKEYKLPFDVELPEDPTVEVTVKNRFSGQSTTMP |
| Ga0075448_102106171 | 3300006352 | Marine | MKTIKYNNKEYKLPFDVELPEDPTVEVTVKNRFSGQSTTMP |
| Ga0100228_10335687 | 3300006565 | Marine | MKTIKYNNKEYKLPFDVALPEDATAEDTVRNRFGGESCTL |
| Ga0098038_11981663 | 3300006735 | Marine | MKTITYNNKQYKLPFDVELPEDPTAEVEVANRFSGQKTTMP |
| Ga0098037_11180294 | 3300006737 | Marine | MKTITYNNKQYKLPFDVELPEDPTAEVEVKNRFSGQSTTMPEFAAAVYDVIIG |
| Ga0098037_11388284 | 3300006737 | Marine | MKTIKYNNKEYKLPFAVELPEDPTAEVEVKNRFSGQSTTMPEFAAAVYDV |
| Ga0098042_11537352 | 3300006749 | Marine | MKTIKYNNKEYKLPFDVELPEDPTAEVEVANRFSGQKTTMP |
| Ga0098042_11548632 | 3300006749 | Marine | MKTITYNNKQYKLPFDVELPEDPTAEVEVANRFSGQKT |
| Ga0098042_11741233 | 3300006749 | Marine | MELKTIEYNNKKIKMPFDVALPDDPTAEVEIKNRFSGQATTMP |
| Ga0098040_10960771 | 3300006751 | Marine | MQSITYNNKQYKLPFAVSLPDDPTTTDTVRNRFGG |
| Ga0098040_12533952 | 3300006751 | Marine | MKTIKYNNKEYKLPFDVALPDDPTVTDTVRNRFGGE |
| Ga0098048_11524923 | 3300006752 | Marine | MKTITYNNKQYKLPFDVELPEDPTAEVEIANRFSGE |
| Ga0098048_11876911 | 3300006752 | Marine | MKTIKYNNKEYKLPFDVELPEDPTAEVVIANRFSGQKTTMPEFAAA |
| Ga0098048_11910771 | 3300006752 | Marine | MKTIKYNNKEYKLPFAVSLPEDPTAMDTVRNRFGG |
| Ga0098044_11997674 | 3300006754 | Marine | MGKLIKYNDKEYKLPFDVALPDDPTATDTVKNRFGG |
| Ga0098054_11077191 | 3300006789 | Marine | MGKLIKYNDKEYKLPFDVALPDDPTATDTVKNRFGGESCTLPAF |
| Ga0098054_11739941 | 3300006789 | Marine | MKTIKYNDKEYKLPFDVALPDDPTATDTVRNRFGGE |
| Ga0098054_12943043 | 3300006789 | Marine | MKTITYNNKQYKLPFDVELPEDPTAEVEVANRFSGEKTTMPEF |
| Ga0098055_11291674 | 3300006793 | Marine | MKTINYNNKEYKLPFDVALPEDATAEDTVRNRFGGESCTLPAFAI |
| Ga0098055_11307631 | 3300006793 | Marine | MKTIKYNNKEYKLPFDVALPEDATATDTVKNRFGGE |
| Ga0098055_11675564 | 3300006793 | Marine | MGKLIKYNNKEYKLPFDVALPEDPTATDTVRNRFGGESC |
| Ga0070749_105675201 | 3300006802 | Aqueous | MKTIKYNNKDYKLPFDVQLPEDPTAEVTVKNRFSGQST |
| Ga0070749_105921191 | 3300006802 | Aqueous | MTKTITYNDKEYKIPFSVALPEDPTTQEEVKNRFGGESCMLPAFA |
| Ga0075467_101027255 | 3300006803 | Aqueous | MKTIKYKNKDYKLPFDVELPDDPTVEVTVKNRFSGQ |
| Ga0070754_101516891 | 3300006810 | Aqueous | MKTIKYNDKEYKLPFDVELPEDPTVEVTVKNRFSGQ |
| Ga0075479_101304944 | 3300006870 | Aqueous | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEATTM |
| Ga0070748_13329102 | 3300006920 | Aqueous | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEATTMPEFAVAV |
| Ga0098060_11585203 | 3300006921 | Marine | MTKTITYNNKEYKLPFDVALPDDPTAEVEVKNRFSGQST |
| Ga0098045_11296422 | 3300006922 | Marine | MKTIKYNNKEYKLPFDVELPEDPTAEVVIANRFSGQKTTMPEFAAAV |
| Ga0098051_10817951 | 3300006924 | Marine | MKTIKYNNKEYKLPFDVALPDDPTATDTVRNRFGGE |
| Ga0098050_10301065 | 3300006925 | Marine | MIDLSYIIPDMKTIKYNNKEYKLPFAVSLPEDATATDTVRNRFGGESCTLP |
| Ga0098041_11512554 | 3300006928 | Marine | MKTIKYNDKEYKLPFDVALPDDPTATDTVRNRFGGESCTLP |
| Ga0098041_11766173 | 3300006928 | Marine | MKTITYNNKEYKLPFEVELPDNPIAEVEIANRFSGEKTTMP |
| Ga0075444_103836832 | 3300006947 | Marine | METIKYNNKEYKLPFDVELPEDPTVEVTVKNRFSGQSTTMPE |
| Ga0075468_100606041 | 3300007229 | Aqueous | MKTIKYNDKEYKLPFDVELPEDPTVEVTVKNRFSGQSTTM |
| Ga0075469_100713261 | 3300007231 | Aqueous | MKTIKYNNKDYKLPFDVQLPEDPTAEVTVKNRFSGQSTTMPEFAAA |
| Ga0075469_101896431 | 3300007231 | Aqueous | MKTIKYKNKDYKLPFDVELPEDPTVEVEVKNRFTGEATTMPEFA |
| Ga0070753_12735673 | 3300007346 | Aqueous | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEATTMPEFAV |
| Ga0099846_10986035 | 3300007542 | Aqueous | MKTIKYNNKEYKLPFAVGLSDEPTALVTVHNRFGGESCE |
| Ga0099846_12076803 | 3300007542 | Aqueous | MKTIKYNNKDYKLPFDVQLPEDPTAEVTVKNRFSGQSTT |
| Ga0102855_12148661 | 3300007647 | Estuarine | MKTIKYNNKEYKMPFDVALPDDPTAEVEVKNRFSGQSTTMPEFAAAVYDAI |
| Ga0102950_12735721 | 3300007764 | Soil | MKTIKYNNKEYKLPFEVELPEDPTAEVEIANRFSGEKTTMPE |
| Ga0098052_10998606 | 3300008050 | Marine | MGKLIKYNDKEYKLPFDVALPDDPTATDTVKNRFGGES |
| Ga0098052_11231564 | 3300008050 | Marine | MQSITYNNKQYKLPFAVALPDDATATDTVRNRFGGESCTLPAF |
| Ga0098052_12143331 | 3300008050 | Marine | MKTIKYNDKEYKLPFDVALPDDPTATDTVRNRFGGESC |
| Ga0115549_12998332 | 3300009074 | Pelagic Marine | MKTIKYNNKEYKLPFDVELPEDPTAEVEVKNRFSGQSTTMPEF |
| Ga0118723_10545976 | 3300009126 | Marine | MGKLIKYNNKEYKLPFDVALPDDPTATDTVRNRFGGESCT |
| Ga0114918_107298741 | 3300009149 | Deep Subsurface | MKTIKYNNKEYKLPFDVELPEDPTVEVEIKNRFGGESTTLPEFAAA |
| Ga0114993_111819131 | 3300009409 | Marine | MKTIKYNNKNYKLPFDVQLPEDPTAEVEVKNRFSGESTTMPEFA |
| Ga0115545_12614793 | 3300009433 | Pelagic Marine | MKTIKYNNKEYKMPFDVELPEDPTVEVEIKNRFTG |
| Ga0115008_113771021 | 3300009436 | Marine | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFSGQSTTMPEFAAAV |
| Ga0115556_12655922 | 3300009437 | Pelagic Marine | MKTIKYNNKEYKLPFEVELPEDPTAEVEVKNRFSGQSTTMPEF |
| Ga0115560_11114685 | 3300009447 | Pelagic Marine | MKTIKYNNKDYKLPFDVQLPEDPTAEVTVKNRFSGQS |
| Ga0114932_104063764 | 3300009481 | Deep Subsurface | MGKLIKYNNKEYKLPFDVELPEDPTATDTVRNRFGG |
| Ga0114932_105507313 | 3300009481 | Deep Subsurface | MKTIKYNNKEYKLPFDVELPEDPTAEVEVKNRFSGQSTTMPEFAA |
| Ga0115571_14053082 | 3300009495 | Pelagic Marine | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEATTMPEFAAAVY |
| Ga0115569_103889983 | 3300009497 | Pelagic Marine | MTKTIKYNNKEYKLPFDVALPDDPTAEVEVKNRFSGQSTTMPEF |
| Ga0129286_102564433 | 3300009515 | Sediment | MKTIKYNNKEYKMPFDVELPEDPTVEVEVKNRFTG |
| Ga0114919_103469901 | 3300009529 | Deep Subsurface | MKTIKYNNKEYKMPFDVELPEDPTAEVEVKNRFGGE |
| Ga0114914_10735941 | 3300009601 | Deep Ocean | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEATTMPEFAVA |
| Ga0115012_105718321 | 3300009790 | Marine | MKTIKYNNKEYKLPFDVSLPEDPTAEVEVANRFSGE |
| Ga0115012_114405272 | 3300009790 | Marine | MKTIKYNNKEYKLPFDVALPDDPTAEVEIANRFSGEKTT |
| Ga0098043_10995051 | 3300010148 | Marine | MKTITYNNKQYKLPFDVELPEDPTAEVEVANRFSGQKTTM |
| Ga0098043_12098222 | 3300010148 | Marine | MKTITYNNKQYKLPFDVELPEDPTAEVEVANRFSG |
| Ga0098049_11976833 | 3300010149 | Marine | MKTIKYNNKEYKLPFDVELPEDPTAEVVIANRFSGQKTTMPEFAAAVY |
| Ga0098056_12177413 | 3300010150 | Marine | MGKLIKYNNKEYKLPFDVALPEDPTATDTVKNRFGGESCTL |
| Ga0098061_11588501 | 3300010151 | Marine | MKTITYNNKQYKLPFDVELPDNPIAEVEIANRFSGEKTTMPEFAAAVY |
| Ga0098061_13364491 | 3300010151 | Marine | MKTIKYNNKEYKLPFDVALPEDPTATDTVRNRFGGESCTLPAF |
| Ga0098059_11991231 | 3300010153 | Marine | MGKLIKYNNKEYKLPFDVALPDDPTATDTVRNRFGGE |
| Ga0098059_13293162 | 3300010153 | Marine | LIGLSYNKKGHMKTIKYNNKEYKLPFAVELPEDPTAEVEVKNRFSGQSTTMPEFAAAVYD |
| Ga0098047_102609043 | 3300010155 | Marine | MKTIKYKNKEYKLPFDVELPEDPTAEVEIANRFSGQKTTMPEFAAAVYDT |
| Ga0098047_103542181 | 3300010155 | Marine | MGKLIKYNNKEYKLPFDVALPEDPTATDTVRNRFGGESCTLPAF |
| Ga0118731_1127397581 | 3300010392 | Marine | MKTIKYKNKDYKLPFDVELPDDPTVEVTVKNRFSGQSTTMPEFAAA |
| Ga0160422_102324522 | 3300012919 | Seawater | MKTIKYKDKEYKLPFKVGLPEDPTTEEVVRNRFGG* |
| Ga0160422_108877602 | 3300012919 | Seawater | MKTITYNNKQYKLPFAVELPEDPTAEVEVKNRFSGQSTTMPEFA |
| Ga0160423_108892451 | 3300012920 | Surface Seawater | MKTITYNNKQYKLPFAVELPEDPTAEVEVKNRFSGQSTTMPEFAAAVYDVII |
| Ga0181372_10726631 | 3300017705 | Marine | MKTIKYNNKEYKLPFAVSLPEDETAIDTVRNRFGGE |
| Ga0181412_10397021 | 3300017714 | Seawater | MKTITYNNKQYKLPFDVALPDDPTAEVEIANRFSGEKTTMPE |
| Ga0181375_10238804 | 3300017718 | Marine | MKARNMKTIKYNGKEYRMPFHVALPDDPTATDTVKNRFGGESCTL |
| Ga0181390_10815254 | 3300017719 | Seawater | MKTIKYKNKDYKLPFDVELPDDPTVEVTVKNRFSGQSTTMPEFAAAVY |
| Ga0181373_10499041 | 3300017721 | Marine | MKTIKYNNKEYKLPFDVALPEAPTATDTVKKRFGGES |
| Ga0181431_11330562 | 3300017735 | Seawater | MKTITYNNKQYKLPFDVALPDDPTAEVEIDNRFSGEKTTMPEFAAA |
| Ga0187218_11603412 | 3300017737 | Seawater | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFNGEATTMPEFA |
| Ga0181421_10756914 | 3300017741 | Seawater | MKTITYNNKQYKLPFDVALPDDPTVEVEVKNRFSGQATTMPEFAAAVYDPIIGSEMMG |
| Ga0181392_12185783 | 3300017749 | Seawater | MELKTIEYNNKKIKMPFNVALPDDPTVEVEVKNRFSGQATTMPEFAAAVYD |
| Ga0187219_12271522 | 3300017751 | Seawater | MKTIKYKNKDYKLPFDVELPDDPTVEVTVKNRFSGQSTTMPEFAAAV |
| Ga0181408_11542673 | 3300017760 | Seawater | MKTITYNNKQYKLPFDVALPDDPTAEVEIANRFSGEKTTMPEFA |
| Ga0181607_106392182 | 3300017950 | Salt Marsh | MKTITYNNKEYKLPFEVGLSDDPTATETIANRFSG |
| Ga0181569_107974352 | 3300017986 | Salt Marsh | MKTIKYNNKEYKLPFDVELPEDPTAEVEVKNRFSGQS |
| Ga0193996_10461661 | 3300019728 | Sediment | MTKTITYNNKEYKLPFDVALPDNPTAEVEIANRFSGEKT |
| Ga0194023_10890991 | 3300019756 | Freshwater | MKNKTIKYNGKEYKLPFAVALSNEPTALTTVNNRFG |
| Ga0211510_10532844 | 3300020336 | Marine | MKTITYNNKQYKLPFDVELPEDPTAEVEVANRFSGEKT |
| Ga0211691_103356203 | 3300020447 | Marine | MKTIKYNNKEYKLPFDVELPEDPTVEVTVKNRFTGEAT |
| Ga0211503_104113643 | 3300020478 | Marine | MGKLIKYNNKEYKLPFDVELPEDPTATDTVRNRFGGE |
| Ga0222716_101971761 | 3300021959 | Estuarine Water | MKTITYNNKQYKLPFDVALPEDPTAEVEVKNRFSGQSTTMPEFAAA |
| Ga0212024_10157515 | 3300022065 | Aqueous | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEATTMPD |
| Ga0212024_10866692 | 3300022065 | Aqueous | MKTIKYNNKEYKLPFDVQLPEDPTAEVEVKNRFSG |
| Ga0196889_10932231 | 3300022072 | Aqueous | MKTIKYNDKEYKLPFDVELPEDPTVEVTVKNRFSGQSTTMP |
| Ga0196889_11069651 | 3300022072 | Aqueous | MKTIKYNNKDYKLPFDVQLPEDPTAEVTVKNRFSGQSTTMP |
| Ga0224906_11371183 | 3300022074 | Seawater | MKTIKYNNKEYKMPFDVALPDDPTVEVEVKNRFSGQATTMPEFAAAV |
| Ga0212022_10764131 | 3300022164 | Aqueous | MKTIKYNNKDYKLPFDVALPDDPTAEVEIANRFSGEKTTMPEFAAAVS |
| Ga0196903_10268031 | 3300022169 | Aqueous | MKTKTIKYNGKEYKLPFAVALSNEPTALTTVHNRFGGESCELPEF |
| Ga0196887_10387521 | 3300022178 | Aqueous | MKTIKYNDKEYKLPFDVELPEDPTVEVTVKNRFSGQSTTMPE |
| Ga0196887_10725421 | 3300022178 | Aqueous | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGE |
| Ga0196887_10784151 | 3300022178 | Aqueous | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEATTMPEF |
| Ga0196899_10829474 | 3300022187 | Aqueous | MKTIKYNNKEYKLPFDVALPDDPTAEVEVKNRFSGQSTTM |
| Ga0196899_11590571 | 3300022187 | Aqueous | MKTIKYNNKEYKLPFDVELPEDPTAEVEVKNRFSGQST |
| Ga0224498_102119991 | 3300022202 | Sediment | MKTIKYNNKEYKMPFDVELPEDPTAEVEIKNRFGGESTTLPEFAAAVYD |
| Ga0255768_101050201 | 3300023180 | Salt Marsh | MKTITYNNKEYKLPFEVGLSDDPTATETIANRFSGE |
| (restricted) Ga0255051_103505811 | 3300024057 | Seawater | MKTIKYNNKEYKLPFAVALPEDPTTMETIQNRFGGESCQL |
| Ga0228624_11001911 | 3300024313 | Seawater | MKTIKYNNKEYKLPFEVELPEDPTAEVEIANRFSGEKTKMPEFAA |
| Ga0209992_104468022 | 3300024344 | Deep Subsurface | MRTITYNNKQYKLPFDVELPEDPTAEVEIANRFSGEKT |
| (restricted) Ga0255045_100914575 | 3300024528 | Seawater | MKTIKYNNKEYKMPFDVELPEDPTAEVEIKNRFGGESTTLPEFAAAV |
| Ga0207905_10206405 | 3300025048 | Marine | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEATTMPEFA |
| Ga0207905_10257171 | 3300025048 | Marine | MKTIKYNNKDYKLPFDVALPDDPTVEVEVKNRFSGEST |
| Ga0207905_10420311 | 3300025048 | Marine | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEA |
| Ga0207905_10626331 | 3300025048 | Marine | MKTIKYNNKEYKLPFDVELPEDPTAEVEVKNRFSG |
| Ga0208667_10257194 | 3300025070 | Marine | MKTIKYNNKEYKLPFDVALPEDATATDTVRNRFGGESCT |
| Ga0207896_10470311 | 3300025071 | Marine | MKTIKYNNKEYKLPFDVELTQDPTAEVQIRNRFSG |
| Ga0207896_10672291 | 3300025071 | Marine | MKTIKYNNKDYKLPFDVELPEDPTAEVEVKNRFSGQSTTMPEFA |
| Ga0208920_10759321 | 3300025072 | Marine | MKTIKYNNKEYKLPFDVALPEDPTATDTVRNRFGGESCT |
| Ga0207890_10211246 | 3300025079 | Marine | MKTIKYNNKEYKLPFDVELTQDPTAEVQIRNRFSGEA |
| Ga0208792_10785201 | 3300025085 | Marine | MKTIKYNNKEYKLPFDVELPEDPTAEVVIANRFSGQKTTM |
| Ga0208157_10372951 | 3300025086 | Marine | MKTIKYNNKEYKLPFAVELPEDPTAEVEVKNRFSGQSTTMPE |
| Ga0208010_11000783 | 3300025097 | Marine | MKTIKYNDKEYKLPFDVALPEDPTATDTVRNRFGGESCTLPA |
| Ga0208434_10635651 | 3300025098 | Marine | MKTIKYNNKEYKLPFDVALPDNPTAEVEIANRFSGE |
| Ga0208669_11115771 | 3300025099 | Marine | MTKTITYNNKEYKLPFDVALPDDPTAEVEVKNRFSGQS |
| Ga0208666_10156896 | 3300025102 | Marine | MKTIKYNNKEYKLPFDVALPDDPTAEVEVKNRFSGQSTTMPEFAAAV |
| Ga0208666_10633271 | 3300025102 | Marine | MKTIKYNNKEYKLPFAVELPEDPTAEVEVKNRFSGQSTTMPEFA |
| Ga0208013_10692594 | 3300025103 | Marine | MNTNKKDIMKTIKYKNKEYKLPFAVGLPEDPTAEEVVHNRFGGESCTLPA |
| Ga0208013_11521521 | 3300025103 | Marine | MKTITYNNKQYKLPFDVELPEDPIAEVEIANRFSGEKTT |
| Ga0208793_11565233 | 3300025108 | Marine | MKTIKYNNKEYKLPFDVELPEDPTAEVVIANRFSGQKTTMP |
| Ga0208158_10809503 | 3300025110 | Marine | MKTITYNNKEYKLPFEVELPDNPIAEVEVANRFSGQKT |
| Ga0208158_10924941 | 3300025110 | Marine | MKTIKYNDKEYKLPFDVALPDDPTATDTVRNRFGGESCTL |
| Ga0209535_10320291 | 3300025120 | Marine | MKTIKYNNKDYKLPFDVALPDDPTAEVEVKNRFSGQS |
| Ga0209535_10832881 | 3300025120 | Marine | MKTIKYNNKDYKLPFDVALPDDPTAEVEVKNRFSGQST |
| Ga0209535_11147631 | 3300025120 | Marine | MKTIKYNNKEYKLPFDVALPDDPTAEVEVKNRFSGQSTTMPE |
| Ga0209535_11360951 | 3300025120 | Marine | MKTIKYNNKEYKLPFDVELPEDPTAEVEVKNRFSGQSTTMPE |
| Ga0209348_11510071 | 3300025127 | Marine | MKTITYNNKQYKLPFDVALPDDPTAEVEIANRFSGEKTTMP |
| Ga0208919_10843363 | 3300025128 | Marine | MELKTIEYNNKKIKMPFDVALPDDPTAEVEVKNRFSGQAT |
| Ga0209128_10748231 | 3300025131 | Marine | MQTITYNNKQYKLPFEVELPDNPIAEVEVANRFSGEKATMPEFA |
| Ga0209128_11304693 | 3300025131 | Marine | MKTIKYKNKEYKLPFEVGLPEDPTTEEKIQNRFGGESCT |
| Ga0209232_10747744 | 3300025132 | Marine | MTKTINYNNKKYKLPFAVALPDDPTTEEVVKNRFNGEG |
| Ga0209232_12034681 | 3300025132 | Marine | MKTITYNNKQYKLPFDVELPEDPTAEVEVANRFSGQKTTMPEFAAAV |
| Ga0208299_11800853 | 3300025133 | Marine | MKTIKYNDKEYKLPFDVALPEDPTATDTVRNRFGG |
| Ga0208299_12065693 | 3300025133 | Marine | MIDLSYIIPDMKTNMKTIKYNNKEYKLPFAVALPEDPTATDVVKNRFN |
| Ga0209336_101611661 | 3300025137 | Marine | MKTIKYNNKEYKLPFDVQLPEDPTAEVEVKNRFSGQSTTMPEFAAAVYDAI |
| Ga0209756_12560473 | 3300025141 | Marine | MKTIKYNNKEYKLPFDVALPDDPTATDTVKNRFGGES |
| Ga0209645_10558784 | 3300025151 | Marine | MKTIKYKNKEYKLPFAVGLPKDPTTEETVHNRFGGESCT |
| Ga0209645_10892344 | 3300025151 | Marine | MKTIKYKNKEYKLPFDVELPEDPTAEVVIANRFSGQKTTM |
| Ga0209337_12504951 | 3300025168 | Marine | MKTIKYNNKDYKLPFDVELPEDPTAEVEVKNRFSGQSTTMPEFAAAVY |
| Ga0209337_12787961 | 3300025168 | Marine | MKTIKYNNKEYKLPFAVALPKDPTTMEKVSNRFGGESCE |
| Ga0208032_10633064 | 3300025266 | Deep Ocean | METIKYNNKEYKLPFDVELPEDPTVEVTVKNRFSGQSTTMPEF |
| Ga0208813_10492283 | 3300025270 | Deep Ocean | MELKTIEYNNKKIKMPFDVALPDDPTVEVEVKNRFSGQAT |
| Ga0209557_10652491 | 3300025483 | Marine | MKTIKYNNKEYKMPFDVELPEDPTAEVEIKNRFGGESTTLPEFAAAVY |
| Ga0208148_10347585 | 3300025508 | Aqueous | MKTIKYKNKDYKLPFDVELPDDPTVEVTVKNRFSGQS |
| Ga0208303_10287135 | 3300025543 | Aqueous | MELKTIEYNNKKIKMPFDVALPDDPTVEVEVKNRFSGQATTM |
| Ga0208660_11292191 | 3300025570 | Aqueous | MKTIKYNNKEYKLPFDVELPEDPTAEVEVKNRFSGQSTTMPEFAAA |
| Ga0209194_10936353 | 3300025632 | Pelagic Marine | MTKTIKYNNKEYKLPFDVALPDDPTAEVEVKNRFSGQ |
| Ga0208643_10662484 | 3300025645 | Aqueous | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEAT |
| Ga0208643_10948914 | 3300025645 | Aqueous | MKTIKYNNKDYKLPFDVELPEDPTVEVEVKNRFTGEATTMP |
| Ga0208643_10999501 | 3300025645 | Aqueous | MKTIKYNNKDYKLPFDVELPEDPTAEVEVKNRFSGQSTTMP |
| Ga0209306_11700613 | 3300025680 | Pelagic Marine | MKTIKYNNKEYKMPFDVELPEDPTVEVEVKNRFTGEA |
| Ga0208150_12281041 | 3300025751 | Aqueous | MKTIKYNNKEYKMPFDVELPEDPTAEVEVKNRFGGESTTLPEFAAAVYDT |
| Ga0208899_12012731 | 3300025759 | Aqueous | MKTIKYNNKDYKLPFDVELPEDPTAEVEVKNRFSGQSTTMPEFAAAVYDA |
| Ga0208767_12759811 | 3300025769 | Aqueous | MKTIKYNNKEYKLPFDVELPEDATAEVEVKNRFTGEATTMP |
| Ga0208545_10230651 | 3300025806 | Aqueous | MKTIKYNNKDYKLPFDVELPEDPTAEVTVKNRFSGQSTTMP |
| Ga0208917_10947501 | 3300025840 | Aqueous | MKTIKYNNKEYKMPFDVELPEDPTVEVEVKNRFTGE |
| Ga0208917_12793813 | 3300025840 | Aqueous | MKTIKYNNKEYKLPFDVALPDDPTAEVEVKNRFSGQSTT |
| Ga0209632_102075944 | 3300025886 | Pelagic Marine | MKTIKYNNKEYKLPFEVALPDDPTVEVEVKNRFSGQAT |
| Ga0208644_13320681 | 3300025889 | Aqueous | MKTIKYNNKDYKLPFDVQLPEDPTAEVTVKNRFSGQ |
| Ga0207992_11308821 | 3300026263 | Marine | MKTIKYKNKEYKLPFDVELPEDPTAEVVIANRFSGQKTTMPEFAAAVYD |
| Ga0209830_102184224 | 3300027791 | Marine | MKTIKYNNKEYKMPFDVELPEDPTVEVEVKNRFSGESTTMPEFAA |
| (restricted) Ga0233413_101983831 | 3300027996 | Seawater | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFSGESTT |
| (restricted) Ga0233414_101228765 | 3300028045 | Seawater | MKTIKYNNKEYKLPFAVALPEDPTTMETIQNRFGGESCQLPAFA |
| Ga0256368_10472351 | 3300028125 | Sea-Ice Brine | MKTIKYNNKDYKLPFDVELPEDPTAEVTVKNRFSGQSTTMPEFPSS |
| Ga0257114_10690921 | 3300028196 | Marine | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEKTTMPEFAAAVYDTIIGSEMFGDYNTVRKG |
| Ga0257121_10066651 | 3300028198 | Marine | MKTIKYNNKEYKLPFDVELPEDPTAEVEVKNRFSGQ |
| Ga0307488_100924481 | 3300031519 | Sackhole Brine | MKTIKYNNKDYKLPFDVELPEDPTAEVTVKNRFSGQS |
| Ga0307488_103191841 | 3300031519 | Sackhole Brine | MKTIKYNNKEYKMPFDVELPEDPTVEVEVKNRFSGESTTMPE |
| Ga0307488_103654011 | 3300031519 | Sackhole Brine | MKTIKYNNKEYKLPFDVELPEDATAEVEVKNRFSGESTTMPE |
| Ga0307488_105383933 | 3300031519 | Sackhole Brine | MKTIKYNNKEYKMPFDVELPEDPTVEVEVKNRFSGE |
| Ga0307488_108049652 | 3300031519 | Sackhole Brine | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEATTMP |
| Ga0302131_11657943 | 3300031594 | Marine | MKTIKYNNKEYKMPFDVELPEDPTVEVEVKNRFSGESTTMPEFAAAVY |
| Ga0316208_10815801 | 3300032254 | Microbial Mat | MKTIKYNNKEYKMPFDVALPDDPTVEVEVKNRFSGQATTMPEFAAAVYD |
| Ga0316202_102455553 | 3300032277 | Microbial Mat | MKTIKYNNKEYKLPFDVELPEDPTVEVTVKNRFSGQSTTM |
| Ga0316202_103578451 | 3300032277 | Microbial Mat | MKTIKYNNKEYKLPFDVELPEDPTAEVTVKNRFSGQSTTMPEF |
| Ga0316204_111491211 | 3300032373 | Microbial Mat | MKTIKYNNKEYKLPFDVELPEDPTVEVEIKNRFSGES |
| Ga0316204_111917411 | 3300032373 | Microbial Mat | MKTIKYNNKEYKLPFDVALPDDPTAEVEVKNRFSGQST |
| Ga0314858_082655_2_130 | 3300033742 | Sea-Ice Brine | MKTIKYNNKEYKLPFDVELPEDATAEVEVKNRFSGESTTMPDL |
| Ga0314858_129670_522_644 | 3300033742 | Sea-Ice Brine | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEAIPPL |
| Ga0314858_134822_1_111 | 3300033742 | Sea-Ice Brine | MKTIKYNNKDYKLPFDVELPEDPTVEVEVKNRFTGEA |
| Ga0348337_182883_427_543 | 3300034418 | Aqueous | MKTIKYNNKEYKLPFDVELPEDPTVEVEVKNRFTGEATT |
| ⦗Top⦘ |