NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F024200

Metagenome / Metatranscriptome Family F024200

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F024200
Family Type Metagenome / Metatranscriptome
Number of Sequences 207
Average Sequence Length 159 residues
Representative Sequence GAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Number of Associated Samples 164
Number of Associated Scaffolds 207

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 4.37 %
% of genes near scaffold ends (potentially truncated) 74.88 %
% of genes from short scaffolds (< 2000 bps) 99.52 %
Associated GOLD sequencing projects 158
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (89.855 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(20.773 % of family members)
Environment Ontology (ENVO) Unclassified
(62.802 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(74.879 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.68%    β-sheet: 0.00%    Coil/Unstructured: 46.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.86 %
UnclassifiedrootN/A10.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000127|SA_S1_NOR05_45mDRAFT_c10059405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum948Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10087128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1162Open in IMG/M
3300000243|SA_S2_NOR18_50mDRAFT_1065496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300003216|JGI26079J46598_1033790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1144Open in IMG/M
3300003345|JGI26080J50196_1048915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum820Open in IMG/M
3300003683|Ga0008459J53047_1027851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum679Open in IMG/M
3300003718|Ga0008277_122496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300005942|Ga0070742_10202995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300006165|Ga0075443_10084068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1087Open in IMG/M
3300006397|Ga0075488_1575341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum789Open in IMG/M
3300006400|Ga0075503_1575256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum811Open in IMG/M
3300006401|Ga0075506_1709870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300006419|Ga0075496_1363858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum827Open in IMG/M
3300007972|Ga0105745_1300582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300009024|Ga0102811_1227705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum696Open in IMG/M
3300009028|Ga0103708_100054354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum890Open in IMG/M
3300009049|Ga0102911_1056353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1144Open in IMG/M
3300009055|Ga0102905_1049574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani835Open in IMG/M
3300009071|Ga0115566_10206481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1196Open in IMG/M
3300009071|Ga0115566_10221768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1144Open in IMG/M
3300009077|Ga0115552_1099145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1262Open in IMG/M
3300009263|Ga0103872_1005157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1104Open in IMG/M
3300009263|Ga0103872_1009829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum961Open in IMG/M
3300009265|Ga0103873_1002002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1799Open in IMG/M
3300009265|Ga0103873_1035450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum910Open in IMG/M
3300009434|Ga0115562_1084669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1292Open in IMG/M
3300009434|Ga0115562_1190835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum739Open in IMG/M
3300009436|Ga0115008_10242882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1282Open in IMG/M
3300009472|Ga0115554_1431714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum514Open in IMG/M
3300009476|Ga0115555_1175509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani890Open in IMG/M
3300009497|Ga0115569_10122451Not Available1280Open in IMG/M
3300009498|Ga0115568_10309818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300009543|Ga0115099_10401763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani744Open in IMG/M
3300009599|Ga0115103_1611110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum750Open in IMG/M
3300009599|Ga0115103_1765279Not Available684Open in IMG/M
3300009606|Ga0115102_10266403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum793Open in IMG/M
3300009606|Ga0115102_10372714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum765Open in IMG/M
3300009606|Ga0115102_10520659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum819Open in IMG/M
3300009606|Ga0115102_10911763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani757Open in IMG/M
3300009608|Ga0115100_10263183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani764Open in IMG/M
3300009677|Ga0115104_10012566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani735Open in IMG/M
3300009677|Ga0115104_10223222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum929Open in IMG/M
3300010368|Ga0129324_10309531Not Available620Open in IMG/M
3300012418|Ga0138261_1006719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani714Open in IMG/M
3300012472|Ga0129328_1101294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani811Open in IMG/M
3300012504|Ga0129347_1066818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum880Open in IMG/M
3300012520|Ga0129344_1143945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum700Open in IMG/M
3300012522|Ga0129326_1323400Not Available917Open in IMG/M
3300012524|Ga0129331_1008229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani873Open in IMG/M
3300012528|Ga0129352_10346780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum883Open in IMG/M
3300012954|Ga0163111_10391903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1258Open in IMG/M
3300012954|Ga0163111_12329581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300012963|Ga0129340_1216818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300012963|Ga0129340_1279338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum914Open in IMG/M
3300012966|Ga0129341_1046496Not Available592Open in IMG/M
3300012966|Ga0129341_1367391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum687Open in IMG/M
3300012967|Ga0129343_1010837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum913Open in IMG/M
3300012967|Ga0129343_1151227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani633Open in IMG/M
3300012967|Ga0129343_1441538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum753Open in IMG/M
3300012969|Ga0129332_1403246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani850Open in IMG/M
3300012970|Ga0129338_1065867Not Available527Open in IMG/M
3300016729|Ga0182056_1111211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300016729|Ga0182056_1372576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum848Open in IMG/M
3300016732|Ga0182057_1212717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300016732|Ga0182057_1237275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum885Open in IMG/M
3300016734|Ga0182092_1259885Not Available551Open in IMG/M
3300016737|Ga0182047_1515923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300016742|Ga0182052_1353631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum759Open in IMG/M
3300016748|Ga0182043_1336336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum842Open in IMG/M
3300016749|Ga0182053_1093276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300016754|Ga0182072_1246066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum831Open in IMG/M
3300016766|Ga0182091_1530964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum888Open in IMG/M
3300017950|Ga0181607_10457359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300017952|Ga0181583_10780069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300017986|Ga0181569_10767048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300018426|Ga0181566_10358659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1044Open in IMG/M
3300018599|Ga0188834_1011699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum904Open in IMG/M
3300018599|Ga0188834_1014404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum821Open in IMG/M
3300018601|Ga0188850_1015640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani702Open in IMG/M
3300018665|Ga0188882_1017480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300018692|Ga0192944_1018696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani964Open in IMG/M
3300018692|Ga0192944_1032171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum760Open in IMG/M
3300018730|Ga0192967_1023585Not Available992Open in IMG/M
3300018742|Ga0193138_1031692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani694Open in IMG/M
3300018745|Ga0193000_1037105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani735Open in IMG/M
3300018765|Ga0193031_1022278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum943Open in IMG/M
3300018765|Ga0193031_1030881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum843Open in IMG/M
3300018825|Ga0193048_1038350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani725Open in IMG/M
3300018831|Ga0192949_1046920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani880Open in IMG/M
3300018832|Ga0194240_1013421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300018836|Ga0192870_1054515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium687Open in IMG/M
3300018846|Ga0193253_1066094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani885Open in IMG/M
3300018976|Ga0193254_10079207Not Available765Open in IMG/M
3300018980|Ga0192961_10089258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani928Open in IMG/M
3300018980|Ga0192961_10089706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum926Open in IMG/M
3300018982|Ga0192947_10102256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum949Open in IMG/M
3300018989|Ga0193030_10094528Not Available908Open in IMG/M
3300018989|Ga0193030_10129602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum803Open in IMG/M
3300018989|Ga0193030_10185763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum682Open in IMG/M
3300018989|Ga0193030_10235098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300019010|Ga0193044_10136063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani806Open in IMG/M
3300019021|Ga0192982_10089149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1010Open in IMG/M
3300019021|Ga0192982_10121884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum891Open in IMG/M
3300019022|Ga0192951_10157780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum805Open in IMG/M
3300019032|Ga0192869_10185847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum877Open in IMG/M
3300019032|Ga0192869_10197936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum853Open in IMG/M
3300019036|Ga0192945_10087922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum965Open in IMG/M
3300019036|Ga0192945_10090429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum953Open in IMG/M
3300019036|Ga0192945_10164169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum716Open in IMG/M
3300019048|Ga0192981_10148251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani927Open in IMG/M
3300019095|Ga0188866_1011853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum878Open in IMG/M
3300019095|Ga0188866_1013625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum831Open in IMG/M
3300019095|Ga0188866_1034024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300019116|Ga0193243_1026653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum779Open in IMG/M
3300019131|Ga0193249_1081737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum763Open in IMG/M
3300019200|Ga0180036_1024842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum949Open in IMG/M
3300019261|Ga0182097_1369919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum879Open in IMG/M
3300019274|Ga0182073_1049707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum732Open in IMG/M
3300020014|Ga0182044_1069218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum880Open in IMG/M
3300021325|Ga0210301_1030009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum887Open in IMG/M
3300021359|Ga0206689_10144770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum853Open in IMG/M
3300021872|Ga0063132_102710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum827Open in IMG/M
3300021872|Ga0063132_114796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300021874|Ga0063147_133909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300021902|Ga0063086_1018458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum841Open in IMG/M
3300021902|Ga0063086_1061574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium848Open in IMG/M
3300021913|Ga0063104_1064207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300021921|Ga0063870_1043866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300021921|Ga0063870_1061633Not Available641Open in IMG/M
3300021922|Ga0063869_1042106Not Available855Open in IMG/M
3300021924|Ga0063085_1027862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum751Open in IMG/M
3300021924|Ga0063085_1027933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum863Open in IMG/M
3300021924|Ga0063085_1046701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani801Open in IMG/M
3300021926|Ga0063871_1101880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300021930|Ga0063145_1046842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani809Open in IMG/M
3300021930|Ga0063145_1114603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300021939|Ga0063095_1070471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300021939|Ga0063095_1156962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum689Open in IMG/M
3300021942|Ga0063098_1123931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300021962|Ga0222713_10566606Not Available668Open in IMG/M
3300023175|Ga0255777_10273949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum968Open in IMG/M
3300023679|Ga0232113_1024981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300023685|Ga0228686_1025445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum804Open in IMG/M
3300025680|Ga0209306_1057160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1237Open in IMG/M
3300025699|Ga0209715_1089624Not Available1166Open in IMG/M
3300025712|Ga0209305_1139706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300025897|Ga0209425_10400047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300026448|Ga0247594_1038010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani819Open in IMG/M
3300026500|Ga0247592_1087455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300027188|Ga0208921_1043799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum660Open in IMG/M
3300027416|Ga0207994_1109533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300028137|Ga0256412_1114975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum984Open in IMG/M
3300028137|Ga0256412_1142873Not Available882Open in IMG/M
3300028233|Ga0256417_1087720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum840Open in IMG/M
3300028282|Ga0256413_1148550Not Available850Open in IMG/M
3300028282|Ga0256413_1193205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani731Open in IMG/M
3300028282|Ga0256413_1308960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300028290|Ga0247572_1060737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani910Open in IMG/M
3300030670|Ga0307401_10580578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300030671|Ga0307403_10394625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum743Open in IMG/M
3300030699|Ga0307398_10306188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum862Open in IMG/M
3300030709|Ga0307400_10469785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium796Open in IMG/M
3300030720|Ga0308139_1075309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300030723|Ga0308129_1013524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum875Open in IMG/M
3300030725|Ga0308128_1015978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum884Open in IMG/M
3300030857|Ga0073981_11666139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300031004|Ga0073984_11258842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300031032|Ga0073980_11395149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum797Open in IMG/M
3300031037|Ga0073979_10010131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum876Open in IMG/M
3300031062|Ga0073989_13450087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300031522|Ga0307388_10436005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum854Open in IMG/M
3300031621|Ga0302114_10105328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1292Open in IMG/M
3300031729|Ga0307391_10384831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum775Open in IMG/M
3300031734|Ga0307397_10183370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum919Open in IMG/M
3300032463|Ga0314684_10198926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1115Open in IMG/M
3300032463|Ga0314684_10388367Not Available819Open in IMG/M
3300032481|Ga0314668_10277345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani865Open in IMG/M
3300032491|Ga0314675_10145431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1125Open in IMG/M
3300032492|Ga0314679_10202090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum907Open in IMG/M
3300032517|Ga0314688_10278510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani885Open in IMG/M
3300032518|Ga0314689_10383702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium739Open in IMG/M
3300032519|Ga0314676_10479047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani740Open in IMG/M
3300032522|Ga0314677_10410755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani723Open in IMG/M
3300032540|Ga0314682_10294109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani887Open in IMG/M
3300032615|Ga0314674_10258617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani900Open in IMG/M
3300032616|Ga0314671_10234737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani986Open in IMG/M
3300032650|Ga0314673_10341010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani764Open in IMG/M
3300032666|Ga0314678_10165720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum943Open in IMG/M
3300032707|Ga0314687_10303025Not Available869Open in IMG/M
3300032707|Ga0314687_10358941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum802Open in IMG/M
3300032709|Ga0314672_1206687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani737Open in IMG/M
3300032713|Ga0314690_10198844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum969Open in IMG/M
3300032714|Ga0314686_10284669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum822Open in IMG/M
3300032714|Ga0314686_10322601Not Available770Open in IMG/M
3300032724|Ga0314695_1138683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum909Open in IMG/M
3300032725|Ga0314702_1152379Not Available864Open in IMG/M
3300032729|Ga0314697_10166278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani961Open in IMG/M
3300032730|Ga0314699_10206090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium866Open in IMG/M
3300032732|Ga0314711_10336375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani782Open in IMG/M
3300032742|Ga0314710_10180279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani850Open in IMG/M
3300032746|Ga0314701_10161035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum986Open in IMG/M
3300032746|Ga0314701_10249589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium801Open in IMG/M
3300032747|Ga0314712_10221850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum896Open in IMG/M
3300032750|Ga0314708_10230822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani904Open in IMG/M
3300032755|Ga0314709_10437120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum805Open in IMG/M
3300033572|Ga0307390_10764039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine20.77%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine18.36%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater14.98%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.18%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh9.18%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.80%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.31%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.38%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.90%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.93%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine1.45%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.97%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.97%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.97%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.97%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.48%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.48%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.48%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.48%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.48%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.48%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000127Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45mEnvironmentalOpen in IMG/M
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000243Svalbard Archipelago station 2 sample NOR 18_50mEnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003345Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNAEnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003718Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016729Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016742Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016749Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018601Metatranscriptome of marine microbial communities from Baltic Sea - GS679_3p0_dTEnvironmentalOpen in IMG/M
3300018665Metatranscriptome of marine microbial communities from Baltic Sea - LD30M_ls2EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021325Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021926Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 ARK-20-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023175Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaGEnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027416Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032729Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SA_S1_NOR05_45mDRAFT_1005940513300000127MarineQVEYAPISDESLVQTGEPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIFGALKKKGTKNLPKLQVKTWDLFDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVRTNLLTKYRDGEFVDPATFDPKAEIDA*
SA_S2_NOR15_50mDRAFT_1008712823300000130MarineMKYTTVLLLIGAVAASQVEYAPISDESLVQTGEPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIFGALKKKGTKNLPKLQVKTWDLFDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVRTNLLTKYRDGEFVDPATFDPKAEIDA*
SA_S2_NOR18_50mDRAFT_106549613300000243MarineVLLLIGAVAASQVEYAPISDESLVQTGEPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIFGALKKKGTKNLPKLQVKTWDLFDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVRTNLLTKYRDGEFVDPATFDPKAEIDA*
JGI26079J46598_103379023300003216MarineMKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHSALVKKGTKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGXFVDPALYDPKDEENK*
JGI26080J50196_104891513300003345MarineMKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHSALVKKGTKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK*
Ga0008459J53047_102785113300003683SeawaterRYQMKYTTLLLLIGVIAATQVESQTAIAAESAATTEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNLFKALKEKGTGNLPKLQVKTWELYDKSFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTVHMENFLRVANTVRTNLLTKYHDGEFSDPALVDPKVEAKKEKTW*
Ga0008277_12249613300003718MarineTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHSALVKKGTKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK*
Ga0070742_1020299513300005942EstuarinePIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHSALVKKGTKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK*
Ga0075443_1008406813300006165MarineMKFSTLLLLIGAAAASQVDAENLVNAVQATKAHDPCVYLTEDIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPASFDPKAEAAAAAAAK*ERN*VLRAQLM*VNVTTQINIKLFVNLHK*
Ga0075488_157534123300006397AqueousMEMFSRTLDPRHWTNVQNISKALKEKGVKNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAKAALKA*
Ga0075503_157525623300006400AqueousAATQVESSTAVASETATQVEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNLYKALKEKGTGNLPKLQVKTWELYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNSVHMENFLRVANTVRTNLLTKYHDGEFSDPALVDPKVEAKKEKTW*
Ga0075506_170987013300006401AqueousGVIAATQVESSTAVASETATSVEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNLYKALKEKGTGNLPKLQVKTWELYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNSVHMENFLRVANTVRTNLLTKYHDGEFSDPALVDPKVEAKKEKTW*
Ga0075496_136385813300006419AqueousQVEYAPIADETLVQTSQDAPCVYLDETVGELEYQLEMFSRTLDPRHWTNVQNIHSALVKKGAKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK*
Ga0105745_130058213300007972Estuary WaterMKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHSALVKKGTKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTN
Ga0102811_122770513300009024EstuarineMKYTTIIALIGAVAASQVEYAPISDETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHSALVKKGTKNLPKLQVNTWGLYDKAFSFPRIRRYNYVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK*
Ga0103708_10005435413300009028Ocean WaterMEMFSRTLDPRHWTNVQNLSKQLKEKGVANVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFDDPADTDPKVEAEKAAAALKA*
Ga0102911_105635313300009049EstuarineMKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHSALVKKATKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK*
Ga0102905_104957413300009055EstuarineMFSRTLDPRHWTNVQNIHSALVKKATKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK*
Ga0115566_1020648113300009071Pelagic MarineMKFQTLILLFGAASAASVDSLNLANAQAPCVYLDETPAELDYQMEMFSRTLDPRHWTNVQNIAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFEDNLNMNISNEVAMENFLRVANTVHTNLATKYHDGEFIDPALTDPKVEAEKAAAALKA*
Ga0115566_1022176813300009071Pelagic MarineMKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQLEMFSRTLDPRHWTNVQNIHSALVKKGAKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK*
Ga0115552_109914513300009077Pelagic MarineMKFQTLILLFGAASAASVDSLNLANAQAPCVYLDETPAELDYQMEMFSRTLDPRHWTNVQNIAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFEDNLNMNISNEVAMENFLRVANTVHTNLATKYHDGEFIDPANTDPKVEAEKAAAALKA*
Ga0103872_100515723300009263Surface Ocean WaterIAATQVESSTAIASETANTVEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNLYKALKEKGTGNLPKLQVKTWELYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNSVHMENFLRVANTVRTNLLTKYHDGEFSDPALVDPKVEAKKEKTW*
Ga0103872_100982913300009263Surface Ocean WaterMKFTTILLFAGAVAASQVEYAPVADHTLVQTDAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALTKKGTKNLPKLQVRTWDLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNSIHMENFLRVANTVRTNLLTKYHDGEFIDPALYDPKKDEENK*
Ga0103873_100200223300009265Surface Ocean WaterMLLLVGVIAATQVESSTAIASETANTVEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNLYKALKEKGTGNLPKLQVKTWELYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNSVHMENFLRVANTVRTNLLTKYHDGEFSDPALVDPKVEAKKEKTW*
Ga0103873_103545013300009265Surface Ocean WaterAGAVAASQVEYAPVADHTLVQTDAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALTKKGTKNLPKLQVRTWDLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNSIHMENFLRVANTVRTNLLTKYHDGEFIDPALYDPKKDEENK*
Ga0115562_108466923300009434Pelagic MarineMKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK*
Ga0115562_119083523300009434Pelagic MarineMKFGTLILLLGAAAASNVETTTLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVATTVKTNLATKYHDGEFVDPADLDPKVEA
Ga0115008_1024288223300009436MarineMKFGTLILLLGAAAASNVETTTLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVATTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA*
Ga0115554_143171413300009472Pelagic MarineIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQLEMFSRTLDPRHWTNVQNIHSALVKKGTKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK*
Ga0115555_117550913300009476Pelagic MarineYQMEMFSRTLDPRHWTNVQNIAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFEDNLNMNISNEVAMENFLRVANTVHTNLATKYHDGEFIDPANTDPKVEAEKAAAALKA*
Ga0115569_1012245123300009497Pelagic MarineMKFQTLLLLIGAAAAAQVDASALAEPAPVAALEPCVYLDESVGELEYQMEMFSRTLDPRHWTNVQNIYAKLKAKGTKDLPKLAVKTWELYDKSFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTNLATKYHDGEFVDPAGLDPKAAAAAAKAAA*
Ga0115568_1030981813300009498Pelagic MarineMKFQTLLLLIGAAAAAQVDASALAEPAPVAALEPCVYLDESIGGLEYQMEMFSRTLDPRHWTNVQNIYAKLKAKGTKDLPKLAVKTWELYDKSFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTN
Ga0115099_1040176313300009543MarineQMEMFSRTLDPRHWTNVQNIAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFEDNLNMNISNEVALEIFLRVANTVHTNLATKYHDGEFIDPANTDPKVEAEKAAAALKA*
Ga0115103_161111013300009599MarineTLLLLIGVIAATQVESQTAIAAESAATTEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNLFKALKEKGTGNLPKLQVKTWELYDKSFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTVHMENFLRVANTVRTNLLTKYHDGEFSDPALVDPKVEAKKEKTW*
Ga0115103_176527923300009599MarineKFSTLLLLIGAAAASQVDTENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHEALFKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK*
Ga0115102_1026640313300009606MarineLDMKFQTLILLFGAASAASVDSLNLANAQAPCVYLDETPAELDYQMEMFSRTLDPRHWTNVQNIAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFEDNLNMNISNEVAMENFLRVANTVHTNLATKYHDGEFIDPANTDPKVEAEKAAAALKA*
Ga0115102_1037271413300009606MarineMKYTTLLLLIGVIAATQVESQTAIAAESAATTEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNLFKALKEKGTGNLPKLQVKTWELYDKSFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTVHMENFLRVANTVRTNLLTKYHDGEFSDPALVDPKVEAKKEKTW*
Ga0115102_1052065913300009606MarineKFGTLILLIGAAAAANVETTSLETTAIKGPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVTGVPKLAVKSWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAAAALKA*
Ga0115102_1091176313300009606MarineIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK*
Ga0115100_1026318313300009608MarineKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK*
Ga0115104_1001256613300009677MarinePRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNLNTNISNQVNMENFLRVANTVRTNLKTKYHDGEFVDPAGFDPKAEAAAAAAAK*
Ga0115104_1022322213300009677MarineMKFQTLILLLGAAAASTVDTHNLANAVEGAKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKTKGASGAPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAAAALKA*
Ga0129324_1030953113300010368Freshwater To Marine Saline GradientSSAVQAAQPADETLVQTEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIYGALKKKGTKQIPKLQVKTWDLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNSVHMENFLRVANTVRTNLLTKYHDGEFVDPALFDPKAEENK*
Ga0138261_100671913300012418Polar MarinePRHWTNVQNIHEALAKKGNKDLPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNTNISNKINMENFLRVANTVKTNLATKYHDGEFVDPASFDPKAEAAAAAAK*
Ga0129328_110129413300012472AqueousAAAASQVDAENLVNAVQSTQAPCVYLTEDIGELEYQLEMFSRTFDPRHWTNAQNLHEALAKKGTKDIPKLQVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNTNISNKVNMENFLRVANTVRTNLATKYHDGEFVDPASFDPKAEAAAAAAAL*
Ga0129347_106681823300012504AqueousMEMFSRTLDPRHWTNVQNLSKALKEKGVKNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAKAALKA*
Ga0129344_114394513300012520AqueousLFLLGAVAATQAEASQAVDLARPADETLVQTEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIYGALKKKGAKNLPKLQVKTWELFDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTVHMENFLRVANTVRTNLLTKYHDGEFVDPALYDPKKEEK*
Ga0129326_132340013300012522AqueousMKYTSLLLLIGAVAATQVESSSAVQAAQPADETLVQTEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIYGALKKKGTKQIPKLQVKTWDLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNSVHMENFLRVANTVRTNLLTKYHDGEFVDPALFDPKAEENK*
Ga0129331_100822913300012524AqueousKFSTLLLLIGAAAASQVDAENLVNAVQSTQAPCVYLTEDIGELEYQLEMFSRTFDPRHWTNAQNLHEALAKKGTKDIPKLQVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNTNISNKVNMENFLRVANTVRTNLATKYHDGEFVDPASFDPKAEAAAAAAAL*
Ga0129352_1034678023300012528AqueousMEMFSRTLDPRHWTNVQNLSKALKEKGVKNVPKLSVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAKAALKA*
Ga0163111_1039190313300012954Surface SeawaterMKFHTLLLLIGAAAASQVDASNLVSAVESSNASDPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGAKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVRTNLKTKYHDGEFIDPADTDPKAVAAAAKAAAA*
Ga0163111_1232958113300012954Surface SeawaterDPRHWTNVQNISAALKSKGVANVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVAMENFLRVANTVHTNLKTKYHDGEFIDPADTDPKAEAEKAAAALKA*
Ga0129340_121681813300012963AqueousYQMEMFSRTLDPRHWTNVQNIYGALKKKGAKNLPKLQVKTWELFDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTVHMENFLRVANTVRTNLLTKYHDGEFVDPALYDPKKEEK*
Ga0129340_127933813300012963AqueousDNLKMKFSAILLLLSVVSAAQVESSSAIQVSTTVDQTVNAQAPCVYLDETVAELEYQMEMFSRTLDPRHWTNVQNIHNALVAKGTKNIPKLQVRTWELLDKAFSFPRIRRYNFVAENMDMLEHFQDNLNMNISNSVHMENFLRVANTVKNNLATKYHDGEFTDPATYDPKLDEESPLYTGPRTK*
Ga0129341_104649613300012966AqueousKYTTVLLLLGAVAATQVEYAPIADEALVQTEAPCVYLDETNGELEYQMEMFSRTLDPRHWTNVLNIHDALKKKGANNIPKLAVKTWELYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNSVHMENFLRVANTVRTNLLTKYHDGEFVDPATYDPKEEEDK*
Ga0129341_136739113300012966AqueousLKMKFSAILLLLSVVSAAQVESSSAIQVSTTVDQTVNAQAPCVYLDETVAELEYQMEMFSRTLDPRHWTNVQNIHNALVAKGAKNIPKLQVRTWELLDKAFSFPRIRRYNFVAENMDMLEHFQDNLNMNISNSVHMENFLRVANTVKNNLATKYHDGEFTDPATYDPKLDEESPLYTGPRTK*
Ga0129343_101083713300012967AqueousDNLKMKFSAILLLLSVVSAAQVESSSAIQVSTTVDQTVNAQAPCVYLDETVAELEYQMEMFSRTLDPRHWTNVQNIHNALVAKGAKNIPKLQVRTWELLDKAFSFPRIRRYNFVAENMDMLEHFQDNLNMNISNSVHMENFLRVANTVKNNLATKYHDGEFTDPATYDPKLDEESPLYTGPRTK*
Ga0129343_115122713300012967AqueousSRTLDPRHWTNVQNLYKALKEKGTKNLPKLQVKTWELYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNSVHMENFLRVANTVRTNLLTKYHDGEFVDPATYDPKEEEDK*
Ga0129343_144153813300012967AqueousLLFLLGAVAATQAEASQAVDLARPADETLVQTEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIYGALKKKGAKNLPKLQVKTWELFDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTVHMENFLRVANTVRTNLLTKYHDGEFVDPALYDPKKEEK*
Ga0129332_140324613300012969AqueousSTLLLLIGAAAASQVDAENLVNAVQSTQAPCVYLTEDIGELEYQLEMFSRTFDPRHWTNAQNLHEALAKKGTKDIPKLQVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNTNISNKVNMENFLRVANTVRTNLATKYHDGEFVDPASFDPKAEAAAAAAAL*
Ga0129338_106586713300012970AqueousMKYTSLLLLIGVAAATQVEYPAIADETLVQTNGPCVYLEESVGELEYQMEMFSRTLDPRHWTNVLNIYDALKKKGTKSLPKLQVKTWDLYDKAFTFPRIRRYNFVCENMDMLEHFQDNLNTNISNSVHMENFLRVANTVRTNLLTKYHDGEFVDPALYDPKADK*
Ga0182056_111121113300016729Salt MarshAPCVYLDETPAELDYQMEMFSRTLDPRHWTNVQNISKALKEKGGKNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAKAALKA
Ga0182056_137257613300016729Salt MarshIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGTKNIPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKVEEEKNK
Ga0182057_121271723300016732Salt MarshMEMFSRTLDPRHWTNVQNISKALKEKGGKNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAKAALKA
Ga0182057_123727513300016732Salt MarshAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGTKNIPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKVEEEKNK
Ga0182092_125988513300016734Salt MarshYTSLILLAGAVAASQVEYAPISDETLLQTEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVLNIHDALKKKGTKNVPKLSVKTWELYDKAFSFPRIRRYNFVCENMDMLEHFEDNLNTNISNTVHMEKFLRVANTVRTNLLTKYHDGEFVDPATYDPKEELEK
Ga0182047_151592313300016737Salt MarshMEMFSRTLDPRHWTNVQNIHAALGKKGTKNIPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKEEEEKNK
Ga0182052_135363123300016742Salt MarshVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALGKKGTKNIPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKVEEENNK
Ga0182043_133633613300016748Salt MarshILMLLGAVAATQLEIAPIADESLVQVEAPCVYLDETIGELEYQMEMFSRTLDPRHWTNVINIHDALKKKGANNIPKLSVKTWELFDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTVHMENFLRVANTVRTNLLTKYHDGEFVDPATYDPKDEENK
Ga0182053_109327613300016749Salt MarshMKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALGKKGTKNIPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKVEEE
Ga0182072_124606613300016754Salt MarshATQVEYAPVADETLVQTGAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHNALVAKGSKNIPKLQVRTWELLDKAFSFPRIRRYNFVAENMDMLEHFQDNLNMNISNSVHMENFLRVANTVKNNLATKYHDGEFTDPATYDPKLDEESPLYTGPRTK
Ga0182091_153096413300016766Salt MarshTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGTKNIPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKVEEEKNK
Ga0181607_1045735913300017950Salt MarshMKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGTKNIPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKEEEEKNK
Ga0181583_1078006913300017952Salt MarshETLVQTEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIYGALKKKGAKNLPKLQVKTWELFDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTVHMENFLRVANTVRTNLLTKYHDGEFVDPALYDPKKEEK
Ga0181569_1076704813300017986Salt MarshMKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGTKNIPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKVEEEKNK
Ga0181566_1035865913300018426Salt MarshMEMFSRTLDPRHWTNVQNISKALKEKGVKNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAKAALKA
Ga0188834_101169913300018599Freshwater LakeMKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALGKKGTKNIPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKVEEEKNK
Ga0188834_101440413300018599Freshwater LakeKFGTLILLLGAAAASNVETTTLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVKEAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVANTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0188850_101564013300018601Freshwater LakeRHWTNVQNIHAALVKKGTKNIPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKVEEEKNK
Ga0188882_101748013300018665Freshwater LakeAVAASQVEYAPISDETLVQTEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVLNIHDALKKKGTKDVPKLSVKTWELYDKAFSFPRIRRYNFVCENMDMLEHFEDNLNTNISNTVHMENFLRVANTVRTNLLTKYHDGEFVDPATYDPKEELEK
Ga0192944_101869613300018692MarineMKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAKXERNXVLRAQLMXVNVTTQINIKLFVNLHK
Ga0192944_103217113300018692MarinePCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGAKELPKLSVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNTNISNQVNMENFLRVANTVRTNLKTKYHDGEFVDPADTDPKAAAAAAKAAAAL
Ga0192967_102358513300018730MarineMKFQTLLLLIGAAAASQVDASNLVSAVESSDAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNISAALKKKGTKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTNLSTKYHDGEFIDPADTDPKAAAAAAKAAAAK
Ga0193138_103169213300018742MarineLEYQMEMFSRTLDPRHWTNVQNLSKQLKEKGVANAPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLVTKYHDGEFDDPANTDPKVEAEKAAAALKA
Ga0193000_103710513300018745MarineTPAELEYQMEMFSRTLDPRHWTNVQNIAKALKEKGAANVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAAAALKA
Ga0193031_102227813300018765MarineHGELINILDMKFQTLILLIGAACASNVETQNLATAVEATKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKSKGASGVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAAAALK
Ga0193031_103088113300018765MarineAAVEATKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKTKGASGAPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAAAALKA
Ga0193048_103835013300018825MarineFSRTLDPRHWTNVQNIHAALTKKGAKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVRTNLKTKYHDGEFIDPADTDPKAAAAAAKAAA
Ga0192949_104692013300018831MarineKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0194240_101342123300018832MarineDASAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGVKEIPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVRTNLKTKYHDGEFIDPADFDPKAAAAAAKAAAE
Ga0192870_105451513300018836MarineLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALTKKGAKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0193253_106609413300018846MarineDMKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0193254_1007920713300018976MarineAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0192961_1008925813300018980MarineMKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0192961_1008970613300018980MarineHGELINILDMKFQTLILLFGAASAASVDSLNLANAQAPCVYLDETPAELDYQMEMFSRTLDPRHWTNVQNIAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFEDNLNMNISNEVAMENFLRVANTVHTNLATKYHDGEFIDPANTDPKVEAEKAAAALKA
Ga0192947_1010225613300018982MarineMKFQTLILLFGAASAASVDSLNLANAQAPCVYLDETPAELDYQMEMFSRTLDPRHWTNVQNIAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFEDNLNMNISNEVAMENFLRVANTVHTNLATKYHDGEFIDPANTDPKVEAEKAAAALKA
Ga0193030_1009452813300018989MarineWDMKFQTLILLIGAACASNVETQNLATAVEATKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKSKGASGVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKAEAEKAAAALKA
Ga0193030_1012960213300018989MarineVEASKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKSKGVAGAPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKAEAEKAAAALKA
Ga0193030_1018576313300018989MarineMKFQTLVLLFGAASAATVDSLNLAHAEAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNIAKALKEKGATNVPKLHVSSWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAAAALKA
Ga0193030_1023509813300018989MarineMKFQTLVLLFGAASAATVDSLNLAHAEAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNIAKALKEKGATNVPKLHVSSWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFIDPADTDPKVEAEKAAAALKA
Ga0193044_1013606313300019010MarineDASAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALTKKGAKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVRTNLKTKYHDGEFIDPADTDPKAAAAAAKAAA
Ga0192982_1008914923300019021MarineMKFSTLLLLIGAAAASQVDAENLVNAVQATKAHDPCVYLTEDIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPASFDPKAEAAAAAAAKXERNXVLRAQLMXVNVTTQINIKLFVNLHK
Ga0192982_1012188413300019021MarineSNLVSAVESADAPCVYLDESVGELEYQMEMFSRTLDPRHWTNVQNISAALKKKGAKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTNLKTKYHDGEFVDPADTDPKAAAAAAKAAAAM
Ga0192951_1015778013300019022MarineNAQAPCVYLDETPAELDYQMEMFSRTLDPRHWTNVQNIAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFEDNLNMNISNEVAMENFLRVANTVHTNLATKYHDGEFIDPANTDPKVEAEKAAAALKA
Ga0192869_1018584713300019032MarineHGELINILDMKFQTLILLFGAASAASVDALNLANAQAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNVAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAAAALKA
Ga0192869_1019793613300019032MarineDMKFQTLVLLFGAASAATVDSLNLAHAEAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNIAKALKEKGATNVPKLHVSSWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAAAALKA
Ga0192945_1008792213300019036MarineAVEATKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKSKGASGAPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFIRVANTVHTNLKTKYHDGEFIDPADLDPKAEAEKAAAALKA
Ga0192945_1009042913300019036MarineMKFHTLLLLIGAAAASQVDASNLVSAVESTNASDPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGAKELPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNTNISNQVNMENFLRVANTVRTNLKTKYHDGEFVDPADTDPKAAAAAAKAAAAL
Ga0192945_1016416913300019036MarineAAVASNVETHNLATAVEATKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKSKGAAGAPKLAVKTWELYDKAWSFPRLRRYNFVMENLDMLEHFEDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKAEAEKAAAALKA
Ga0192981_1014825113300019048MarineMKFSTLLLLIGAAAASQVDAENLVNAVQATKAHDPCVYLTEDIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPASFDPKAEAAAAAAAK
Ga0188866_101185313300019095Freshwater LakeKFHTLLLLIGAAAASQVDASNLVSAVESSNASDPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKSGAKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVRTNLKTKYHDGEFVDPADTDPKAVAAAAKAAL
Ga0188866_101362513300019095Freshwater LakeMKYTAIIALLGAVAASQVEFAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHSALVKKGVKNIPKLQVRTWDLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKKEEEDK
Ga0188866_103402413300019095Freshwater LakeKYTTLLLLVGVIAATQVESSTAVASETATQVEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNLYKALKEKGTGNLPKLQVKTWELYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNSVHMENFLRVANTVRTNLLTKYHDGEFSDPALVDPKVEAKKEKTW
Ga0193243_102665313300019116MarinePCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGAKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNTNISNQVNMENFLRVANTVRTNLKTKYHDGEFIDPADTDPKAVAAAAKAAAAN
Ga0193249_108173713300019131MarineTILLLIGAAAASQVDASNLVSAVESSKTTDPCVYLDETIGELEYQMEMFSRTFDPRHWTNVQNIYGALKKKGTKDLPKLAVKTWELYDKSFSFPRIRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTNLATKYHDGEFIDPAGFDPKAAAAAAKAAAA
Ga0180036_102484213300019200EstuarineMKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHSALVKKATKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK
Ga0182097_136991913300019261Salt MarshKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGTKNIPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKVEEEKNK
Ga0182073_104970713300019274Salt MarshLLFLLGAVAATQAEASQAVDLARPADETLVQTEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIYGALKKKGAKNLPKLQVKTWELFDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTVHMENFLRVANTVRTNLLTKYHDGEFVDPALYDPKKEEK
Ga0182044_106921813300020014Salt MarshKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALGKKGTKNIPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKVEEEKNK
Ga0210301_103000913300021325EstuarineMKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHSALVKKGTKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK
Ga0206689_1014477013300021359SeawaterMKYTSALVLLGLIADSSAVKLEKPCVYLDETQDELDYQIDMFSRTLDPRHWTNALNIQKALGKAGTKTTVNKVHTWELYDKSFSFPRVRRYNFVNENMDMLEHFQDNLNTNVSNSVHMENFLRVANTVRENFNQKYHDGEFADPGATDPKDEDKTVNYVY
Ga0063132_10271013300021872MarineKFQTLILLIGAACASNVETQNLATAVEATKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKSKGASGVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFIDPADLDPKAEAEKAAAALKA
Ga0063132_11479613300021872MarineRHWTNVQNIHAALKKKGTKDIPKLAVKTWELYDKSFSFPRIRRYNFVMENMDMLEHFQDNLNTNISNQVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAETK
Ga0063147_13390913300021874MarineFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0063086_101845813300021902MarineKFHTLLLLIGAAAASQVDASNLVSAVESAHASDPCVYLDESIGELEYQMEMFSRTLDPRHWTNVQNIHAALTKKGAKDLPKLSVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVRTNLKTKYHDGEFIDPADTDPKAAAAAAKAAM
Ga0063086_106157413300021902MarineSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0063104_106420713300021913MarineSTLILLIGAAAASQVDASNLVSAVESANASDPCVYLDESIGELEYQMEMFSRTLDPRHWTNVENISAKLKAKGTKDLPKLAIKTWELYDKSFSFPRIRRYNFVMENMDMLEHFQDNLNMNISNKVNMENFIRVANTVKTNLAAKYSNGEFVDPASFDPKAAAAAAKAAL
Ga0063870_104386613300021921MarineEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVATTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0063870_106163313300021921MarineKFQTLLLLIGAAAAAQVDASALAEPAPVAALEPCVYLDESVGELEYQMEMFSRTLDPRHWTNVQNIYAKLKAKGTKDLPKLAVKTWELYDKSFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTNLATKYHDGEFVDPAGLDPKAAAAAAKAAA
Ga0063869_104210613300021922MarineQTLLLLIGAAAAAQVDASALAEPAPVAALEPCVYLDESVGELEYQMEMFSRTLDPRHWTNVQNIYAKLKAKGTKDLPKLAVKTWELYDKSFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTNLATKYHDGEFVDPAGLDPKAAAAAAKAAA
Ga0063085_102786213300021924MarineQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVATTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0063085_102793313300021924MarineHTLLLLIGAAAASQVDASNLVSAVESAHASDPCVYLDESIGELEYQMEMFSRTLDPRHWTNVQNIHAALTKKGAKDLPKLSVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVRTNLKTKYHDGEFIDPADTDPKAAAAAAKAAM
Ga0063085_104670113300021924MarineKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0063871_110188013300021926MarineLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVATTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0063145_104684213300021930MarineIDMKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0063145_111460313300021930MarineMEMFSRTLDPRHWTNVQNISKALKEKGVANAPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFDDPADTDPKVEAEKAAAALKA
Ga0063095_107047113300021939MarineSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVATTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALK
Ga0063095_115696213300021939MarineLILLIGAAAASQVDASNLVSAVESANASDPCVYLDESIGELEYQMEMFSRTLDPRHWTNVENISAKLKAKGTKDLPKLAIKTWELYDKSFSFPRIRRYNFVMENMDMLEHFQDNLNMNISNKVNMENFIRVANTVKTNLAAKYSNGEFVDPASFDPKAAAAAAKAAL
Ga0063098_112393113300021942MarineKFSTLILLIGAAAASQVDASNLVSAVESANASDPCVYLDESIGELEYQMEMFSRTLDPRHWTNVENISAKLKAKGTKDLPKLAIKTWELYDKSFSFPRIRRYNFVMENMDMLEHFQDNLNMNISNKVNMENFIRVANTVKTNLAAKYSNGEFVDPASFDPKAAAAAAKAAL
Ga0222713_1056660613300021962Estuarine WaterMKYTSLLLLIGVAAATQVEYPAIADETLVQTNGPCVYLEESVGELEYQMEMFSRTLDPRHWTNVLNIYDALKKKGTKSLPKLQVKTWDLYDKAFTFPRIRRYNFVCENMDMLEHFQDNLNTNISNSVHMENFLRVANTVRTNLLTKYHDGEFVDPALYDP
Ga0255777_1027394913300023175Salt MarshIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGTKNIPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKVEEEKNK
Ga0232113_102498113300023679SeawaterLLLLIGAAAASQVDASNLVSAVESSNASDPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGAKELPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNTNISNQVNMENFLRVANTVRTNLKTKYHDGEFIDPADTDPKAVAAAAKAAAA
Ga0228686_102544513300023685SeawaterKFHTLLLLIGAAAASQVDASNLVSAVESSNASDPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGAKELPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNTNISNQVNMENFLRVANTVRTNLKTKYHDGEFIDPADTDPKAVAAAAKAAAA
Ga0209306_105716013300025680Pelagic MarineMKFQTLILLFGAASAASVDSLNLANAQAPCVYLDETPAELDYQMEMFSRTLDPRHWTNVQNIAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFEDNLNMNISNEVAMENFLRVANTVHTNLATKYHDGEFIVEAEKAAAALKA
Ga0209715_108962413300025699Pelagic MarineMKFQTLLLLIGAAAAAQVDASALAEPAPVAALEPCVYLDESVGELEYQMEMFSRTLDPRHWTNVQNIYAKLKAKGTKDLPKLAVKTWELYDKSFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTNLATKYHDGEFVDPAGLDPKAAAAAAKAAA
Ga0209305_113970613300025712Pelagic MarineMKFQTLILLFGAASAASVDSLNLANAQAPCVYLDETPAELDYQMEMFSRTLDPRHWTNVQNIAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFEDNLNMNISNEVAMENFLRVANTVHTNLATKYHDGEFIDPANTDPKVEAEKAAAA
Ga0209425_1040004713300025897Pelagic MarineMKYTTIIALIGAVAASQVEYAPIADETLVQTSQEAPCVYLDETVGELEYQLEMFSRTLDPRHWTNVQNIHSALVKKGAKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK
Ga0247594_103801013300026448SeawaterQMEMFSRTLDPRHWTNVQNIAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFEDNLNMNISNEVAMENFLRVANTVHTNLATKYHDGEFIDPANTDPKVEAEKAAAALKA
Ga0247592_108745513300026500SeawaterLDETVGELEYQMEMFSRTLDPRHWTNVQNLFKALKEKGTGNLPKLQVKTWELYDKSFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTVHMENFLRVANTVRTNLLTKYHDGEFSDPALVDPKVEAKKEKTW
Ga0208921_104379913300027188EstuarineVEYAPIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHSALVKKGTKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK
Ga0207994_110953313300027416EstuarinePIADETLVQTSQEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHSALVKKGTKNLPKLQVNTWGLYDKAFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTIHMENFLRVANTVHTNLLTKYHDGEFVDPALYDPKDEENK
Ga0256412_111497513300028137SeawaterMKYTTLLLLVGVIAATQVESSTAIASETATSVEAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNLYKALKEKGSGNLPKLQVKTWELYDKSFSFPRIRRYNFVCENMDMLEHFQDNLNTNISNTVHMENFLRFANTVRTNLLTKYHDGEFSDPALVDPKVEAKKEKTW
Ga0256412_114287313300028137SeawaterLKMKYTSILLLIGVIAATSVESTEGALAEVSTQAQAPCVYLDETIGELEYQMEMFSRTLDPRHWTNVLNIYGALKKKGTKDLPKLQVRTWDLFDKAFSFPRIRRYNFVCENMDMLEHFQDNLNMNISNTVHMENFLRVANTVRSNLKTKYHDGEFTDPATFDPKAEE
Ga0256417_108772013300028233SeawaterLLIGAAAASQVDASNLVSAVESSNASDPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGAKELPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNTNISNQVNMENFLRVANTVRTNLKTKYHDGEFIDPADTDPKAVAAAAKAAAA
Ga0256413_114855013300028282SeawaterAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAKXERNXVLRAQFMXVNVTTQINIKLFVNLHK
Ga0256413_119320513300028282SeawaterSRTLDPRHWTNVQNIHAALVKKGAKELPKLAVKTWELYDKSWSFPRLRRYNIVMENMDRLEHFQDNLNTNISNQVNMENFLRVANTVRTNLKTKYHDGEFIDPADTDPKAVAAAAKAAAA
Ga0256413_130896013300028282SeawaterKFQTLILLFGAASAASVDSLNLANAQAPCVYLDETPAELDYQMEMFSRTLDPRHWTNVQNIAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFEDNLNMNISNEVAMENFLRVANTVHTNLATKYHDGEFIDPANTDPKVEAEKAAAALKA
Ga0247572_106073713300028290SeawaterKDMKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAKXERNXVLRAQFMXVNVTTQINIKLFVNLHK
Ga0307401_1058057813300030670MarineKFQTLLLLIGAAAASQVDASNLVSAVESSDAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNISAALKKKGTKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTNLSTKYHDGEFIDPADTDPKAAAAAAKAA
Ga0307403_1039462513300030671MarineAVESADAPCVYLDESVGELEYQMEMFSRTLDPRHWTNVQNISAALKKKGAKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTNLGTKYHDGEFVDPAGFDPKAAAAAAKAAAE
Ga0307398_1030618813300030699MarineKFQTLLLLIGAAAASQVDASNLVSAVESSDAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNISAALKKKGTKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTNLSTKYHDGEFIDPADTDPKAAAAAAKAAAAK
Ga0307399_1053091213300030702MarineMFSRTLDTRHWTNVLNIHKKLDNPKRLLVHTWELFDKAFSFPRIRRYQYVQENMDMLEHFQDNLNMNISNDRAMANFLRVANTVRDNLKGKY
Ga0307400_1046978513300030709MarineQATKAHDPCVYLTEDIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPASFDPKAEAAAAAAAK
Ga0308139_107530923300030720MarineFSRTLDPRHWTNVENISAKLKAKGTKDLPKLAIKTWELYDKSFSFPRIRRYNFVMENMDMLEHFQDNLNMNISNKVNMENFIRVANTVKTNLAAKYSNGEFVDPASFDPKAAAAAAKAAL
Ga0308129_101352413300030723MarineGTLILLIGAAAAANVETTSLETTAIKGPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVTGVPKLAVKSWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAAAALKA
Ga0308128_101597813300030725MarineMKFGTLILLIGAAAAANVETTSLETTAIKGPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVTGGPKLAVKSWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNTNISNEVAMQNFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAAAALKA
Ga0073981_1166613913300030857MarineMFSRTLDPRHWTNVQNLSKQLKEKGVANVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLITKYHDGEFDDPANTDPKVEAEKAAAALKA
Ga0073984_1125884213300031004MarineAGLGIANVLAPARIDMDAHGKLVAIFNQELRGAPPEDPGSAAASQVDASNLVSAVESSDASAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHAALVKKGVKDIPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVRTNLKTKYHDGE
Ga0073980_1139514913300031032MarinePCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKSKGASGVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLITKYHDGEFDDPANTDPKVEAEKAAAALKA
Ga0073979_1001013113300031037MarineMEMFSRTLDPRHWTNVQNLSKQLKEKGVANAPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLITKYHDGEFDDPANTDPKVEAEKAAAALKA
Ga0073989_1345008713300031062MarineMKFNTLILFLGGAAASRNNKKNLANAVQGAHEPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNLSKQLKEKGVANVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMENFLRVANTVHTNLKTKYHDGEFIDPADTDPKVEAEKAAAALKA
Ga0307388_1043600513300031522MarineLTFNCFIDMKFQTLILLFGAASAASVDSLNLANAQAPCVYLDETPAELDYQMEMFSRTLDPRHWTNVQNIAKALKEKGSSNVPKLAVKTWELYDKAWSFPRLRRYNFVMENMDMLEHFEDNLNMNISNEVAMENFLRVANTVHTNLATKYHDGEFIDPANTDPKVEAEKAAAALKA
Ga0302114_1010532813300031621MarineMKFGTLILLIGAAAAANVETTSLETTAIKGPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVTGGPKLAVKSWELYDKAWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVANTVHTNLKTKYHDGEFIDPADLDPKVEAEKAAAALKA
Ga0307391_1038483123300031729MarineAASQVDASNLVSAVESADAPCVYLDESVGELEYQMEMFSRTLDPRHWTNVQNISAALKKKGAKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTNLKTKYHDGEFVDPADTDPKAAAAAAKAAAAM
Ga0307397_1018337013300031734MarineMKFRTLLLLIGAAAASQVDASNLVSAVESSDAPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNISAALKKKGTKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTNLSTKYHDGEFIDPADTDPKAAAAAAKAAAAK
Ga0314684_1019892613300032463SeawaterMKFGTLILLLGAAAASNVETTTLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVATTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0314684_1038836713300032463SeawaterENLVNAVEATKAHDPCVYLDETVGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314668_1027734513300032481SeawaterMKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314675_1014543113300032491SeawaterMIPSLRRFFGTLILLLGAAAASNVETTTLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVATTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0314679_1020209013300032492SeawaterKFGTLILLLGAAAASNVETTTLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVATTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0314688_1027851013300032517SeawaterKDMKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314689_1038370213300032518SeawaterLLLLIGAAAASQVDAENLVNAVEATKTHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314676_1047904713300032519SeawaterMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAA
Ga0314677_1041075513300032522SeawaterGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314682_1029410913300032540SeawaterDMKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314674_1025861713300032615SeawaterIKDMKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAKXERNXVLRAQFMXVNVTTQINIKLFVNLHK
Ga0314671_1023473713300032616SeawaterMKFSTLLLLIGAAAASQVDAENLVNAVEATKADDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAKXERNXVLRAQFMXVNVTTQINIKLFVNLHK
Ga0314673_1034101013300032650SeawaterELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314678_1016572013300032666SeawaterILDMKFGTLILLLGAAAASNVETTTLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVATTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0314687_1030302513300032707SeawaterPYWSAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314687_1035894113300032707SeawaterKFHTLLLLIGAAAASQVDASNLVSAFESAHASDPCVYLDESIGELEYQMEMFSRTLDPRHWTNVQNIHAALTKKGAKDLPKLSVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVRTNLKTKYHDGEFIDPADTDPKAAAAAAKAAM
Ga0314672_120668713300032709SeawaterTPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVANTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0314690_1019884413300032713SeawaterLCLYMIFMLFHHHSLSFSAVTSLAHECPALAAFLAAAASNVETTTLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVATTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0314686_1028466913300032714SeawaterLDMKFGTLILLLGAAAASNVETTTLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVANTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0314686_1032260113300032714SeawaterLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314695_113868313300032724SeawaterLDMKFGTLILLLGAAAASNVETTTLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVATTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0314702_115237913300032725SeawaterKFSTLLLLIGATAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314697_1016627813300032729SeawaterQIKDMKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAKXERNXVLRAQFMXVNVTTQINIKLFVNLHK
Ga0314699_1020609013300032730SeawaterTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314711_1033637513300032732SeawaterYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314710_1018027913300032742SeawaterIKDMKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHEALVKKGTKDIPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314701_1016103513300032746SeawaterLAASNVETTTLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVATTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0314701_1024958913300032746SeawaterLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314712_1022185013300032747SeawaterKFGTLILLLGAAAASNVETTTLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVANTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0314708_1023082213300032750SeawaterIKDMKFSTLLLLIGAAAASQVDAENLVNAVEATKAHDPCVYLDETIGELEYQMEMFSRTLDPRHWTNVQNIHDTLAKKGTKDLPKLAIKTWELYDKAFSFPRIRRYNFVMENMDMLEHFQDNVNTNISNKVNMENFLRVANTVKTNLATKYHDGEFVDPAGFDPKAEAAAAAAAK
Ga0314709_1043712013300032755SeawaterLILLLGAAAASNVETTTLETQAIKAPCVYLDETPAELEYQMEMFSRTLDPRHWTNVQNISKALKEKGVNGAPKLAVKTWELYDKAFSFPRLRRYNFVMENMDMLEHFQDNLNMNISNEVAMQNFLRVANTVKTNLATKYHDGEFVDPADLDPKVEAEKAAAALKA
Ga0307390_1076403913300033572MarineAASQVDASNLVSAVESADAPCVYLDESVGELEYQMEMFSRTLDPRHWTNVQNISAALKKKGAKDLPKLAVKTWELYDKSWSFPRLRRYNFVMENMDMLEHFQDNLNMNISNQVNMENFLRVANTVKTNLKTKYHDGEFVDPADTDPKAAAAAAKAAAAMLGEN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.