 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F023591 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 209 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MSCSGGKSTKKGSYNKANNLKQPTSYTIDKNGNVKPIYK |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 209 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 12.20 % |
| % of genes near scaffold ends (potentially truncated) | 16.27 % |
| % of genes from short scaffolds (< 2000 bps) | 60.29 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.512 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.488 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.148 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.895 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.97% β-sheet: 11.94% Coil/Unstructured: 82.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 209 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 48.80 |
| PF06745 | ATPase | 8.13 |
| PF06414 | Zeta_toxin | 4.31 |
| PF10263 | SprT-like | 2.87 |
| PF02151 | UVR | 2.39 |
| PF13481 | AAA_25 | 1.91 |
| PF01467 | CTP_transf_like | 0.96 |
| PF05728 | UPF0227 | 0.96 |
| PF13479 | AAA_24 | 0.96 |
| PF01464 | SLT | 0.48 |
| PF01370 | Epimerase | 0.48 |
| PF02146 | SIR2 | 0.48 |
| PF01025 | GrpE | 0.48 |
| PF01510 | Amidase_2 | 0.48 |
| PF00303 | Thymidylat_synt | 0.48 |
| PF07068 | Gp23 | 0.48 |
| PF01227 | GTP_cyclohydroI | 0.48 |
| PF13585 | CHU_C | 0.48 |
| PF07460 | NUMOD3 | 0.48 |
| PF00535 | Glycos_transf_2 | 0.48 |
| PF13578 | Methyltransf_24 | 0.48 |
| PF13392 | HNH_3 | 0.48 |
| PF04984 | Phage_sheath_1 | 0.48 |
| PF02562 | PhoH | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 209 Family Scaffolds |
|---|---|---|---|
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.48 |
| COG0576 | Molecular chaperone GrpE (heat shock protein HSP-70) | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.48 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.48 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.51 % |
| All Organisms | root | All Organisms | 22.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.49% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 11.96% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.13% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.26% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.83% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.87% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.87% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 2.39% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.91% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.91% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.44% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.44% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 1.44% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.44% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.44% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.96% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.48% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.48% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.48% |
| Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat | 0.48% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.48% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.48% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.48% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.48% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000119 | Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 01_9.5m | Environmental | Open in IMG/M |
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300002131 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS1 (111f) | Environmental | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004764 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006561 | Marine microbial communities from the Black Sea in Odessa region - Od_1 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007094 | Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A) | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012286 | Freshwater microbial communities from Ausable River, Ontario, Canada - S47 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022827 | Saline water microbial communities from Ace Lake, Antarctica - #333 | Environmental | Open in IMG/M |
| 3300022837 | Saline water microbial communities from Ace Lake, Antarctica - #1699 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023242 | Saline water microbial communities from Ace Lake, Antarctica - #1576 | Environmental | Open in IMG/M |
| 3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028081 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033494 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.226 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KGI_S1_ANT01_95mDRAFT_101260572 | 3300000119 | Marine | MGNCSGGSSSSTLKGKWNKKQNLQKPTGYVVDKKGNVKPTYK* |
| LV_Brine_h2_0102DRAFT_10010719 | 3300000405 | Hypersaline | MGNCSGGSSSGTLRGKFNKKQNLQKPKGYIVDKKGNVKPIYI* |
| Draft_100317412 | 3300000558 | Hydrocarbon Resource Environments | MSCSGGKSTKKGSYNKANNLKKPTGYTVDSKGNIKPLYK* |
| Draft_102005072 | 3300000558 | Hydrocarbon Resource Environments | MGCSGGKSTKKGSYNKANNLKKPTGYTVDSKGNIKPLYK* |
| Draft_100222422 | 3300001605 | Hydrocarbon Resource Environments | MSCSGGNSTKKGGYNKVNNLKNPIDYTVDKNGNIKPIYKK* |
| Draft_100239652 | 3300001605 | Hydrocarbon Resource Environments | MGCSGGSSTKKGGYNKVNNLKNPIDYTVDKKGNIKPIYKK* |
| M2t2BS1_128273029 | 3300002131 | Marine | MSCSGGKSTAKGRYNKANNLKQPTGYTVDNKGNVKPIYK* |
| MLSBCLC_107794922 | 3300002220 | Hydrocarbon Resource Environments | MSCSGGKSTKKGNYNKVNNLKNPIGYKIDKKGNIKPIYLKNKL* |
| JGI25908J49247_100928791 | 3300003277 | Freshwater Lake | MSCSGGKSTKKGGYNKADNLKKPTGYTVDKKGNVKPKYN* |
| Ga0007754_14125032 | 3300004764 | Freshwater Lake | MSCSGGKSTKKGDYNKANNLKKPTGYTVDKKGNVKPKYN* |
| Ga0007764_115739292 | 3300004797 | Freshwater Lake | MSCSGAKSVKKGGYNKSNNLKQPISYTIDKNGNVKPIYK* |
| Ga0078894_102803942 | 3300005662 | Freshwater Lake | MSCSGAKSVKKGGYNKSNNLKQPTSYTIDKNGNVKPIYK* |
| Ga0070744_1000933611 | 3300006484 | Estuarine | MSCSGGKSTKKGSYNKANNLKQPTSYTIDKNGNVKPIYK* |
| Ga0070744_100821552 | 3300006484 | Estuarine | MSCSSGKSTKKGSYNKANNLKQPISYTIDSKGNVKPIYLLKTK* |
| Ga0101389_10066192 | 3300006561 | Marine | MSCSSGKSTKKGRYNKANNLKSPISYIIDKKGNIKAIYSLN* |
| Ga0070749_103640712 | 3300006802 | Aqueous | MSCSGGKSVKKGGYNKANNLKQPVSYTIDKKGNIKPIYK* |
| Ga0070749_104473522 | 3300006802 | Aqueous | VYLLKLKDMSCSGGKSTKKGRYNKADNLKKPTGYTVDKNGNVKPKYN* |
| Ga0070754_100142752 | 3300006810 | Aqueous | MSCSKGKSTKKGSYNKSNNLKQPVSYTIDKNGNIKPIYK* |
| Ga0070754_101025725 | 3300006810 | Aqueous | MSCSKGKSTKKGSYNKANNLKQPVSYTIDKNGNVKNKEFEYAYA* |
| Ga0070746_100694882 | 3300006919 | Aqueous | MSCSKGKSTKKGSYNKANNLKQPVSYTIDKNGNVKPIYK* |
| Ga0070746_102183652 | 3300006919 | Aqueous | MSCSGKSTKKGNYNKANNLRKPTGYAIDKNGNIKPLYK* |
| Ga0102532_11707263 | 3300007094 | Freshwater Lake | MSCSGGKSTKKGKYSKKDNLKKPTGYTVDKKGNVKPMYN* |
| Ga0103961_12971064 | 3300007216 | Freshwater Lake | MSCSGGKSTKKGRYNKANNLKQPTGYTVDKKGNVKPKYN* |
| Ga0070745_10089385 | 3300007344 | Aqueous | MSCSGGKSTKRGRYNKANNLKKPTGYTVDKNGNVKPIYK* |
| Ga0070752_10653452 | 3300007345 | Aqueous | MSCSKGKSTKKGSYNKSNNLKQPVSYTIDKNGNVKPIYK* |
| Ga0099851_10165912 | 3300007538 | Aqueous | MSCSGGKSTKKGKYSKKNNLKKPTGYTVDKKGNVKPIYN* |
| Ga0099851_11290862 | 3300007538 | Aqueous | MSCSGGKSTSRGSYNRATNLKKPTGYTIDKKGNIKPTYNENNKK* |
| Ga0099849_100266117 | 3300007539 | Aqueous | MSCSGGKLTKKGRYNKANNLKKPTGYTVDKKGNVKPTYN* |
| Ga0099849_10200784 | 3300007539 | Aqueous | MSCSKGKSTKKGSYNKSNNLKQPVSYTIDKNGNIKSIYK* |
| Ga0099847_10725542 | 3300007540 | Aqueous | MSCSGGKSTKKGRYNKADNLKKPTGYTVDKNGNVKPKYN* |
| Ga0099848_10170314 | 3300007541 | Aqueous | MSCSGSKSTMKGSYNKANNLKQPISYTIDSKGNVKPIYATTKTK* |
| Ga0099848_11141851 | 3300007541 | Aqueous | DMNCSGGKSTKKGRYNKADNLKKPTGYTVDKNGNVKPKYN* |
| Ga0099846_10226665 | 3300007542 | Aqueous | MSCSGKSTKKGNYNKANNLRKPTGYTIDKNGNIKPLYK* |
| Ga0099846_10557932 | 3300007542 | Aqueous | MSCTGGTSTKKGGYNKKNNLKNPIGYTIDKKGNLKPIYK* |
| Ga0102817_10308792 | 3300007555 | Estuarine | MSCSGGKSTKKGSYNKANNLKQPTSYTIDKNGTVKPIYK* |
| Ga0102919_11894692 | 3300007597 | Estuarine | MSCSGGKSVKKGRYSKAQNLQKPIDYTIDKNGNVKPIYTKK* |
| Ga0102896_11669181 | 3300007618 | Estuarine | TKKGSYNKANNLKQPISYTIDSKGNVKPIYLLKTK* |
| Ga0105747_10508331 | 3300007974 | Estuary Water | MSCSGGKSVKKGRYSKSQNLQKPIDYTIDKNGNIKPIYTKK* |
| Ga0105748_101245691 | 3300007992 | Estuary Water | GGKSIKKGRYSKTDNLKKPTEYTVDKKGNVKPKYN* |
| Ga0114340_100260411 | 3300008107 | Freshwater, Plankton | MSCSGGTSTKKGRYNKANNLKQPTSYTIDKNGNVKPIYK* |
| Ga0114340_10441623 | 3300008107 | Freshwater, Plankton | MSCSGGTSTKKGYYNKTNNLKQPISYTIDKNGNVKPIYK* |
| Ga0114346_10354783 | 3300008113 | Freshwater, Plankton | MSCSGGTSTKKGRYNKANNLKQPVSYTIDKNGNVKPIYK* |
| Ga0114346_10739772 | 3300008113 | Freshwater, Plankton | MSCSGGKSTKKGRYNKANNLKKPTGYTVDKKGNIKPMYN* |
| Ga0114346_11669622 | 3300008113 | Freshwater, Plankton | MSCSGGKSTKKGRYNKVNNLKQPTSYTIDKNGNVKPIYK* |
| Ga0114354_10050904 | 3300008119 | Freshwater, Plankton | MSCSGGKSVKKGRYNKAQNLQKPIDYTIDKNGNVKPIYTKK* |
| Ga0114841_100269011 | 3300008259 | Freshwater, Plankton | MSCSGGKSVKKGRYSKAQNLQKPIDYTIDKNGNIKPIYTKK* |
| Ga0114363_100430515 | 3300008266 | Freshwater, Plankton | MSCSGGKSTKKGRYNKANNLKKPTGYTVDKKGNVKPMYN* |
| Ga0114363_102002610 | 3300008266 | Freshwater, Plankton | MSCSRGKSTKKGRYNKANNLKKPTGYTVDKNGNIKPTYN* |
| Ga0114363_11320952 | 3300008266 | Freshwater, Plankton | MSCSGGKSTKKGKYNKTNNLKNPIGYELDKNGNIKPIYLKK* |
| Ga0114364_100002763 | 3300008267 | Freshwater, Plankton | MSCSGGKSTKKGRYNKANNLKKPTGYTVDKKGNIKPTYN* |
| Ga0114364_10049862 | 3300008267 | Freshwater, Plankton | MSCSGGKSTKKGSYNKSNNLKQPVSYTIDKKGNVKPIYK* |
| Ga0114364_100518916 | 3300008267 | Freshwater, Plankton | MSCTGGKSVKKGKYSKTNNLQKPIDYTIDKNGNIKAIYPKTK* |
| Ga0114364_10075068 | 3300008267 | Freshwater, Plankton | MNCSGGKSTKKGRYNKADNLKKPTGYTVDKKGNVKPVYN* |
| Ga0114364_10152036 | 3300008267 | Freshwater, Plankton | MSCTGGSKTKKGRYNKANNLKQPTEYTVDSKGNVKPIYK* |
| Ga0114364_10175355 | 3300008267 | Freshwater, Plankton | MSCSGGKSVKKGRYNKAQNLQKPIDYTIDKNGNIKPIYTKK* |
| Ga0114364_10253565 | 3300008267 | Freshwater, Plankton | MSCSGGKSTKKGRYNKANNLKKPTGYTVDKKGNVKPTYN* |
| Ga0114364_10472093 | 3300008267 | Freshwater, Plankton | MSCSGGKSTKKGNYNKINNLKNPIGYEIDKKGNIKPIYLKK* |
| Ga0114364_10661402 | 3300008267 | Freshwater, Plankton | MSCSGGKSTAKGKYSKKDNLKKPTGYTVDKKGNIKPTYN* |
| Ga0114364_10688762 | 3300008267 | Freshwater, Plankton | MSCSGGKSVKKGSYNKANNLKQPISYTIDKNGNVKPIYK* |
| Ga0114364_10810192 | 3300008267 | Freshwater, Plankton | MSCSSGKSTKKGSYNKANNLKQPISYTIDKKGNVKPIYSLKTK* |
| Ga0114364_11271772 | 3300008267 | Freshwater, Plankton | MSCSGGKSVKKGSYNKTNNLKQPTSYTIDKNGNFKPIYK* |
| Ga0114364_11544052 | 3300008267 | Freshwater, Plankton | MSCSGGTSTKKGRYNKANNLKQPISYTIDKNGNVKPIYK* |
| Ga0114364_11548411 | 3300008267 | Freshwater, Plankton | LHSMSCSGGTSTKKGRYNKANNLKQPVSYTIDKNGNVKPIYK* |
| Ga0114364_11853592 | 3300008267 | Freshwater, Plankton | MSCSGGKLTKKGKYSKTNNLKKPTGYTVDKKGNVKPMYN* |
| Ga0114876_11458411 | 3300008448 | Freshwater Lake | MSCSGGKSVKKGRYNKAQKLQKPIDYTIDKNGNIKPIYTKK* |
| Ga0114880_10026254 | 3300008450 | Freshwater Lake | MSCSGGKSTKKGRYNKADNLKQPTGYTVDKKGNVKPIYK* |
| Ga0104242_10055534 | 3300008962 | Freshwater | MSCSGNKSTMRGSYNKATNLKKPTGYTIDKKGNIKPTYNENNKR* |
| Ga0102830_10044322 | 3300009059 | Estuarine | MSCSGGTSTKKGYYNKANNLKQPVSYTIDKNGNVKPIYK* |
| Ga0102830_10544162 | 3300009059 | Estuarine | MSCSGGKSVKKGNYNKANNLKQPTGYTVDKKGNVKPKYN* |
| Ga0105103_101662432 | 3300009085 | Freshwater Sediment | MSCSGGKSTKKGRYNKANNLKKPTGYTVDKNGNLKPTYN* |
| Ga0115551_14714282 | 3300009193 | Pelagic Marine | CSGGKSVKKGNYNKANNLKQPTGYTVDKKGNVKPKYN* |
| Ga0129333_102119751 | 3300010354 | Freshwater To Marine Saline Gradient | FVYLLKLKDMSCSGGKSTKKGRYNKADNLKKPTGYTVDKNGNVKPKYN* |
| Ga0153800_10377492 | 3300011995 | Freshwater | MSCSGGKSTKKGSYNKANNLKQPVSYTIDKNGNVKPIYK* |
| Ga0153805_10026101 | 3300012013 | Surface Ice | CSGGKSTKKGSYNKANNLKQPVSYTIDKNGNVKPIYK* |
| Ga0153805_10071292 | 3300012013 | Surface Ice | MSCTGGKSTKKGRYNKANNLKQPTEYIVDKKGNIKPKYN* |
| Ga0153805_10563513 | 3300012013 | Surface Ice | MSCSGGKSTKKGSYNKANNLKQPISYTIDKKGNVKPIYSLKTK* |
| Ga0157137_10004312 | 3300012286 | Freshwater | MSCSGGKSTKKGRYNKANNLKQPVSYTIDSKGNVKPKYN* |
| Ga0157137_1053152 | 3300012286 | Freshwater | MSCSGGKSTAKGKYSKKDNLKKPTGYTVDKKGNVKPTYN* |
| Ga0157203_10181902 | 3300012663 | Freshwater | MSYSGGKSTAKGRYNKANNLKQPISYTIDSKGNVKPIYSTNKK* |
| Ga0157210_100000178 | 3300012665 | Freshwater | MSCSGGKSTAKGRYNKANNLKQPISYTIDSKGNVKPIYSTNKK* |
| Ga0157208_1000098415 | 3300012667 | Freshwater | MSCSGGKSTKKGRYNKANNLKQPLSYTIDSKGNVKPKYN* |
| Ga0157208_100429091 | 3300012667 | Freshwater | MSCSGGKSVKKGRYSKAQNLQKPIDYTIDKNGNIKPI |
| Ga0138283_11144063 | 3300012774 | Freshwater Lake | GKSTKKGSYNKANNLKQPISYTIDKKGNIKPIYTLKTK* |
| Ga0164293_105201942 | 3300013004 | Freshwater | MSCSGSKSTMKGSYNKANNLRQPISYTIDSKGNIKPIYATTKTK* |
| Ga0164292_104868122 | 3300013005 | Freshwater | MSCSGGKSVKKGRYNKANNLKQPISYTIDKKGNVKPIYSLKIK* |
| (restricted) Ga0172367_100266532 | 3300013126 | Freshwater | MSCTGGSKTKKGRYNKANNLKQPTGYTVDSKGNVKPIYK* |
| (restricted) Ga0172365_102489932 | 3300013127 | Sediment | MSCSGGKGVKKGKYNKTKKLQKTIDYTIDKNGNVKAVYSKTK* |
| (restricted) Ga0172364_101368402 | 3300013129 | Sediment | MSCSGGKGVKKGKYNKTNNLQKPIDYTIDKNGNVKAVYSKTK* |
| Ga0170791_111581832 | 3300013295 | Freshwater | MSCSGGKSTMKGSYNKATNLKSPTGYTIDKKGNIKPTYNENNKK* |
| Ga0170791_111633691 | 3300013295 | Freshwater | GKSTKKGSYNKANNLKQPISYTIDKKGNVKPIYTLKTK* |
| Ga0177922_101203511 | 3300013372 | Freshwater | MSCSGGKSTKKGNYSKADNLKKPTEYTVDKKGNVKPKYK* |
| Ga0177922_1039256914 | 3300013372 | Freshwater | MGCGSGSSTRKGKYNKENNLKQPTSYTIDKNGNVKAIYSKN* |
| Ga0177922_110115262 | 3300013372 | Freshwater | VMSCSGGKSTKKGSYNTSNNLKQAVAYTIDKKGNVKPICK* |
| Ga0177922_110623251 | 3300013372 | Freshwater | MSCSGGKSTKKGSYNKANNLKQPIGYTIDSKGNIKPIYDKK* |
| Ga0177922_112541971 | 3300013372 | Freshwater | MSCSGGKSVKKGRYSKTQNLQKPIDYTIDKNGNIKPIYTKK* |
| (restricted) Ga0172376_102173103 | 3300014720 | Freshwater | MSCSGGTSTKKGYYNKTNNLKQPVSYTIDKNGNVKP |
| Ga0181363_10126244 | 3300017707 | Freshwater Lake | MSCSGGKSVKKGGYNKANNLKQPISYTIDKNGNVKPIYK |
| Ga0181350_10145056 | 3300017716 | Freshwater Lake | MSCSGGKSTKKGRYSKTDNLKKPTGYTVDKKGNVKPKYK |
| Ga0181347_10024564 | 3300017722 | Freshwater Lake | MSCSGRKSTMKGSYNKATNLKKPTTYIIDKKGNIKPLYNENNKK |
| Ga0181347_10066504 | 3300017722 | Freshwater Lake | MSCSGGKSTKKGNYNKINNLKNPIGYEIDKKGNIKPIYLKK |
| Ga0181347_11934851 | 3300017722 | Freshwater Lake | MSCSGGKSTKKGNYSKTDNLKKPTEYTVDKKGNVKPKYK |
| Ga0181344_10543943 | 3300017754 | Freshwater Lake | MSCSGGKSTKKGGYNKADNLKKPTGYTVDKKGNVKPKYK |
| Ga0181356_10495252 | 3300017761 | Freshwater Lake | MSCSGGKSVKKGKYSKTNNLKKPTGYTVDKKGNVKPMYN |
| Ga0181356_10771252 | 3300017761 | Freshwater Lake | MSCSGSKSTSKGSYNKATNLKKPTNYIIDKKGNIKPLYNENNKK |
| Ga0181356_10931851 | 3300017761 | Freshwater Lake | NMSCSGGKSTKKGNYNKANNLKNPIGYEIDKKGNIKPIYLKK |
| Ga0181343_101265812 | 3300017766 | Freshwater Lake | MSCSGGTSTKKGRYNKANNLKQPISYTIDKNGNVKPIYK |
| Ga0181343_10321373 | 3300017766 | Freshwater Lake | MSCSGAKSVKKGGYNKSNNLKQPTSYTIDKNGNVKPIYK |
| Ga0181358_10092719 | 3300017774 | Freshwater Lake | MSCSSGKSTKKGRYNKANNFKQPISYTIDSKGNVKPIYSLKTK |
| Ga0181358_11372252 | 3300017774 | Freshwater Lake | MSCSGGKSTKKGNCNKINNLKNPIGYEIDKKGNIKPIYLKK |
| Ga0181357_11050762 | 3300017777 | Freshwater Lake | MSCSGGKSTMRGSYNKATNLKKPTGYTIDKKGNIKPTYNENNKR |
| Ga0181357_11095143 | 3300017777 | Freshwater Lake | QIKKGKNMSCSGGKSTKKGNYSKADNLKKPTEYTVDKKGNVKPKYK |
| Ga0181349_10125558 | 3300017778 | Freshwater Lake | MSCSSGKSTKKGRYNKANNFKQPISYTIDSKGNVKLIYSLKTK |
| Ga0181349_11174805 | 3300017778 | Freshwater Lake | YTMSCSSGKSTKKGGYNKKENLMVPIGYTIDKKGALKPIYQKTS |
| Ga0181346_11395252 | 3300017780 | Freshwater Lake | MSYSGGKSTMRGSYNKATNLKKPTGYTIDKKGNIKPTYNENNKR |
| Ga0181346_13220681 | 3300017780 | Freshwater Lake | KVMSCSGGKSTKKGSYNKANNLKQPISYTIDKKGNVKPIYSLKTK |
| Ga0181355_10326832 | 3300017785 | Freshwater Lake | MSCSGSKSTMKGSYSKANNLKQPISYTTDSKGNVKPIYSTTKTK |
| Ga0181361_1186401 | 3300019783 | Freshwater Lake | MSCSGGKSTKKGGYNKADNLKKPTGYTVDKKGNVKPKYN |
| Ga0181359_10366074 | 3300019784 | Freshwater Lake | MSCSGGKSTKKGSYNKANNLKQPVSYTIDKNGNVKPIYK |
| Ga0181359_10473082 | 3300019784 | Freshwater Lake | MSCSGGKSTKKGRYSKTDNLKKPTEYTVDKKGNVKPKYK |
| Ga0181359_10534382 | 3300019784 | Freshwater Lake | MSCSGRKSTMKGSYNKATNLKKPTNYIIDKKGNIKPLYNENNKK |
| Ga0181359_10613101 | 3300019784 | Freshwater Lake | MSCSGSKSTMKGSYNKANNLKQPISYTIDSKGNVKSIYSTTKIK |
| Ga0181359_10996901 | 3300019784 | Freshwater Lake | MSCSGSKSTMKGSYSKANNLKQPISYTIDSKGNVKPIYSTTKTK |
| Ga0181359_11051062 | 3300019784 | Freshwater Lake | MSCSGGKSTKKGRYNKADNLKKPTGYTVDKKGNVKPKYN |
| Ga0181359_11234222 | 3300019784 | Freshwater Lake | MSCSGGKSTKKGSYNKANNLKQPISYTIDKKGNVKPIYSLKTK |
| Ga0181359_12298981 | 3300019784 | Freshwater Lake | ENKIMSCTGGKSTKKGRYNKANNLKQPTEYTVDKKGNVKPIYK |
| Ga0181359_12365042 | 3300019784 | Freshwater Lake | MSCSSGKSTKKGGYNKKENLMVPIGYTIDKKGALKPIYQKTS |
| Ga0181359_12461682 | 3300019784 | Freshwater Lake | MSCSGGKSTAKGKYSKKDNLKKPTGYTVDKKGNIKPTYN |
| Ga0207193_1000070209 | 3300020048 | Freshwater Lake Sediment | MSCSGGKSVKKGRYNKAQNLQKPIDYTIDKNGNVKPIYTKK |
| Ga0207193_100060167 | 3300020048 | Freshwater Lake Sediment | MGCSGGSSTKKGGYNKVNNLKNPIDYTVDKKGNIKPIYKK |
| Ga0207193_16220802 | 3300020048 | Freshwater Lake Sediment | MSCSGGKSTKKGNYNKKINLKNPTGYKMGKNGELIPIYXXXXXXX |
| Ga0211732_15039142 | 3300020141 | Freshwater | MSCTGGKSTKKGRYNKANNLKQPTGYTVDKKGNVKPIY |
| Ga0211736_106586921 | 3300020151 | Freshwater | KRKTMSCSGGKSTKKGRYSKADNLKKPTGYTVDKKGNVKPKYN |
| Ga0211726_101554551 | 3300020161 | Freshwater | MSCSGGKSTKKGRYSKADNLKKPTGYTVDKKGNVKPKYN |
| Ga0211726_103391442 | 3300020161 | Freshwater | MSCTGGSKTKKGRYNKANNLKQPTEYTVDSKGNVKPKYN |
| Ga0211729_100203152 | 3300020172 | Freshwater | MSCSGGKSVKKGRYSKAQNLQKPIDYTIDKNGNVKPIYTKK |
| Ga0211729_103977192 | 3300020172 | Freshwater | MSCSGGKSVKKGRYNKAQNLQKPIDYTIDKNGNIKPIYTKK |
| Ga0211729_109697872 | 3300020172 | Freshwater | MSCSSGKSVKSGKYNKRENLMKPTGYTIDKKGNVK |
| Ga0194115_100472344 | 3300020183 | Freshwater Lake | MSCSGGKSVKKGNYNKANNLKQPTGYTVDKKGNVKPKYN |
| Ga0194115_100659062 | 3300020183 | Freshwater Lake | MSCSGGKSTKKGRYNKANNLKKPTGYTVDKKGNVKPTYN |
| Ga0194118_103979042 | 3300020190 | Freshwater Lake | MSCSGGKLTKKGRYNKADNLKKPTGYTVDKNGNVKPKYN |
| Ga0211731_109686222 | 3300020205 | Freshwater | MSCTGGKSTKKGRYNKANNLKQPTGYTVDSKGNIKPTYK |
| Ga0194130_100882875 | 3300021376 | Freshwater Lake | MSCSGGKLTKKGRYNKANNLKKPTGYTVDKKGNVKPTYN |
| Ga0222714_101171472 | 3300021961 | Estuarine Water | MSCSGGKSVKKGGYNKANNLKQPVSYTIDKNGNVKPIYK |
| Ga0222713_101052102 | 3300021962 | Estuarine Water | MSCSGGTSTKKGYYNKANNLKQPVSYTIDKNGNVKPIYK |
| Ga0222713_105216521 | 3300021962 | Estuarine Water | CSGGGKSVKKGRYNKANNLKQPVSYTVDKNGNVKPIYK |
| Ga0222712_104336652 | 3300021963 | Estuarine Water | MSCSGGKSVKKGNYNKKDNLKKPTGYTVDKKGNVKPTYN |
| Ga0212031_10129833 | 3300022176 | Aqueous | MSCSGGKSTKKGKYSKKNNLKKPTGYTVDKKGNVKPIYN |
| Ga0181353_10009232 | 3300022179 | Freshwater Lake | MSCSGGKSTKKGRYNKANNLKKPTGYTVDKKGNIKPTYN |
| Ga0181354_11003392 | 3300022190 | Freshwater Lake | MSCSGGKSTKKGGYNKADNLKKPIGYTVDKKGNVKPKYN |
| Ga0181351_100013119 | 3300022407 | Freshwater Lake | MSCSGGKSTMKGSYNKATNLKSPTSYTIDKKGNIKPIYNENNKK |
| Ga0181351_10132572 | 3300022407 | Freshwater Lake | MSCSSGKSTKKGRYNKANNFKQPISYTIDSKGNVKPIYSSKTK |
| Ga0181351_10306215 | 3300022407 | Freshwater Lake | MSCSGGKSTKKGDYNKADNLKKPTGYTVDKKGNVKPKYN |
| Ga0181351_10452384 | 3300022407 | Freshwater Lake | MSCSGGKSTKKGSYNKSNNLKQPVSYTIDKKGNVKPIYK |
| Ga0181351_10561432 | 3300022407 | Freshwater Lake | MGCSSSKLTKKGYYNKANNLKVPTSYVIDKKGNVKAVYSIQPKNKTI |
| Ga0181351_10574934 | 3300022407 | Freshwater Lake | MSCSGGKSTKKGNYNKANNLKNPIGYEIDKKGNIKPIYLKK |
| Ga0181351_10918322 | 3300022407 | Freshwater Lake | MSCSGGKSTKKGNYSKADNLKKPTGYTVDKKGNVKPKYK |
| Ga0181351_12109803 | 3300022407 | Freshwater Lake | MSCSGGKSTKKGNYNKINNLKNSIGYEIDKKGNIKPIYLKK |
| Ga0222647_100003032 | 3300022827 | Saline Water | MGNCSGGNSGKTLKGSYNKKQNLQKPTGYIVDKKGNVKPTYSKN |
| Ga0222711_100003211 | 3300022837 | Saline Water | MGNCSGGSSGKTLKGSYNKKQNLQKPTGYIVDKKGNVKPTYSKN |
| Ga0214923_104855992 | 3300023179 | Freshwater | MSCSGGKSVKKGRYNKANNLKQPISYTIDKNGNVKPIYK |
| Ga0214919_1000048911 | 3300023184 | Freshwater | MSCTGGSKTKKGRYNKANNLKQPIEYTVDKNGHVKPVYSK |
| Ga0214919_103860293 | 3300023184 | Freshwater | MGCGSGSSTRKGKYNKENNLKQPTSYTIDKNGNVK |
| Ga0222708_10315732 | 3300023242 | Saline Water | MGNCSNNSSPNTLKGKWNKKQNLRNPTSYVVDKKGNVKPIYTQL |
| Ga0209414_10022069 | 3300023301 | Hypersaline | MGNCSGGSSSGTLRGKFNKKQNLQKPKGYIVDKKGNVKPIYI |
| Ga0247724_10245492 | 3300024239 | Deep Subsurface Sediment | MSCSGGKSTKKGNYNKANNLKKPTGYTVDKKGNIKPIYK |
| Ga0244777_103469402 | 3300024343 | Estuarine | KSTKKGSYNKANNLKQPISYTIDSKGNVKPIYLLKTK |
| Ga0244775_100004708 | 3300024346 | Estuarine | MSCSGGKSTKKGSYNKANNLKQPTSYTIDKNGNVKPIYK |
| Ga0244775_106051852 | 3300024346 | Estuarine | MSCSGSKSTMKGSYNKANNLKQPISYTIDSKGNVKPIYSTAKIK |
| Ga0244776_100141012 | 3300024348 | Estuarine | MSCSSGKSTKKGSYNKANNLKQPISYTIDSKGNVKPIYLLKTK |
| Ga0208161_10125996 | 3300025646 | Aqueous | MSCSGSKSTMKGSYNKANNLKQPISYTIDSKGNVKPIYATTKTK |
| Ga0208161_11333042 | 3300025646 | Aqueous | MSCSKGKSTKKGSYNKSNNLKQPVSYTIDKNGNIKSI |
| Ga0208161_11443022 | 3300025646 | Aqueous | MGCSGSKSTLRGSYNKANNLKNPISYTIDKKGNVKPIYSKNK |
| Ga0208160_10683482 | 3300025647 | Aqueous | MSCSGGKSTKKGRYNKADNLKKPTGYTVDKNGNVKPKYN |
| Ga0208898_10237773 | 3300025671 | Aqueous | MSCSGGKSTKRGRYNKANNLKKPTGYTVDKNGNVKPIYK |
| Ga0208898_10395755 | 3300025671 | Aqueous | MSCSKGKSTKKGSYNKANNLKQPVSYTIDKNGNVKNKEFEYAYA |
| Ga0209768_102970382 | 3300027772 | Freshwater Lake | SCSGGKSTKKGGYNKADNLKKPTGYTVDKKGNVKPKYN |
| Ga0209354_101691351 | 3300027808 | Freshwater Lake | MSCSGGKSTKKGGYNKADNLKKPTGYTVDKKGNVK |
| Ga0209668_102171772 | 3300027899 | Freshwater Lake Sediment | MSCSGGKSTKKGNYSKTDNLKKPTGYTVDKKGNVKPKYK |
| Ga0247723_100045728 | 3300028025 | Deep Subsurface Sediment | MSCSGGKSVKKGRYSKSQNLQKPIDYTIDKNGNIKPIYTKK |
| Ga0247723_10143208 | 3300028025 | Deep Subsurface Sediment | MSCTGGKSVKKGRYNKTNNLKKPTGYTVDKNGNVKPTYK |
| Ga0255260_10028574 | 3300028081 | Freshwater | MSCSGGTSTKKGYYNKTNNLKQPISYTIDKNGNVKPIYK |
| Ga0307376_100905853 | 3300031578 | Soil | MSCSGSKSTMKGSYSKANNLKQPISYTVDSKGNIKPIYVTTKTK |
| Ga0307376_100908955 | 3300031578 | Soil | MSCSSGKSTKKGSYNKANNLKQPISYTIDKKGNVKPIYTLKTK |
| Ga0307376_103913212 | 3300031578 | Soil | MGRCSGGSCTKSGNYNKKNNLRKPISYTVDKNGNVKPIYKKLXDLEIVIFR |
| Ga0307375_101163353 | 3300031669 | Soil | MGRCSGGSCTKSGNYNKKNNLRKPISYTVDKNGNVKPIYKKL |
| Ga0307377_101271882 | 3300031673 | Soil | MSCSSGKSTKKGSYNKANNLKQPISYTIDKKGNVKPIYSLKIK |
| Ga0307377_105660892 | 3300031673 | Soil | MGGCSRGCGTKSGNYNKKQNLMNPVSYTVDKNGNVKPIYKKD |
| Ga0315907_1003284811 | 3300031758 | Freshwater | MSCSRGKSTKKGRYNKANNLKKPTGYTVDKNGNIKPTYN |
| Ga0315900_100218356 | 3300031787 | Freshwater | MSCSGGKSTKKGRYNKANNLKKPTGYTVDKKGNIKPMYN |
| Ga0315900_100624673 | 3300031787 | Freshwater | MSCTGGSKTKKGRYNKANNLKQPTGYTVDSKGNVKPIYK |
| Ga0315900_110817432 | 3300031787 | Freshwater | IIKKENMSCSGGKSTKKGRYNKANNLKKPTGYTVDKKGNVKPTYN |
| Ga0315901_100708576 | 3300031963 | Freshwater | MNCSGGKSTKKGRYNKADNLKKPTGYTVDKKGNVKPVYN |
| Ga0315901_101280111 | 3300031963 | Freshwater | MSCTGGKSVKKGKYSKTNNLQKPIDYTIDKNGNIKAIYPKTK |
| Ga0315901_101479583 | 3300031963 | Freshwater | MSCSGGTSTKKGRYNKANNLKQPTSYTIDKNGNVKPIYK |
| Ga0315901_108722912 | 3300031963 | Freshwater | MSCSGGKSTKKGRYNKANNLKQPTGYTVDKKGNVKPKYN |
| Ga0315274_118639861 | 3300031999 | Sediment | MSCSSGKSTKKGSYNKANNLKQPTSYTIDKKGNVKPIYSLKTK |
| Ga0315902_105583661 | 3300032093 | Freshwater | MSCSGGKSTKKGRYNKANNLKQPTGYTVDKKGNVKPKY |
| Ga0315903_102668191 | 3300032116 | Freshwater | MSCSGGKSTKKGRYNKANNLKKPTGYTVDKKGNIK |
| Ga0315903_105840222 | 3300032116 | Freshwater | MSCSGGKSTKKGRYNKANNLKKPTGYTVDKKGNVKPMYN |
| Ga0316612_100032115 | 3300033494 | Microbial Mat | MSCSGGKSTKKGRYNKANNLKPPVSYTIDSKGNVKPKYN |
| Ga0334998_0024200_2658_2777 | 3300034019 | Freshwater | MSCSGGKSTKKGSYNKANNLKKPTGYTVDSKGNIKPLYK |
| Ga0334987_0028580_4209_4328 | 3300034061 | Freshwater | MSCSGGKSTKKGRYNKANNLKKPTGYTVDKNGNLKPTYN |
| Ga0334990_0365738_516_638 | 3300034068 | Freshwater | MSCTGGKSTSKGRYNKTNNLKQPTGYTVDNKGNVKPIYSK |
| Ga0335031_0026031_1622_1753 | 3300034104 | Freshwater | MSCSSGKSTKKGSYNKANNLKQPISYTIDKKGNVKPIYSLKTK |
| Ga0335031_0081866_1667_1798 | 3300034104 | Freshwater | MSCSGGKSTKKGRYNKANNFKQPISYTIDSKGNVKPIYSPKTK |
| Ga0335031_0235228_1087_1206 | 3300034104 | Freshwater | MSCSGGKSTKKGKYSKTNNLKKPTGYIVDKNGNLKPTYN |
| Ga0335068_0057027_3_161 | 3300034116 | Freshwater | SHYKIKIKVMSCSSGKSTKKGSYNKANNLKQPISYTIDSKGNIKPIYTLKTK |
| Ga0335007_0242799_133_264 | 3300034283 | Freshwater | MSCSSGKSTKKGSYNKVNNLKQPISYTIDKKGNVKPIYSLKTK |
| Ga0348337_003077_8614_8733 | 3300034418 | Aqueous | MSCSKGKSTKKGSYNKANNLKQPVSYTIDKNGNVKPIYK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |