| Basic Information | |
|---|---|
| Family ID | F023872 |
| Family Type | Metagenome |
| Number of Sequences | 208 |
| Average Sequence Length | 41 residues |
| Representative Sequence | AAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNKFIYE |
| Number of Associated Samples | 166 |
| Number of Associated Scaffolds | 208 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.52 % |
| % of genes from short scaffolds (< 2000 bps) | 92.79 % |
| Associated GOLD sequencing projects | 155 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.788 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (24.038 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.231 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.308 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 208 Family Scaffolds |
|---|---|---|
| PF01379 | Porphobil_deam | 51.92 |
| PF03900 | Porphobil_deamC | 32.21 |
| PF02602 | HEM4 | 10.58 |
| PF00924 | MS_channel | 1.92 |
| PF00814 | TsaD | 0.96 |
| PF02325 | YGGT | 0.48 |
| PF01878 | EVE | 0.48 |
| PF01070 | FMN_dh | 0.48 |
| PF02882 | THF_DHG_CYH_C | 0.48 |
| PF01209 | Ubie_methyltran | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 208 Family Scaffolds |
|---|---|---|---|
| COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 84.13 |
| COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 10.58 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.48 |
| COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 0.48 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.48 |
| COG0762 | Cytochrome b6 maturation protein CCB3/Ycf19 and related maturases, YggT family | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.48 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.48 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.48 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.48 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.79 % |
| All Organisms | root | All Organisms | 32.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10055024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1720 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10127586 | Not Available | 876 | Open in IMG/M |
| 3300000148|SI47jul10_100mDRAFT_c1035782 | Not Available | 702 | Open in IMG/M |
| 3300000150|SI48aug10_120mDRAFT_c1029939 | Not Available | 686 | Open in IMG/M |
| 3300000153|SI39nov09_135mDRAFT_c1014194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1740 | Open in IMG/M |
| 3300000167|SI39nov09_120mDRAFT_c1079394 | Not Available | 585 | Open in IMG/M |
| 3300000168|LPjun09P1210mDRAFT_c1013995 | Not Available | 643 | Open in IMG/M |
| 3300000174|SI60aug11_200mDRAFT_c1043503 | Not Available | 740 | Open in IMG/M |
| 3300000192|SI60aug11_100mDRAFT_c1022896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1262 | Open in IMG/M |
| 3300000192|SI60aug11_100mDRAFT_c1057106 | Not Available | 610 | Open in IMG/M |
| 3300000324|SI48aug10_100mDRAFT_1038595 | Not Available | 792 | Open in IMG/M |
| 3300000949|BBAY94_10162987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 604 | Open in IMG/M |
| 3300001353|JGI20159J14440_10112153 | Not Available | 843 | Open in IMG/M |
| 3300001832|ACM6_1001824 | Not Available | 650 | Open in IMG/M |
| 3300001937|GOS2252_1003629 | Not Available | 988 | Open in IMG/M |
| 3300001946|GOS2244_1025135 | Not Available | 1043 | Open in IMG/M |
| 3300001947|GOS2218_1028607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2803 | Open in IMG/M |
| 3300001951|GOS2249_1017903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1297 | Open in IMG/M |
| 3300001965|GOS2243_1016643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1796 | Open in IMG/M |
| 3300001965|GOS2243_1054899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1931 | Open in IMG/M |
| 3300001974|GOS2246_10164641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1682 | Open in IMG/M |
| 3300001974|GOS2246_10179116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1537 | Open in IMG/M |
| 3300002033|GOS24894_10063259 | Not Available | 897 | Open in IMG/M |
| 3300002040|GOScombined01_100805613 | Not Available | 785 | Open in IMG/M |
| 3300002040|GOScombined01_101395223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1729 | Open in IMG/M |
| 3300002040|GOScombined01_103056074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1485 | Open in IMG/M |
| 3300003185|JGI26064J46334_1098200 | Not Available | 556 | Open in IMG/M |
| 3300003501|JGI26243J51142_1067211 | Not Available | 652 | Open in IMG/M |
| 3300004276|Ga0066610_10161521 | Not Available | 743 | Open in IMG/M |
| 3300005430|Ga0066849_10400732 | Not Available | 517 | Open in IMG/M |
| 3300005522|Ga0066861_10227961 | Not Available | 636 | Open in IMG/M |
| 3300005523|Ga0066865_10286944 | Not Available | 621 | Open in IMG/M |
| 3300005606|Ga0066835_10264394 | Not Available | 591 | Open in IMG/M |
| 3300005837|Ga0078893_10035473 | Not Available | 628 | Open in IMG/M |
| 3300005837|Ga0078893_10386266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1663 | Open in IMG/M |
| 3300005838|Ga0008649_10112418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1114 | Open in IMG/M |
| 3300005971|Ga0066370_10329456 | Not Available | 548 | Open in IMG/M |
| 3300006337|Ga0068495_1394837 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300006351|Ga0099953_1076126 | Not Available | 867 | Open in IMG/M |
| 3300006412|Ga0099955_1037770 | Not Available | 536 | Open in IMG/M |
| 3300006480|Ga0100226_1017158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 873 | Open in IMG/M |
| 3300006867|Ga0075476_10046984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1757 | Open in IMG/M |
| 3300006874|Ga0075475_10157141 | Not Available | 994 | Open in IMG/M |
| 3300007114|Ga0101668_1092152 | Not Available | 648 | Open in IMG/M |
| 3300007236|Ga0075463_10097921 | Not Available | 946 | Open in IMG/M |
| 3300008964|Ga0102889_1257604 | Not Available | 504 | Open in IMG/M |
| 3300009000|Ga0102960_1043781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1653 | Open in IMG/M |
| 3300009077|Ga0115552_1057557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1758 | Open in IMG/M |
| 3300009433|Ga0115545_1145509 | Not Available | 830 | Open in IMG/M |
| 3300009447|Ga0115560_1190747 | Not Available | 799 | Open in IMG/M |
| 3300009476|Ga0115555_1391604 | Not Available | 553 | Open in IMG/M |
| 3300009790|Ga0115012_10073766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2339 | Open in IMG/M |
| 3300009790|Ga0115012_10788128 | Not Available | 769 | Open in IMG/M |
| 3300009790|Ga0115012_10984667 | Not Available | 695 | Open in IMG/M |
| 3300010296|Ga0129348_1042557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1645 | Open in IMG/M |
| 3300010296|Ga0129348_1047861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1544 | Open in IMG/M |
| 3300010300|Ga0129351_1262860 | Not Available | 658 | Open in IMG/M |
| 3300012928|Ga0163110_11143871 | Not Available | 624 | Open in IMG/M |
| 3300012936|Ga0163109_10745466 | Not Available | 716 | Open in IMG/M |
| 3300012936|Ga0163109_11230723 | Not Available | 546 | Open in IMG/M |
| 3300012954|Ga0163111_10090118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2494 | Open in IMG/M |
| 3300012954|Ga0163111_10217926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1657 | Open in IMG/M |
| 3300012954|Ga0163111_11096270 | Not Available | 773 | Open in IMG/M |
| 3300012954|Ga0163111_11957297 | Not Available | 589 | Open in IMG/M |
| 3300012954|Ga0163111_12444074 | Not Available | 531 | Open in IMG/M |
| 3300012954|Ga0163111_12623844 | Not Available | 514 | Open in IMG/M |
| 3300017709|Ga0181387_1047741 | Not Available | 851 | Open in IMG/M |
| 3300017717|Ga0181404_1158055 | Not Available | 546 | Open in IMG/M |
| 3300017731|Ga0181416_1041240 | Not Available | 1085 | Open in IMG/M |
| 3300017732|Ga0181415_1078222 | Not Available | 746 | Open in IMG/M |
| 3300017741|Ga0181421_1088851 | Not Available | 807 | Open in IMG/M |
| 3300017741|Ga0181421_1185287 | Not Available | 534 | Open in IMG/M |
| 3300017742|Ga0181399_1104893 | Not Available | 697 | Open in IMG/M |
| 3300017749|Ga0181392_1182634 | Not Available | 608 | Open in IMG/M |
| 3300017756|Ga0181382_1020371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2095 | Open in IMG/M |
| 3300017762|Ga0181422_1070770 | Not Available | 1105 | Open in IMG/M |
| 3300017779|Ga0181395_1067921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1159 | Open in IMG/M |
| 3300017779|Ga0181395_1083520 | Not Available | 1031 | Open in IMG/M |
| 3300017781|Ga0181423_1311504 | Not Available | 578 | Open in IMG/M |
| 3300017783|Ga0181379_1079373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1220 | Open in IMG/M |
| 3300017786|Ga0181424_10075435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1456 | Open in IMG/M |
| 3300017786|Ga0181424_10075573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1455 | Open in IMG/M |
| 3300017952|Ga0181583_10569195 | Not Available | 685 | Open in IMG/M |
| 3300017958|Ga0181582_10238336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1219 | Open in IMG/M |
| 3300017962|Ga0181581_10682668 | Not Available | 619 | Open in IMG/M |
| 3300017967|Ga0181590_10409524 | Not Available | 962 | Open in IMG/M |
| 3300018036|Ga0181600_10188497 | Not Available | 1111 | Open in IMG/M |
| 3300018421|Ga0181592_10595755 | Not Available | 751 | Open in IMG/M |
| 3300018426|Ga0181566_10353821 | Not Available | 1052 | Open in IMG/M |
| 3300018428|Ga0181568_10508401 | Not Available | 959 | Open in IMG/M |
| 3300020053|Ga0181595_10384364 | Not Available | 548 | Open in IMG/M |
| 3300020055|Ga0181575_10256193 | Not Available | 1007 | Open in IMG/M |
| 3300020177|Ga0181596_10141279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1131 | Open in IMG/M |
| 3300020207|Ga0181570_10125136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1430 | Open in IMG/M |
| 3300020207|Ga0181570_10256851 | Not Available | 896 | Open in IMG/M |
| 3300020207|Ga0181570_10575984 | Not Available | 502 | Open in IMG/M |
| 3300020269|Ga0211484_1033150 | Not Available | 986 | Open in IMG/M |
| 3300020282|Ga0211667_1107877 | Not Available | 676 | Open in IMG/M |
| 3300020293|Ga0211665_1013455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1720 | Open in IMG/M |
| 3300020339|Ga0211605_1046773 | Not Available | 880 | Open in IMG/M |
| 3300020346|Ga0211607_1030129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1178 | Open in IMG/M |
| 3300020351|Ga0211601_1079481 | Not Available | 767 | Open in IMG/M |
| 3300020362|Ga0211488_10091102 | Not Available | 913 | Open in IMG/M |
| 3300020362|Ga0211488_10111213 | Not Available | 801 | Open in IMG/M |
| 3300020370|Ga0211672_10198675 | Not Available | 620 | Open in IMG/M |
| 3300020377|Ga0211647_10157493 | Not Available | 750 | Open in IMG/M |
| 3300020378|Ga0211527_10202338 | Not Available | 554 | Open in IMG/M |
| 3300020380|Ga0211498_10347622 | Not Available | 558 | Open in IMG/M |
| 3300020381|Ga0211476_10136357 | Not Available | 897 | Open in IMG/M |
| 3300020388|Ga0211678_10187060 | Not Available | 873 | Open in IMG/M |
| 3300020391|Ga0211675_10258774 | Not Available | 745 | Open in IMG/M |
| 3300020393|Ga0211618_10105178 | Not Available | 1010 | Open in IMG/M |
| 3300020400|Ga0211636_10142189 | Not Available | 952 | Open in IMG/M |
| 3300020404|Ga0211659_10235325 | Not Available | 815 | Open in IMG/M |
| 3300020404|Ga0211659_10333907 | Not Available | 664 | Open in IMG/M |
| 3300020411|Ga0211587_10098055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1275 | Open in IMG/M |
| 3300020414|Ga0211523_10162306 | Not Available | 933 | Open in IMG/M |
| 3300020416|Ga0211644_10163030 | Not Available | 912 | Open in IMG/M |
| 3300020417|Ga0211528_10139627 | Not Available | 958 | Open in IMG/M |
| 3300020417|Ga0211528_10141188 | Not Available | 952 | Open in IMG/M |
| 3300020418|Ga0211557_10086222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 1571 | Open in IMG/M |
| 3300020418|Ga0211557_10408403 | Not Available | 602 | Open in IMG/M |
| 3300020428|Ga0211521_10141756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1129 | Open in IMG/M |
| 3300020431|Ga0211554_10459988 | Not Available | 585 | Open in IMG/M |
| 3300020437|Ga0211539_10031392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2083 | Open in IMG/M |
| 3300020438|Ga0211576_10469635 | Not Available | 638 | Open in IMG/M |
| 3300020439|Ga0211558_10123991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1254 | Open in IMG/M |
| 3300020446|Ga0211574_10443066 | Not Available | 560 | Open in IMG/M |
| 3300020450|Ga0211641_10443043 | Not Available | 624 | Open in IMG/M |
| 3300020455|Ga0211664_10529177 | Not Available | 537 | Open in IMG/M |
| 3300020457|Ga0211643_10571212 | Not Available | 555 | Open in IMG/M |
| 3300020461|Ga0211535_10131544 | Not Available | 1079 | Open in IMG/M |
| 3300020463|Ga0211676_10001171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 28014 | Open in IMG/M |
| 3300020464|Ga0211694_10119482 | Not Available | 1053 | Open in IMG/M |
| 3300020465|Ga0211640_10148442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1335 | Open in IMG/M |
| 3300020468|Ga0211475_10048571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2316 | Open in IMG/M |
| 3300020468|Ga0211475_10176726 | Not Available | 1080 | Open in IMG/M |
| 3300020469|Ga0211577_10248069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1149 | Open in IMG/M |
| 3300020469|Ga0211577_10393671 | Not Available | 858 | Open in IMG/M |
| 3300020471|Ga0211614_10081552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1363 | Open in IMG/M |
| 3300020472|Ga0211579_10082584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1942 | Open in IMG/M |
| 3300020474|Ga0211547_10246050 | Not Available | 913 | Open in IMG/M |
| 3300021085|Ga0206677_10156561 | Not Available | 1013 | Open in IMG/M |
| 3300021085|Ga0206677_10222755 | Not Available | 794 | Open in IMG/M |
| 3300021378|Ga0213861_10025923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4035 | Open in IMG/M |
| 3300021425|Ga0213866_10070724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1941 | Open in IMG/M |
| 3300021425|Ga0213866_10204318 | Not Available | 1024 | Open in IMG/M |
| 3300021962|Ga0222713_10061895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2807 | Open in IMG/M |
| (restricted) 3300022933|Ga0233427_10071996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1739 | Open in IMG/M |
| (restricted) 3300022933|Ga0233427_10163939 | Not Available | 1005 | Open in IMG/M |
| 3300022937|Ga0255770_10332708 | Not Available | 687 | Open in IMG/M |
| 3300023105|Ga0255782_10088610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1657 | Open in IMG/M |
| 3300023110|Ga0255743_10265701 | Not Available | 903 | Open in IMG/M |
| 3300023176|Ga0255772_10269008 | Not Available | 921 | Open in IMG/M |
| 3300023178|Ga0255759_10159683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1525 | Open in IMG/M |
| 3300024185|Ga0228669_1111423 | Not Available | 502 | Open in IMG/M |
| 3300024191|Ga0228636_1146979 | Not Available | 512 | Open in IMG/M |
| 3300024192|Ga0228637_1089310 | Not Available | 613 | Open in IMG/M |
| 3300024226|Ga0228667_1106649 | Not Available | 522 | Open in IMG/M |
| 3300024237|Ga0228653_1078158 | Not Available | 723 | Open in IMG/M |
| 3300024250|Ga0228677_1122895 | Not Available | 514 | Open in IMG/M |
| 3300024294|Ga0228664_1067419 | Not Available | 827 | Open in IMG/M |
| 3300024326|Ga0228652_1059620 | Not Available | 962 | Open in IMG/M |
| 3300025610|Ga0208149_1102923 | Not Available | 684 | Open in IMG/M |
| 3300025622|Ga0209264_1032770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1497 | Open in IMG/M |
| 3300025643|Ga0209151_1098704 | Not Available | 781 | Open in IMG/M |
| 3300025672|Ga0209663_1122704 | Not Available | 768 | Open in IMG/M |
| 3300025676|Ga0209657_1071731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1147 | Open in IMG/M |
| 3300025719|Ga0209252_1011490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4045 | Open in IMG/M |
| 3300025722|Ga0209660_1107306 | Not Available | 970 | Open in IMG/M |
| 3300025751|Ga0208150_1191803 | Not Available | 633 | Open in IMG/M |
| 3300025810|Ga0208543_1012114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2200 | Open in IMG/M |
| 3300025815|Ga0208785_1070511 | Not Available | 922 | Open in IMG/M |
| 3300025840|Ga0208917_1165930 | Not Available | 758 | Open in IMG/M |
| 3300025881|Ga0209309_10023946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4022 | Open in IMG/M |
| 3300025892|Ga0209630_10043066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2762 | Open in IMG/M |
| 3300025894|Ga0209335_10015343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5782 | Open in IMG/M |
| 3300025894|Ga0209335_10055738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2321 | Open in IMG/M |
| 3300025894|Ga0209335_10094166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1595 | Open in IMG/M |
| 3300025894|Ga0209335_10244688 | Not Available | 793 | Open in IMG/M |
| 3300026268|Ga0208641_1048073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1322 | Open in IMG/M |
| 3300026270|Ga0207993_1060883 | Not Available | 1059 | Open in IMG/M |
| 3300026517|Ga0228607_1179504 | Not Available | 502 | Open in IMG/M |
| 3300027413|Ga0208950_1021490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1873 | Open in IMG/M |
| 3300027553|Ga0208947_1032888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1335 | Open in IMG/M |
| 3300027801|Ga0209091_10252978 | Not Available | 855 | Open in IMG/M |
| 3300027813|Ga0209090_10332076 | Not Available | 746 | Open in IMG/M |
| 3300027830|Ga0209359_10557667 | Not Available | 528 | Open in IMG/M |
| 3300027859|Ga0209503_10211465 | Not Available | 933 | Open in IMG/M |
| 3300027906|Ga0209404_11270908 | Not Available | 507 | Open in IMG/M |
| 3300028284|Ga0257120_1031382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1559 | Open in IMG/M |
| 3300028397|Ga0228639_1034963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1513 | Open in IMG/M |
| 3300028397|Ga0228639_1166399 | Not Available | 502 | Open in IMG/M |
| 3300028418|Ga0228615_1041941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1420 | Open in IMG/M |
| 3300028418|Ga0228615_1144646 | Not Available | 617 | Open in IMG/M |
| 3300028418|Ga0228615_1185265 | Not Available | 517 | Open in IMG/M |
| 3300031775|Ga0315326_10362075 | Not Available | 945 | Open in IMG/M |
| 3300031851|Ga0315320_10371048 | Not Available | 1000 | Open in IMG/M |
| 3300031851|Ga0315320_10710814 | Not Available | 643 | Open in IMG/M |
| 3300032011|Ga0315316_10857096 | Not Available | 746 | Open in IMG/M |
| 3300032047|Ga0315330_10670813 | Not Available | 607 | Open in IMG/M |
| 3300032047|Ga0315330_10747403 | Not Available | 565 | Open in IMG/M |
| 3300032073|Ga0315315_11472032 | Not Available | 591 | Open in IMG/M |
| 3300032088|Ga0315321_10120758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1771 | Open in IMG/M |
| 3300032088|Ga0315321_10274574 | Not Available | 1082 | Open in IMG/M |
| 3300032088|Ga0315321_10278731 | Not Available | 1072 | Open in IMG/M |
| 3300032088|Ga0315321_10715914 | Not Available | 578 | Open in IMG/M |
| 3300032088|Ga0315321_10759727 | Not Available | 555 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 24.04% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 12.50% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.13% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 8.17% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 8.17% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.69% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 6.73% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 4.33% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.85% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.88% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.40% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.40% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.44% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.96% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.96% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.96% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.48% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.48% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.48% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.48% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.48% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.48% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000148 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100m | Environmental | Open in IMG/M |
| 3300000150 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 48 08/11/10 120m | Environmental | Open in IMG/M |
| 3300000153 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 135m | Environmental | Open in IMG/M |
| 3300000167 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 120m | Environmental | Open in IMG/M |
| 3300000168 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10m | Environmental | Open in IMG/M |
| 3300000174 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 60 08/10/11 200m | Environmental | Open in IMG/M |
| 3300000192 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 60 08/10/11 100m | Environmental | Open in IMG/M |
| 3300000324 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 48 08/11/10 100m | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001832 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM6, ROCA_DNA131_0.2um_27b | Environmental | Open in IMG/M |
| 3300001937 | Marine microbial communities from the Equatorial Pacific Ocean - GS037 | Environmental | Open in IMG/M |
| 3300001946 | Marine microbial communities from North James Bay, Santigo Island, Equador | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300001951 | Marine microbial communities from North Seamore Island, Equador - GS034 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002033 | Marine microbial communities from the Sargasso Sea - GS000a &b | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300003185 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003501 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_130m_DNA | Environmental | Open in IMG/M |
| 3300004276 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165m | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006337 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025m | Environmental | Open in IMG/M |
| 3300006351 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m | Environmental | Open in IMG/M |
| 3300006412 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0125m | Environmental | Open in IMG/M |
| 3300006480 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075m | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007114 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', waterEBis4 | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020177 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020269 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556080-ERR599041) | Environmental | Open in IMG/M |
| 3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
| 3300020293 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556092-ERR599063) | Environmental | Open in IMG/M |
| 3300020339 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX555929-ERR599080) | Environmental | Open in IMG/M |
| 3300020346 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556057-ERR599069) | Environmental | Open in IMG/M |
| 3300020351 | Marine microbial communities from Tara Oceans - TARA_B100000676 (ERX555955-ERR599089) | Environmental | Open in IMG/M |
| 3300020362 | Marine microbial communities from Tara Oceans - TARA_A100001234 (ERX556035-ERR599049) | Environmental | Open in IMG/M |
| 3300020370 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX556065-ERR599079) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
| 3300020393 | Marine microbial communities from Tara Oceans - TARA_B100000161 (ERX556105-ERR599054) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020455 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300024185 | Seawater microbial communities from Monterey Bay, California, United States - 84D | Environmental | Open in IMG/M |
| 3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
| 3300024192 | Seawater microbial communities from Monterey Bay, California, United States - 47D | Environmental | Open in IMG/M |
| 3300024226 | Seawater microbial communities from Monterey Bay, California, United States - 81D | Environmental | Open in IMG/M |
| 3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
| 3300024250 | Seawater microbial communities from Monterey Bay, California, United States - 58D_r | Environmental | Open in IMG/M |
| 3300024294 | Seawater microbial communities from Monterey Bay, California, United States - 78D | Environmental | Open in IMG/M |
| 3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025622 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_150m (SPAdes) | Environmental | Open in IMG/M |
| 3300025643 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165m (SPAdes) | Environmental | Open in IMG/M |
| 3300025672 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI073_LV_135m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025676 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025719 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_135m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025722 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300026268 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes) | Environmental | Open in IMG/M |
| 3300026270 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes) | Environmental | Open in IMG/M |
| 3300026517 | Seawater microbial communities from Monterey Bay, California, United States - 8D | Environmental | Open in IMG/M |
| 3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027553 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028284 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10 | Environmental | Open in IMG/M |
| 3300028397 | Seawater microbial communities from Monterey Bay, California, United States - 50D | Environmental | Open in IMG/M |
| 3300028418 | Seawater microbial communities from Monterey Bay, California, United States - 16D | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100550245 | 3300000117 | Marine | AVSSQLDSIPRINGFLLIQIVSINCTISLQEGNIK* |
| DelMOWin2010_101275862 | 3300000117 | Marine | AVSSQLDSIPRINGFLLIQIVSINCTISLQEGNIN* |
| SI47jul10_100mDRAFT_10357822 | 3300000148 | Marine | FSVIIDAAVSSQLDSIPRIKGFLLIQLVFINCTISIQVRNKFIYEK* |
| SI48aug10_120mDRAFT_10299392 | 3300000150 | Marine | SSQLDSIPRIKGFLLIQIVFINCTISIQVRNKFIYE* |
| SI39nov09_135mDRAFT_10141941 | 3300000153 | Marine | VIMDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNKIIYE* |
| SI39nov09_120mDRAFT_10793941 | 3300000167 | Marine | IDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFL* |
| LPjun09P1210mDRAFT_10139952 | 3300000168 | Marine | DAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEE* |
| SI60aug11_200mDRAFT_10435032 | 3300000174 | Marine | AVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNKFIYE* |
| SI60aug11_100mDRAFT_10228961 | 3300000192 | Marine | SQLDSIPRIKGFLLIQIVFINCTISIQVRNKIIYE* |
| SI60aug11_100mDRAFT_10571061 | 3300000192 | Marine | AVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFL* |
| SI48aug10_100mDRAFT_10385951 | 3300000324 | Marine | SSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFL* |
| BBAY94_101629871 | 3300000949 | Macroalgal Surface | VSSQLVSIPRIKGFLLIQIVFNNCTFPIQERNKFIYD* |
| JGI20159J14440_101121532 | 3300001353 | Pelagic Marine | AAVSSQLDSIPRIRGFLIIQIVFINCTISIQVRNKLIYE* |
| ACM6_10018241 | 3300001832 | Marine Plankton | SVIKEAAVSSQLDSIPRIKGFLLIQIVFNNCTIFIQVRNNFL* |
| GOS2252_10036292 | 3300001937 | Marine | SFSVIKDAAVSSQLDSIPKIKGFLLIQIVFINCTISIQVRNKFIYE* |
| GOS2244_10251352 | 3300001946 | Marine | INDAAVSSQLDSIPRIMGFLLIQIVFNNCTISIQVMK* |
| GOS2218_10286074 | 3300001947 | Marine | VIIEAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYA* |
| GOS2249_10179033 | 3300001951 | Marine | IMDAAVSSQLDSIPRIKGFLLIQILFINCTISIKKRNNFIND* |
| GOS2243_10166434 | 3300001965 | Marine | IKEAAVSSQLDSIPRIKGFLLIQIVFNNCTILIQVRNKFI* |
| GOS2243_10548994 | 3300001965 | Marine | FSDIIDAAVSSQLDSIPRIKGFLLIQIVLNNCTISIQKRNKFINE* |
| GOS2246_101646414 | 3300001974 | Marine | IDAAVSSQLDSIPRIKGFLIIQIVFINCTIPIQVRK* |
| GOS2246_101791162 | 3300001974 | Marine | SVIKEAAVSSQLDSIPRIKGFLLIQIVFNNCTIFIQIRNKFL* |
| GOS24894_100632592 | 3300002033 | Marine | EAAVSSQLDSIPRIKGFLLIQIVFNNCTILIQVRNKFL |
| GOScombined01_1008056131 | 3300002040 | Marine | KDAAVSSQLDSFPRIKGFLFIQIVSINCTILIQERNKFIHE* |
| GOScombined01_1013952233 | 3300002040 | Marine | QLVSIPRIKGFLLIQIVFNNCTISIQVRNKYIYE* |
| GOScombined01_1030560742 | 3300002040 | Marine | AVSSQLDSIPRIKGFLLIQIVFNNCTILIQVRNKFL* |
| JGI26064J46334_10982001 | 3300003185 | Marine | VIIDAAVSSQLDSIPRIKGFLLIQLVFINCTISIQVRNKFIYE* |
| JGI26243J51142_10672112 | 3300003501 | Marine | PCSFSVIKDAAVSSQLVSIPRIKGFLLIQIVFINCTISIQVRNKFIYE* |
| Ga0066610_101615211 | 3300004276 | Marine | AVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEE* |
| Ga0066849_104007322 | 3300005430 | Marine | SFSVIKDAAVSSQLDSIPRIKGFLLIQIVFINCTIPIQVKINYL* |
| Ga0066861_102279612 | 3300005522 | Marine | AAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNKFIYE* |
| Ga0066865_102869442 | 3300005523 | Marine | VSSQLDSIPRIKGFLLIQIVFINCTIPIQVRNKYIYE* |
| Ga0066835_102643942 | 3300005606 | Marine | QLDSIPRIKGFLLIQIVFINCTILIQERNKFIHE* |
| Ga0078893_100354732 | 3300005837 | Marine Surface Water | AVSSQLVSMPRIIGFLLIQIVIINSTIFIQERKKN* |
| Ga0078893_103862663 | 3300005837 | Marine Surface Water | TEAAVSSQLDSIPRIIGFLLIQIGSINSTISLQV* |
| Ga0008649_101124183 | 3300005838 | Marine | SSQLVSIPRIKGFLLIQIVFINCTISIQVRNKFIYE* |
| Ga0066370_103294562 | 3300005971 | Marine | KEAAVSSQLDSIPRIKGFLLIQIVFNNCTIFIQVRNNFL* |
| Ga0068495_13948371 | 3300006337 | Marine | DISDAAVSSQLDSIPRIKGFLLIQIVMINCTISIKKRNKYKN* |
| Ga0099953_10761261 | 3300006351 | Marine | SFSVIIEAAVSSQLVSIPRIKGFLLIQIVFNNCTISIQVRNKYIYE* |
| Ga0099955_10377701 | 3300006412 | Marine | ITEAAVSSQLVSIPRIKGFLLIQIVFNNCTFPIQERNKFIYD* |
| Ga0100226_10171582 | 3300006480 | Marine | AVSSQLDSIPRIKGFLLIQIVFNNCTIFIQVRNNFL* |
| Ga0075476_100469841 | 3300006867 | Aqueous | LIIAAAVSSQLDSIPRINGFLLIQIVSINCTISLQEGNIN* |
| Ga0075475_101571411 | 3300006874 | Aqueous | VSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE* |
| Ga0101668_10921521 | 3300007114 | Volcanic Co2 Seep Seawater | EAAVSSQLVSIPRIKGFLLIQIVFNNCTFPIQERNKFIYD* |
| Ga0075463_100979211 | 3300007236 | Aqueous | AAAVSSQLDSIPRINGFLLIQIVSINCTISLQEGNIN* |
| Ga0102889_12576042 | 3300008964 | Estuarine | IIDAAVSSQLDSIPRIKGFLLIQLVFINCTISIQVRNKFIYEK* |
| Ga0102960_10437813 | 3300009000 | Pond Water | AAVSSQLDSIPRINGFLLIQIVSINCTISLQEGNIN* |
| Ga0115552_10575571 | 3300009077 | Pelagic Marine | SLIIAAAVSSQLDSIPRINGFLLIQIVSINCTISLQEGNIK* |
| Ga0115545_11455092 | 3300009433 | Pelagic Marine | AAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNKFIYEK* |
| Ga0115560_11907472 | 3300009447 | Pelagic Marine | IEAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE* |
| Ga0115555_13916042 | 3300009476 | Pelagic Marine | IKDAAVSSQLDSIPSISGFLFIQIVFINCTISLQVRNKLIYG* |
| Ga0115012_100737661 | 3300009790 | Marine | VSSQLDSIPRIIVFLLIQIVFNNSTIFIQIRNKFYEK* |
| Ga0115012_107881281 | 3300009790 | Marine | IDAAVSSQLDSIPRIKGFLLIQIVFNNCTISLQKRNKFINE* |
| Ga0115012_109846671 | 3300009790 | Marine | DAAVSSQLDSIPKIKGFLLIQIVFINCTIPIQVRNKFIYE* |
| Ga0129348_10425571 | 3300010296 | Freshwater To Marine Saline Gradient | VSSQLDSIPRINGFLLIQIVSINCTISLQEGNIN* |
| Ga0129348_10478613 | 3300010296 | Freshwater To Marine Saline Gradient | VSSQLDSIPRINGFLLIQIVSINCTISLQEGNIK* |
| Ga0129351_12628601 | 3300010300 | Freshwater To Marine Saline Gradient | EAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE* |
| Ga0163110_111438711 | 3300012928 | Surface Seawater | AVSSQLDSIPRIKGFLLIQIVFNNCTISIQKRNKFINE* |
| Ga0163109_107454661 | 3300012936 | Surface Seawater | VSSQLDSIPRIKGFLLIQIVFNNCTIPIQERNKLIYE* |
| Ga0163109_112307231 | 3300012936 | Surface Seawater | VSSQLDSIPRIKGFLLIQIVFNNCTILIQVRNKFL* |
| Ga0163111_100901181 | 3300012954 | Surface Seawater | IIDAAVSSQLDSIPRIKGFLLIQIVFINCTIPIQVRNKYIYE* |
| Ga0163111_102179261 | 3300012954 | Surface Seawater | DIIDAAVSSQLDSIPKIKGFLFIQIVFNNCTISKQKRNKFINA* |
| Ga0163111_110962701 | 3300012954 | Surface Seawater | IDAAVSSQLVSIPRIKGFLLIQIVFNNCTISIQVKIKFIYE* |
| Ga0163111_119572971 | 3300012954 | Surface Seawater | FSVTKDAAVSSQLDSIPRIKGFLLIQILFIDCTISIQVRNKFIYE* |
| Ga0163111_124440741 | 3300012954 | Surface Seawater | IIDAAVSSQLDSIPRIKGFLLIQIVINNCTISKKKRNKFINGKKNNNRI* |
| Ga0163111_126238442 | 3300012954 | Surface Seawater | SVIKDAAVSSQLDSIPRIKGFLLIQIVFNNCTIPIQVRNKLIYE* |
| Ga0181387_10477412 | 3300017709 | Seawater | SVIIEAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0181404_11580552 | 3300017717 | Seawater | SFSVTIEAAVSSQLDSIPRIIGFLLIQIGSINSTISLQVXKKKKL |
| Ga0181416_10412401 | 3300017731 | Seawater | TPFSFSVIIDAAVSSQLDSIPRIRGFLLIQIVFNNCTISIQVRNKFIYD |
| Ga0181415_10782221 | 3300017732 | Seawater | KDAAVSSQLDSIPKIKGFLLIQIVFINCTIPIQVRNKFIYE |
| Ga0181421_10888512 | 3300017741 | Seawater | IIDAAVSSHLDSIPRVKVFLLIQIVFINCTISIQVRNKFFYEEKNNYWN |
| Ga0181421_11852872 | 3300017741 | Seawater | XEGECSFSVIIDAAVSSQLDSIPRIKGFLVIQIVFINCTISIQVRNIFIYE |
| Ga0181399_11048932 | 3300017742 | Seawater | SVIIEAAVSSQLDSIPRIKGFLIIQIVFINCTISIQVRNTFIYE |
| Ga0181392_11826341 | 3300017749 | Seawater | NSAFLSQLDSISRIKSFLLIKIVFINCTISIQVRNIFIYEE |
| Ga0181382_10203714 | 3300017756 | Seawater | AAVSSQLDSIPRIKGFLLIQIVFNNCTIPIQVRNKFFYE |
| Ga0181422_10707702 | 3300017762 | Seawater | FSVMIDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0181395_10679213 | 3300017779 | Seawater | IIDAAVSSQLDSIPRIKGFLLIQIVFNNCTISIKKRNKFINE |
| Ga0181395_10835202 | 3300017779 | Seawater | AAVSSQLDSIPRIKGFLLIQIVFNNCTISIQVRNKFIYE |
| Ga0181423_13115041 | 3300017781 | Seawater | IDAAVSSQLDSIPRINGFLVIQIVFINCTISIQVRNIFIYE |
| Ga0181379_10793731 | 3300017783 | Seawater | QLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYAEKIYHWI |
| Ga0181424_100754353 | 3300017786 | Seawater | AAVSSQLDSIPRIKGFLLIQIVFNNCTIPIQERNKLIYE |
| Ga0181424_100755734 | 3300017786 | Seawater | AAVSSQLDSIPRIKGFLLIQIVFINCTNSIQVRNIFIYAEKIYHWI |
| Ga0181583_105691952 | 3300017952 | Salt Marsh | AAVSSQLVSIPRIKGFLLIQIVFNNCTISIQVRNKIIHG |
| Ga0181582_102383363 | 3300017958 | Salt Marsh | AAVSSQLDSIPRINGFLLIQIVSINCTISLQEGNIN |
| Ga0181581_106826682 | 3300017962 | Salt Marsh | AVSSQLDSIPRIKGFLLIQIVFNNCTIRIQKRNKFINE |
| Ga0181590_104095242 | 3300017967 | Salt Marsh | LDSIPRINGFLLIQIVSINCTISLQERNIKFINEKTKNSYWF |
| Ga0181600_101884971 | 3300018036 | Salt Marsh | AAAVSSQLDSIPRINGFLLIQIVSINCTISLQERNIKFINEKTKNSYWL |
| Ga0181592_105957551 | 3300018421 | Salt Marsh | AVSSQLVSIPRIKGFLLIQIVFNNCTISIQVRNKIIHG |
| Ga0181566_103538212 | 3300018426 | Salt Marsh | DAAVSSQLDSIPRIKGFLLIQIIFNNCTIRIQKRNKLIND |
| Ga0181568_105084011 | 3300018428 | Salt Marsh | VSSQLDSIPRIIGFLLIQIGSINSTISLQVXKKKKL |
| Ga0181595_103843642 | 3300020053 | Salt Marsh | VIIDAAVSSQLDSIPRIIGFLLIQIGSINSTISLQV |
| Ga0181575_102561932 | 3300020055 | Salt Marsh | SFSVIIDAAVSSQLVSIPRIKGFLLIQIVFNNCTISIQVRNKIIHG |
| Ga0181596_101412793 | 3300020177 | Salt Marsh | SVIIDAAVSSQLDSIPRIIGFLLIQIGSINSTISLQV |
| Ga0181570_101251361 | 3300020207 | Salt Marsh | AAVSSQLDSIPRINGFLLIQIVSINCTISLQERNIKFINEKTKNSYWF |
| Ga0181570_102568511 | 3300020207 | Salt Marsh | AAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0181570_105759841 | 3300020207 | Salt Marsh | FSVITEAAVSSQLDSIPRIIGFLLIQIGSINSTISLQVXKKKKL |
| Ga0211484_10331502 | 3300020269 | Marine | VSSQLVSMPRINGFLFIQIVFINSTIFIQERKKIL |
| Ga0211667_11078771 | 3300020282 | Marine | IKDAAVSSQLVSIPRIKGFLLIQIVFNNCTIPIQVRNDFL |
| Ga0211665_10134553 | 3300020293 | Marine | FSVTKDAAVSSQLDSIPRIKGFLLIQISFNNCTISIQVRNIFL |
| Ga0211605_10467731 | 3300020339 | Marine | VTKDAAVSSQLDSIPRIKGFLLIQIVFINCTILIQERNKFIHG |
| Ga0211607_10301291 | 3300020346 | Marine | PSLFSDIIDAAVSSQLDSIPRIIGFLFIKIVSINSTIFIQERKKI |
| Ga0211601_10794812 | 3300020351 | Marine | EAAVSSQLDSIPRIKGFLLIQIVFNNCTISIQKRNKFINE |
| Ga0211488_100911022 | 3300020362 | Marine | AVSSQLDSIPRIKGFLLIQIVMINCTISIKKRNKFIYE |
| Ga0211488_101112132 | 3300020362 | Marine | SFSVNIDAAVSSQLVSIPRIKGFLLIQIVFNNCTISLQKRNKFIDE |
| Ga0211672_101986751 | 3300020370 | Marine | AVSSQLVSIPRIKGFLLIQIVFINCTISIQVRNKFIYE |
| Ga0211647_101574931 | 3300020377 | Marine | PRIKGFLLIQIVFNNCTIPIQVRNKLIYEQENNNWI |
| Ga0211527_102023381 | 3300020378 | Marine | SVIIEAAVSSQLDSIPRIIGFLLIQIVFINSTISLQV |
| Ga0211498_103476221 | 3300020380 | Marine | AAVSSQLVSIPRIKGFLLIQIVFNNCTISLQKRNKFIDE |
| Ga0211476_101363571 | 3300020381 | Marine | SIPRIKGFLLIQLVFNNCTISLQVRNKFIYAKENNHWI |
| Ga0211678_101870602 | 3300020388 | Marine | AVSSQLDSIPRIKGFLLIQIVFINCTIPIQVRNKFIYE |
| Ga0211675_102587741 | 3300020391 | Marine | VTKDAAVSSQLDSIPRIKGFLLIQISFNNCTISIQVRNIFL |
| Ga0211618_101051781 | 3300020393 | Marine | SQLDSIPRIKGFLLIQIVLDNCTISIQKRNKFINA |
| Ga0211636_101421892 | 3300020400 | Marine | IKEAAVSSQLDSIPRIKGFLLIQIVFINCTISIQKRNKFIND |
| Ga0211659_102353252 | 3300020404 | Marine | DAAVSSQLDSIPRIKGFLFIQIVFNNCTISKQKRNKFINE |
| Ga0211659_103339072 | 3300020404 | Marine | EAAVSSQLDSIPRIKGFLLIQIVFNNCTIFIQVRNNFL |
| Ga0211587_100980553 | 3300020411 | Marine | NIDAAVSSQLDSIPRIIVFLLIQIVFNNSTIFIQIRNKFYEK |
| Ga0211523_101623061 | 3300020414 | Marine | IDAAVSSQLDSIPSIRGFLLIQIVLDNCTISIQKRNKFINE |
| Ga0211644_101630301 | 3300020416 | Marine | PSSFSVIKEAAVSSQLDSIPRIKGFLLIQIVFNNCTIFIQVRNNFLXEKK |
| Ga0211528_101396271 | 3300020417 | Marine | DAAVSSQLDSIPRIKGFLLIQIVFNNCTISVQKINKFINE |
| Ga0211528_101411882 | 3300020417 | Marine | QLDSIPRIKGFLLIQIVFYNCTISLQKINKLINEKKNNNWI |
| Ga0211557_100862223 | 3300020418 | Marine | SVTIDAAVSSQLDSIPNIIGFLLIQIDPINSTISLQV |
| Ga0211557_104084031 | 3300020418 | Marine | EAAVSSQLDSIPRIRGFLLIKIVFNNCTILIQVRNKFL |
| Ga0211521_101417561 | 3300020428 | Marine | RIKGFLLIQIVFINCTISIQERNKFNYEENNHWIKK |
| Ga0211554_104599881 | 3300020431 | Marine | DAAVSSQLDSIPRIKGFLLIQIVFNNCTIPIQERNKLIYE |
| Ga0211539_100313921 | 3300020437 | Marine | SQLDSIPRIKGFLLIQIVFNNCTISLQKRNKFINE |
| Ga0211576_104696352 | 3300020438 | Marine | IPRIKGFLLIQIVFINCTISIQVRNKFFYEEKNNYWN |
| Ga0211558_101239911 | 3300020439 | Marine | LSFSVNIDAAVSSQLVSIPRIKGFLLIQIVFNNCTISLQKRNKFIDE |
| Ga0211574_104430662 | 3300020446 | Marine | KDAAVSSQLDSIPKIKGFLLIQIVFINCTISIQVRNKFIYE |
| Ga0211641_104430431 | 3300020450 | Marine | AAVSSQLDSIPRIKGFLLIQISFNNCTISIQVRNIFL |
| Ga0211664_105291771 | 3300020455 | Marine | PRSFSDIIDAAVSSQLDSIPRIKGFLLIQIVLNNCTISIQKRNKFINEQ |
| Ga0211643_105712121 | 3300020457 | Marine | SSQLVSIPKIKGFLLIQIVFINCTILVHVKKHIYE |
| Ga0211535_101315442 | 3300020461 | Marine | SFSVIKEAAVSSQLDSIPRIKGFLLIQIVFNNCTILIQVRNKFL |
| Ga0211676_1000117138 | 3300020463 | Marine | SSQLDSIPRIKGFLLIQIVFINCTILIQERNKLIYE |
| Ga0211694_101194822 | 3300020464 | Marine | AAVSSQLVSIPRINGFLLIQIVFINCTISIQVRNKFFYEDKNNNWI |
| Ga0211640_101484423 | 3300020465 | Marine | SVTKDAAVSSQLDSIPRIKGFLLIQIVFINCTILIQERNKFIHD |
| Ga0211475_100485711 | 3300020468 | Marine | EAAVSSQLDSIPRIKGFLLIKIVFNNCTILIQVRNKFL |
| Ga0211475_101767261 | 3300020468 | Marine | IIDAAVSSQLDSIPRIIGFLFIQIVSINSTISLQA |
| Ga0211577_102480693 | 3300020469 | Marine | DAAVSSQLVSIPRIKGFLLIQIVFNNCTISIQVKIKFIYE |
| Ga0211577_103936711 | 3300020469 | Marine | IKDAAVSSQLDSIPKIKGFLLIQIVFINCTISIQVRNKFIYE |
| Ga0211614_100815523 | 3300020471 | Marine | SSQLDSIPRIKGFLLIQIVFNNCTISIQVRNKFIYEQTNNDWI |
| Ga0211579_100825844 | 3300020472 | Marine | AAVSSQLDSIPKIKGFLLIQIVFNNCTISIQKRNKLIND |
| Ga0211547_102460502 | 3300020474 | Marine | XLSSSVTIDAAVSSQLDSIPKIMGFLFIKIVFNNSTIFIQIGNKLNEKKNNYWF |
| Ga0206677_101565611 | 3300021085 | Seawater | SFSVIIAAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0206677_102227551 | 3300021085 | Seawater | SVIIDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0213861_100259231 | 3300021378 | Seawater | FSLIIAAAVSSQLDSIPRINGFLLIQIVSINCTISLQEGNIK |
| Ga0213866_100707241 | 3300021425 | Seawater | AAAVSSQLDSIPRINGFLLIQIVSINCTISLQEGNIK |
| Ga0213866_102043182 | 3300021425 | Seawater | SFSVIIEAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0222713_100618951 | 3300021962 | Estuarine Water | FSLIIAAAVSSQLDSIPRINGFLLIQIVSINCTISLQEGNIN |
| (restricted) Ga0233427_100719961 | 3300022933 | Seawater | VSSQLDSIPRIKGFLLIQIVFINCTISIQVRNKIIYE |
| (restricted) Ga0233427_101639391 | 3300022933 | Seawater | QLDSIPRIKGFLLIQIVFINCTISIQVRNKFIYEQKNHHRI |
| Ga0255770_103327082 | 3300022937 | Salt Marsh | DAAVSSQLVSIPRIKGFLLIQIVFNNCTISIQVRNKIIHG |
| Ga0255782_100886101 | 3300023105 | Salt Marsh | LTMAAAVSSQLDSIPRINGFLLIQIVSINCTISLQERNIKFINEKTKNSYWF |
| Ga0255743_102657012 | 3300023110 | Salt Marsh | MLDAAVSSQLVSIPRIKGFLLIQIVFNNCTISIQVRNKFIYG |
| Ga0255772_102690081 | 3300023176 | Salt Marsh | FSLIMAAAVSSQLDSIPRINGFLLIQIVSINCTISLQERNIKFINEKTKNSYWF |
| Ga0255759_101596833 | 3300023178 | Salt Marsh | GAAVSSQLDSIPRIKGFLLIQIVFNNCTISIQKRNKFINE |
| Ga0228669_11114231 | 3300024185 | Seawater | AVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0228636_11469792 | 3300024191 | Seawater | FSVIIDAAVSSQLDSIPRIKGFLVIQIVFINCTISIQVRNIFIYE |
| Ga0228637_10893102 | 3300024192 | Seawater | SFSVIIDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0228667_11066491 | 3300024226 | Seawater | AVSSQLDSIPRIKGFLLIQLVFINCTISIQVRNKFIYEK |
| Ga0228653_10781582 | 3300024237 | Seawater | DAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0228677_11228952 | 3300024250 | Seawater | AAVSSQLDSIPRIKGFLLIQLVFINCTISIQVRNKFIYEK |
| Ga0228664_10674192 | 3300024294 | Seawater | INDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEK |
| Ga0228652_10596202 | 3300024326 | Seawater | PCSFSVIIDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0208149_11029232 | 3300025610 | Aqueous | AAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYA |
| Ga0209264_10327701 | 3300025622 | Marine | IEAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYAEKIYHWI |
| Ga0209151_10987041 | 3300025643 | Marine | IEAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEE |
| Ga0209663_11227041 | 3300025672 | Marine | IIEAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEE |
| Ga0209657_10717311 | 3300025676 | Marine | SQLDSIPRIKGFLLIQIVFINCTISIQVRNKFIYEQKNHHRI |
| Ga0209252_10114906 | 3300025719 | Marine | FSVIIDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEE |
| Ga0209660_11073061 | 3300025722 | Marine | LDSIARIKGFLLIQIVFINCTISIQVRNKFIYEQKNHHRI |
| Ga0208150_11918032 | 3300025751 | Aqueous | IEAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYA |
| Ga0208543_10121144 | 3300025810 | Aqueous | LDSIPRIKGFLLIQIVFINCTISIQVRNIFIYAEKIYHWI |
| Ga0208785_10705111 | 3300025815 | Aqueous | PCSFSVMIDAAVSSQLDSIPRIIGFLLIQIGSINSTISLQV |
| Ga0208917_11659301 | 3300025840 | Aqueous | ITAAAVSSQLDSIPRINGFLLIQIVSINCTISLQEGNIN |
| Ga0209309_100239461 | 3300025881 | Pelagic Marine | IIEAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEQENRYWIKRE |
| Ga0209630_100430661 | 3300025892 | Pelagic Marine | FSVIKDAAVSSQLDSIPSISGFLFIQIVFINCTISLQVRNKLIYG |
| Ga0209335_1001534310 | 3300025894 | Pelagic Marine | VSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0209335_100557384 | 3300025894 | Pelagic Marine | VSSQLDSIPRIKGFLLIQIVFINCTISIQVRNKFIYE |
| Ga0209335_100941663 | 3300025894 | Pelagic Marine | AAVSSQLDSIPRIKGFLVIQLVFINCTISLQVRNKFIYE |
| Ga0209335_102446881 | 3300025894 | Pelagic Marine | SIPRIKGFLLIQIVFINCTISIQVRNKLIYEKKNNYWF |
| Ga0208641_10480731 | 3300026268 | Marine | DAAVSSQLDSIPRIIVFLLIQIVFNNSTIFIQIRNKFYEK |
| Ga0207993_10608832 | 3300026270 | Marine | AVSSQLDSIPRIKGFLLIQIVFNNCTIPIQVRNKLIYEQENNNWI |
| Ga0228607_11795041 | 3300026517 | Seawater | NDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEK |
| Ga0208950_10214904 | 3300027413 | Marine | AAVSSQLDSIPRIRGFLLIQIVFINCTISIQVRNKFIYE |
| Ga0208947_10328883 | 3300027553 | Marine | RIKGFLLIQIVFINCTISIQVRNKFIYEQKNHHRI |
| Ga0209091_102529781 | 3300027801 | Marine | SVIIETAVSSQLDSIPSIMGFLFIKLVFINNTISIQVXSIKQLNEK |
| Ga0209090_103320761 | 3300027813 | Marine | AAVSSQLVSIPRIKGFLVIQLVFINCTISIQVRNKNTYE |
| Ga0209359_105576671 | 3300027830 | Marine | AVSSQLDSIPRIKGFLLIQIVLNNCTISIQKRNKFINE |
| Ga0209503_102114651 | 3300027859 | Marine | SQLDSIPRIKGFLLIQIVFNNCTIPIQVRNKFFYE |
| Ga0209404_112709082 | 3300027906 | Marine | QLDSIPRIKGFLDIQIVFINCKILLQVRNKYIYEYENNHRI |
| Ga0257120_10313821 | 3300028284 | Marine | IIDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0228639_10349633 | 3300028397 | Seawater | IDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0228639_11663991 | 3300028397 | Seawater | AVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEE |
| Ga0228615_10419413 | 3300028418 | Seawater | DAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEE |
| Ga0228615_11446462 | 3300028418 | Seawater | VSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEE |
| Ga0228615_11852651 | 3300028418 | Seawater | SFSVIIDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNKFIYEQENNYWI |
| Ga0315326_103620752 | 3300031775 | Seawater | QLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEE |
| Ga0315320_103710482 | 3300031851 | Seawater | VITDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYG |
| Ga0315320_107108142 | 3300031851 | Seawater | IDAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEE |
| Ga0315316_108570961 | 3300032011 | Seawater | AVSSQLDSIPKIKGFLLIQLVFINCTISIQVRNKFIYE |
| Ga0315330_106708131 | 3300032047 | Seawater | AAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYEE |
| Ga0315330_107474032 | 3300032047 | Seawater | VIKDAAVSSQLDSIPKIKGFLLIQIVFINCTISIQVRNKFIYE |
| Ga0315315_114720322 | 3300032073 | Seawater | IDAAVSSQLDSIPRIKGFFLIQIVFINCTISIQVRNKFIYE |
| Ga0315321_101207581 | 3300032088 | Seawater | SFSVIKDAAVSSQLDSIPRIKGFLLIQLVFINCTISIQVRNKFIYE |
| Ga0315321_102745742 | 3300032088 | Seawater | SFSVIIDAAVSSQLDSIPRIKGFLLIQLVFINCTISIQVRNKFIYEK |
| Ga0315321_102787311 | 3300032088 | Seawater | SIPRIKGFLLIQIVFINCTISIQVRNKFIYEQKNHHRI |
| Ga0315321_107159142 | 3300032088 | Seawater | IEAAVSSQLDSIPRIKGFLLIQIVFINCTISIQVRNIFIYE |
| Ga0315321_107597272 | 3300032088 | Seawater | IARIKGFLLIQIVFINCTISIQVRNKFIYEQKNHHRI |
| ⦗Top⦘ |