| Basic Information | |
|---|---|
| Family ID | F023491 |
| Family Type | Metagenome |
| Number of Sequences | 210 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDAEETDKQNKIRELQAVVAKGLKGINECRYAADCEFARACPGTC |
| Number of Associated Samples | 156 |
| Number of Associated Scaffolds | 210 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 38.57 % |
| % of genes near scaffold ends (potentially truncated) | 23.81 % |
| % of genes from short scaffolds (< 2000 bps) | 64.76 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (24.762 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.286 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 43.84% β-sheet: 0.00% Coil/Unstructured: 56.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 210 Family Scaffolds |
|---|---|---|
| PF12840 | HTH_20 | 33.33 |
| PF13177 | DNA_pol3_delta2 | 28.10 |
| PF02826 | 2-Hacid_dh_C | 4.29 |
| PF08282 | Hydrolase_3 | 4.29 |
| PF07994 | NAD_binding_5 | 4.29 |
| PF01658 | Inos-1-P_synth | 3.81 |
| PF01022 | HTH_5 | 3.33 |
| PF00389 | 2-Hacid_dh | 2.38 |
| PF03279 | Lip_A_acyltrans | 1.43 |
| PF13439 | Glyco_transf_4 | 0.95 |
| PF07726 | AAA_3 | 0.48 |
| PF00004 | AAA | 0.48 |
| PF07690 | MFS_1 | 0.48 |
| PF02811 | PHP | 0.48 |
| PF00724 | Oxidored_FMN | 0.48 |
| PF08281 | Sigma70_r4_2 | 0.48 |
| PF00265 | TK | 0.48 |
| PF01174 | SNO | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 210 Family Scaffolds |
|---|---|---|---|
| COG1260 | Myo-inositol-1-phosphate synthase | Lipid transport and metabolism [I] | 8.10 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 4.29 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 4.29 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 4.29 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 4.29 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 4.29 |
| COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 1.43 |
| COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 1.43 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG0118 | Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH | Amino acid transport and metabolism [E] | 0.48 |
| COG0311 | Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase) | Coenzyme transport and metabolism [H] | 0.48 |
| COG1435 | Thymidine kinase | Nucleotide transport and metabolism [F] | 0.48 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001089|JGI12683J13190_1002287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2611 | Open in IMG/M |
| 3300001154|JGI12636J13339_1033287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 674 | Open in IMG/M |
| 3300001181|JGI12663J13571_100851 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300001333|A21PFW6_1287141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 834 | Open in IMG/M |
| 3300001359|A3035W6_1102485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 746 | Open in IMG/M |
| 3300001536|A1565W1_10402351 | All Organisms → cellular organisms → Bacteria | 5272 | Open in IMG/M |
| 3300001536|A1565W1_10441352 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300001545|JGI12630J15595_10019182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1451 | Open in IMG/M |
| 3300001545|JGI12630J15595_10082145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 633 | Open in IMG/M |
| 3300001661|JGI12053J15887_10013994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4435 | Open in IMG/M |
| 3300001661|JGI12053J15887_10014954 | All Organisms → cellular organisms → Bacteria | 4303 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100174692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2032 | Open in IMG/M |
| 3300002557|JGI25381J37097_1065130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 586 | Open in IMG/M |
| 3300002558|JGI25385J37094_10070598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1115 | Open in IMG/M |
| 3300002560|JGI25383J37093_10097328 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300002853|draft_1012372 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300002908|JGI25382J43887_10008421 | All Organisms → cellular organisms → Bacteria | 5126 | Open in IMG/M |
| 3300002914|JGI25617J43924_10123490 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300002915|JGI25387J43893_1069718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 521 | Open in IMG/M |
| 3300002916|JGI25389J43894_1099391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
| 3300005166|Ga0066674_10034085 | All Organisms → cellular organisms → Bacteria | 2262 | Open in IMG/M |
| 3300005167|Ga0066672_10031954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2886 | Open in IMG/M |
| 3300005167|Ga0066672_10061907 | All Organisms → cellular organisms → Bacteria | 2186 | Open in IMG/M |
| 3300005171|Ga0066677_10014700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3487 | Open in IMG/M |
| 3300005174|Ga0066680_10074728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2035 | Open in IMG/M |
| 3300005176|Ga0066679_10429883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 865 | Open in IMG/M |
| 3300005176|Ga0066679_10608280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 713 | Open in IMG/M |
| 3300005177|Ga0066690_10064035 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
| 3300005177|Ga0066690_10962420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
| 3300005178|Ga0066688_10081822 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
| 3300005180|Ga0066685_10006736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus | 6100 | Open in IMG/M |
| 3300005180|Ga0066685_10084143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2104 | Open in IMG/M |
| 3300005181|Ga0066678_10865062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 593 | Open in IMG/M |
| 3300005184|Ga0066671_10000057 | All Organisms → cellular organisms → Bacteria | 27910 | Open in IMG/M |
| 3300005434|Ga0070709_11526971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
| 3300005435|Ga0070714_100006521 | All Organisms → cellular organisms → Bacteria | 9022 | Open in IMG/M |
| 3300005445|Ga0070708_100027921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4849 | Open in IMG/M |
| 3300005445|Ga0070708_100030932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4630 | Open in IMG/M |
| 3300005445|Ga0070708_100405757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1285 | Open in IMG/M |
| 3300005446|Ga0066686_10054639 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
| 3300005451|Ga0066681_10297689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 986 | Open in IMG/M |
| 3300005454|Ga0066687_10036198 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
| 3300005468|Ga0070707_100000187 | All Organisms → cellular organisms → Bacteria | 61460 | Open in IMG/M |
| 3300005468|Ga0070707_100674340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 996 | Open in IMG/M |
| 3300005471|Ga0070698_100000778 | All Organisms → cellular organisms → Bacteria | 34585 | Open in IMG/M |
| 3300005518|Ga0070699_100056705 | All Organisms → cellular organisms → Bacteria | 3392 | Open in IMG/M |
| 3300005518|Ga0070699_100578824 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300005536|Ga0070697_100000036 | All Organisms → cellular organisms → Bacteria | 97783 | Open in IMG/M |
| 3300005536|Ga0070697_100061019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3074 | Open in IMG/M |
| 3300005540|Ga0066697_10077780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1912 | Open in IMG/M |
| 3300005540|Ga0066697_10204893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1172 | Open in IMG/M |
| 3300005540|Ga0066697_10536180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 658 | Open in IMG/M |
| 3300005542|Ga0070732_10011034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4969 | Open in IMG/M |
| 3300005552|Ga0066701_10030738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2789 | Open in IMG/M |
| 3300005554|Ga0066661_10313570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 965 | Open in IMG/M |
| 3300005555|Ga0066692_10930917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
| 3300005557|Ga0066704_10468712 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005560|Ga0066670_10608369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 665 | Open in IMG/M |
| 3300005561|Ga0066699_11059040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 560 | Open in IMG/M |
| 3300005561|Ga0066699_11099289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 548 | Open in IMG/M |
| 3300005566|Ga0066693_10065766 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300005575|Ga0066702_10093963 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300005576|Ga0066708_10099747 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300006028|Ga0070717_10063489 | All Organisms → cellular organisms → Bacteria | 3066 | Open in IMG/M |
| 3300006032|Ga0066696_10596865 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300006034|Ga0066656_10376545 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300006791|Ga0066653_10284452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 837 | Open in IMG/M |
| 3300006796|Ga0066665_10463706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1043 | Open in IMG/M |
| 3300006796|Ga0066665_10699342 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300007255|Ga0099791_10217232 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300007258|Ga0099793_10111429 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300007265|Ga0099794_10170876 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300007740|Ga0104326_132330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3505 | Open in IMG/M |
| 3300007822|Ga0104325_109114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1166 | Open in IMG/M |
| 3300007982|Ga0102924_1006403 | All Organisms → cellular organisms → Bacteria | 11060 | Open in IMG/M |
| 3300007982|Ga0102924_1018047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5311 | Open in IMG/M |
| 3300007982|Ga0102924_1052847 | All Organisms → cellular organisms → Bacteria | 2362 | Open in IMG/M |
| 3300009012|Ga0066710_104506109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 521 | Open in IMG/M |
| 3300009038|Ga0099829_10016220 | All Organisms → cellular organisms → Bacteria | 4992 | Open in IMG/M |
| 3300009038|Ga0099829_10719525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 829 | Open in IMG/M |
| 3300009088|Ga0099830_10192681 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300009089|Ga0099828_10055129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3314 | Open in IMG/M |
| 3300009089|Ga0099828_10567877 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300009090|Ga0099827_10000681 | All Organisms → cellular organisms → Bacteria | 16096 | Open in IMG/M |
| 3300009090|Ga0099827_11224209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 653 | Open in IMG/M |
| 3300009137|Ga0066709_100382521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1946 | Open in IMG/M |
| 3300009137|Ga0066709_100923666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1273 | Open in IMG/M |
| 3300009137|Ga0066709_102212839 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300009137|Ga0066709_104011908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 535 | Open in IMG/M |
| 3300009143|Ga0099792_10147281 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300009143|Ga0099792_10531533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 740 | Open in IMG/M |
| 3300010326|Ga0134065_10273269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 638 | Open in IMG/M |
| 3300010335|Ga0134063_10034139 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
| 3300010337|Ga0134062_10194958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 920 | Open in IMG/M |
| 3300011269|Ga0137392_10636943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 884 | Open in IMG/M |
| 3300011998|Ga0120114_1063821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 715 | Open in IMG/M |
| 3300011998|Ga0120114_1102298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 551 | Open in IMG/M |
| 3300012014|Ga0120159_1188734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 554 | Open in IMG/M |
| 3300012019|Ga0120139_1105931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 709 | Open in IMG/M |
| 3300012019|Ga0120139_1110648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 696 | Open in IMG/M |
| 3300012198|Ga0137364_10150473 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
| 3300012198|Ga0137364_10967143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 644 | Open in IMG/M |
| 3300012200|Ga0137382_10409276 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300012201|Ga0137365_10012597 | All Organisms → cellular organisms → Bacteria | 6665 | Open in IMG/M |
| 3300012203|Ga0137399_10490781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1030 | Open in IMG/M |
| 3300012205|Ga0137362_10310264 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300012206|Ga0137380_10101549 | All Organisms → cellular organisms → Bacteria | 2629 | Open in IMG/M |
| 3300012206|Ga0137380_10759237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 839 | Open in IMG/M |
| 3300012208|Ga0137376_10635927 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300012349|Ga0137387_10378550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1026 | Open in IMG/M |
| 3300012356|Ga0137371_10959553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 649 | Open in IMG/M |
| 3300012359|Ga0137385_10577523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 946 | Open in IMG/M |
| 3300012363|Ga0137390_10619138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1049 | Open in IMG/M |
| 3300012363|Ga0137390_12022171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
| 3300012918|Ga0137396_10313669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1160 | Open in IMG/M |
| 3300012922|Ga0137394_11573412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 515 | Open in IMG/M |
| 3300012927|Ga0137416_11344911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 646 | Open in IMG/M |
| 3300012944|Ga0137410_11463958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 595 | Open in IMG/M |
| 3300012975|Ga0134110_10254039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 749 | Open in IMG/M |
| 3300014150|Ga0134081_10105971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 889 | Open in IMG/M |
| 3300015193|Ga0167668_1005278 | All Organisms → cellular organisms → Bacteria | 2881 | Open in IMG/M |
| 3300015357|Ga0134072_10024008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1544 | Open in IMG/M |
| 3300017659|Ga0134083_10335429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 648 | Open in IMG/M |
| 3300018431|Ga0066655_10087298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1715 | Open in IMG/M |
| 3300018433|Ga0066667_10033513 | All Organisms → cellular organisms → Bacteria | 2920 | Open in IMG/M |
| 3300018433|Ga0066667_10369881 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300018433|Ga0066667_10524143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Thermosporotrichaceae → Thermosporothrix → Thermosporothrix hazakensis | 980 | Open in IMG/M |
| 3300018468|Ga0066662_10122660 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
| 3300018468|Ga0066662_10233713 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300018468|Ga0066662_11605457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 679 | Open in IMG/M |
| 3300018482|Ga0066669_10000991 | All Organisms → cellular organisms → Bacteria | 10313 | Open in IMG/M |
| 3300018482|Ga0066669_10072480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2282 | Open in IMG/M |
| 3300018482|Ga0066669_11341811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 648 | Open in IMG/M |
| 3300019888|Ga0193751_1019010 | All Organisms → cellular organisms → Bacteria | 3425 | Open in IMG/M |
| 3300019888|Ga0193751_1035279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2294 | Open in IMG/M |
| 3300020022|Ga0193733_1067388 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300020581|Ga0210399_11315218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 569 | Open in IMG/M |
| 3300021046|Ga0215015_10887893 | All Organisms → cellular organisms → Bacteria | 2936 | Open in IMG/M |
| 3300021559|Ga0210409_10674825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 904 | Open in IMG/M |
| 3300022557|Ga0212123_10014309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 10118 | Open in IMG/M |
| 3300022557|Ga0212123_10034601 | All Organisms → cellular organisms → Bacteria | 5059 | Open in IMG/M |
| 3300022557|Ga0212123_10158853 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300022557|Ga0212123_10254104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1259 | Open in IMG/M |
| 3300022691|Ga0248483_116327 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
| 3300025910|Ga0207684_10001384 | All Organisms → cellular organisms → Bacteria | 26395 | Open in IMG/M |
| 3300025922|Ga0207646_10000124 | All Organisms → cellular organisms → Bacteria | 104800 | Open in IMG/M |
| 3300025929|Ga0207664_10604307 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300025939|Ga0207665_10020373 | All Organisms → cellular organisms → Bacteria | 4358 | Open in IMG/M |
| 3300026295|Ga0209234_1009155 | All Organisms → cellular organisms → Bacteria | 3760 | Open in IMG/M |
| 3300026296|Ga0209235_1055107 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300026298|Ga0209236_1122036 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300026300|Ga0209027_1214926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 618 | Open in IMG/M |
| 3300026300|Ga0209027_1269588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 547 | Open in IMG/M |
| 3300026300|Ga0209027_1290619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
| 3300026301|Ga0209238_1126468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 832 | Open in IMG/M |
| 3300026310|Ga0209239_1084733 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300026315|Ga0209686_1001698 | All Organisms → cellular organisms → Bacteria | 10695 | Open in IMG/M |
| 3300026317|Ga0209154_1059887 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300026317|Ga0209154_1121757 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300026318|Ga0209471_1002397 | All Organisms → cellular organisms → Bacteria | 10785 | Open in IMG/M |
| 3300026324|Ga0209470_1268121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 670 | Open in IMG/M |
| 3300026328|Ga0209802_1101689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1292 | Open in IMG/M |
| 3300026330|Ga0209473_1216129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 710 | Open in IMG/M |
| 3300026330|Ga0209473_1226711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 675 | Open in IMG/M |
| 3300026331|Ga0209267_1021260 | All Organisms → cellular organisms → Bacteria | 3252 | Open in IMG/M |
| 3300026335|Ga0209804_1251891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 657 | Open in IMG/M |
| 3300026342|Ga0209057_1000999 | All Organisms → cellular organisms → Bacteria | 23664 | Open in IMG/M |
| 3300026342|Ga0209057_1118537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1000 | Open in IMG/M |
| 3300026343|Ga0209159_1024421 | All Organisms → cellular organisms → Bacteria | 3336 | Open in IMG/M |
| 3300026499|Ga0257181_1055901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 662 | Open in IMG/M |
| 3300026527|Ga0209059_1116778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1032 | Open in IMG/M |
| 3300026530|Ga0209807_1018059 | All Organisms → cellular organisms → Bacteria | 3451 | Open in IMG/M |
| 3300026536|Ga0209058_1036419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2958 | Open in IMG/M |
| 3300026537|Ga0209157_1006907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8097 | Open in IMG/M |
| 3300026540|Ga0209376_1041941 | All Organisms → cellular organisms → Bacteria | 2721 | Open in IMG/M |
| 3300026550|Ga0209474_10108441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1859 | Open in IMG/M |
| 3300026551|Ga0209648_10131039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2007 | Open in IMG/M |
| 3300026551|Ga0209648_10189497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1582 | Open in IMG/M |
| 3300027181|Ga0208997_1024569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 861 | Open in IMG/M |
| 3300027383|Ga0209213_1095895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
| 3300027521|Ga0209524_1083394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 672 | Open in IMG/M |
| 3300027535|Ga0209734_1002004 | All Organisms → cellular organisms → Bacteria | 3442 | Open in IMG/M |
| 3300027546|Ga0208984_1059182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 821 | Open in IMG/M |
| 3300027587|Ga0209220_1002202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5325 | Open in IMG/M |
| 3300027591|Ga0209733_1017183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1942 | Open in IMG/M |
| 3300027616|Ga0209106_1036339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1093 | Open in IMG/M |
| 3300027645|Ga0209117_1019371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2210 | Open in IMG/M |
| 3300027651|Ga0209217_1020870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2097 | Open in IMG/M |
| 3300027651|Ga0209217_1052015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1233 | Open in IMG/M |
| 3300027651|Ga0209217_1192138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 552 | Open in IMG/M |
| 3300027684|Ga0209626_1037464 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300027738|Ga0208989_10038039 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300027842|Ga0209580_10022514 | All Organisms → cellular organisms → Bacteria | 2815 | Open in IMG/M |
| 3300027875|Ga0209283_10073671 | All Organisms → cellular organisms → Bacteria | 2203 | Open in IMG/M |
| 3300027875|Ga0209283_10439990 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300027882|Ga0209590_10000716 | All Organisms → cellular organisms → Bacteria | 11444 | Open in IMG/M |
| 3300027882|Ga0209590_10244376 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300027903|Ga0209488_10585743 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300028047|Ga0209526_10114106 | All Organisms → cellular organisms → Bacteria | 1899 | Open in IMG/M |
| 3300028536|Ga0137415_10263900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1529 | Open in IMG/M |
| 3300028536|Ga0137415_10512470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1008 | Open in IMG/M |
| 3300028536|Ga0137415_10939471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 675 | Open in IMG/M |
| 3300028884|Ga0307308_10003090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6957 | Open in IMG/M |
| 3300031753|Ga0307477_10000625 | All Organisms → cellular organisms → Bacteria | 36257 | Open in IMG/M |
| 3300031753|Ga0307477_10016619 | All Organisms → cellular organisms → Bacteria | 5022 | Open in IMG/M |
| 3300031820|Ga0307473_10155662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1306 | Open in IMG/M |
| 3300031962|Ga0307479_10045132 | All Organisms → cellular organisms → Bacteria | 4232 | Open in IMG/M |
| 3300031962|Ga0307479_10102771 | All Organisms → cellular organisms → Bacteria | 2778 | Open in IMG/M |
| 3300032180|Ga0307471_100646822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1219 | Open in IMG/M |
| 3300032205|Ga0307472_100087642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2095 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 24.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 15.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.14% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.29% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.95% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.48% |
| Hydrocarbon Resource Environments | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001181 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 | Environmental | Open in IMG/M |
| 3300001333 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001359 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002853 | PDIso9.ppmwps2 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007740 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300007822 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-8-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022691 | Soil microbial communities from Calhoun CZO, South Carolina, United States - 60cm depth | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12683J13190_10022873 | 3300001089 | Forest Soil | MDAEETDQQRSIVELKAIIAKGLQGINECRYKTDCEFACACPGTC* |
| JGI12636J13339_10332872 | 3300001154 | Forest Soil | MDAEETDQQKKIRELQAIIAKGLKGINDCRYKTECEFAGACPGTC* |
| JGI12663J13571_1008512 | 3300001181 | Forest Soil | MDAEETDQQKSIVELQAIIAKGLKGINECRYKTDCEFACACPGTC* |
| A21PFW6_12871412 | 3300001333 | Permafrost | MDAEDAKKVKRIPELQAVVARALAGINECRYKSECEFARSCPGTC* |
| A3035W6_11024852 | 3300001359 | Permafrost | MMDAENKEKPGRIPELQAVVARALDGINECRYKSECEFVRT |
| A1565W1_104023514 | 3300001536 | Permafrost | MDAEDTEKAKKIQELQAVVAQALSGINDCRYKSECEFARTCPGTC* |
| A1565W1_104413522 | 3300001536 | Permafrost | MMDAENKEKPGRIPELQAVVARALDGINECRYKSECEFARTCPATC* |
| JGI12630J15595_100191822 | 3300001545 | Forest Soil | MDAEETDQQKKIRELQAIIAKGLKGINECRYQTDCEFAHTCPGTC* |
| JGI12630J15595_100821452 | 3300001545 | Forest Soil | MDAEETDQQKKIRELQAIIAKGLKGINDCRYKNDCEFACACPGTC* |
| JGI12053J15887_100139946 | 3300001661 | Forest Soil | MDAEETDQQKKILELQAIIAKGLKGINDCRYKTDCEFACACPGTC* |
| JGI12053J15887_100149542 | 3300001661 | Forest Soil | MDAGETEQQNKIRELQAIVAKGLKGINECRYKTDCEFASACPGTC* |
| JGIcombinedJ26739_1001746923 | 3300002245 | Forest Soil | MDAEETDQQKKIRELQAIIAKGLNGINDCRYKTDCEFACACPGTC* |
| JGI25381J37097_10651302 | 3300002557 | Grasslands Soil | MDAEDTDNQKKIRELLAVVAKGKKGINDCRYQTDCEFARECPGTC* |
| JGI25385J37094_100705983 | 3300002558 | Grasslands Soil | MDAEETDKQNKIRELQAVVAKGLKGINECRYAADCEFARACPGTC* |
| JGI25383J37093_100973283 | 3300002560 | Grasslands Soil | MDAEETDKQNKIRELQAVVAKGLKGINECRYAADCEFARTCPGTC* |
| draft_10123722 | 3300002853 | Hydrocarbon Resource Environments | MDAEEKKNVKRIVELQAVVARAQDGINECRYKAECEFARTCPGTC* |
| JGI25382J43887_100084214 | 3300002908 | Grasslands Soil | MDAGETEQQKKIPELQAIIAKGLKGINECRYKADCEFACACPGTC* |
| JGI25617J43924_101234901 | 3300002914 | Grasslands Soil | MDAEETDQQKKILELQAIIAKGLKGINECRYKDECEFACAXPGTC* |
| JGI25387J43893_10697182 | 3300002915 | Grasslands Soil | MDAEETQQQKKLRELQAIVAKGLKGINDCRYKSDCEFARNCPGTC* |
| JGI25389J43894_10993911 | 3300002916 | Grasslands Soil | MDTEDTEKQNKIRELQAVIAKGLKGINECRYQTDCEFAHECPGTC* |
| Ga0066674_100340851 | 3300005166 | Soil | MDAEETKQNKIRELQAVVARGLKGINECRYQAECEFARACPGTC* |
| Ga0066672_100319543 | 3300005167 | Soil | MDAENTQKQKRIRELQDTVAKGLKGINECRYRSECPFAQQCPATC* |
| Ga0066672_100619073 | 3300005167 | Soil | MDAEETDQQKKILELQAIIAKGLKGINDCRYKTDCEFACACPGIC* |
| Ga0066677_100147003 | 3300005171 | Soil | MDAEEPDQQNKIRELQAVVAKGLKGINECRYAADCEFARACPGTC* |
| Ga0066680_100747282 | 3300005174 | Soil | MDAEETDKQNKIRKLQAVVAKGLKGINECRYQAECEFARACPGTC* |
| Ga0066679_104298831 | 3300005176 | Soil | MDTEDTEKQNKIRELQAVVAKGLKGINECRYQTDCEFAHECPGTC* |
| Ga0066679_106082801 | 3300005176 | Soil | MDTEDTQKQNKIKELQAVVAKGLKGINECRFQADCEFAHECPGTC* |
| Ga0066690_100640352 | 3300005177 | Soil | MDAEDTEKQNKIRELLAVVAKGKKGINECRYQTDCEFAHECPGTC* |
| Ga0066690_109624202 | 3300005177 | Soil | SSTLMDTEDTEKQNKIRELRAVIAKGLKGINECRYQTDCEFGHECPGTC* |
| Ga0066688_100818221 | 3300005178 | Soil | MDAGETEQKKKIPELQAIIAKGLKGINECRYKTDCEFACAC |
| Ga0066685_100067365 | 3300005180 | Soil | MDAEETDKQNKIRELQAVVARGLKGINECRYQAECEFARACPGTC* |
| Ga0066685_100841432 | 3300005180 | Soil | MDAGETEQKKKIPELQAIIAKGLKGINECRYKTDCEFACACPGTC* |
| Ga0066678_108650622 | 3300005181 | Soil | AIPMDAGETEQQKKIPELQAIIAKGLKGINECRYKADCEFACACPGTC* |
| Ga0066671_100000571 | 3300005184 | Soil | MDAEDTEKQDKIRELQAVIARAKNGIMDCRYKADCEFARACPGTC* |
| Ga0070709_115269711 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAEDTEKQSKIRELQAVVAKGLKGINECRFQTDCEFAHECPGTC* |
| Ga0070714_1000065213 | 3300005435 | Agricultural Soil | MDAEDTEQQKKIRELQAVVAKGLKGINDCRYKGECEFASACPGTC* |
| Ga0070708_1000279212 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAEDTQKQNKIRELQAVVAKGLKGINECRFQTDCEFAHECPGTC* |
| Ga0070708_1000309323 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAEDTDNQNKIRELLAVVAKGKKGINECRYQTDCEFARECPGTC* |
| Ga0070708_1004057572 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAEDTEQQKKIRELQAVVAKGLKGINDCRYKGECEFANACPGTC* |
| Ga0066686_100546391 | 3300005446 | Soil | MDAEETDKQSKIRELQAVVAKGLKGINECRYAADCEFARACPGTC* |
| Ga0066681_102976891 | 3300005451 | Soil | MDAEETEKQNKIRELQAVVARGLKGINECRYQAGCEFARACPGTC* |
| Ga0066687_100361983 | 3300005454 | Soil | MDAGETEQQKKIPELQAIIAKGLKGINECRYKTDCEFACACPGTC* |
| Ga0070707_10000018759 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAEDTEKQNKIRELQAVVAKGLKGINECRYQTECEFARACPGTC* |
| Ga0070707_1006743403 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAEDTQKQSKIRELQAVVAKGLKGINECRFQTDCEFAHECPGTC* |
| Ga0070698_1000007789 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAEETEQQKKIPELQAIIAKGLKGINECRYKTDCEFACACPGTC* |
| Ga0070699_1000567051 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAGETEQQKKIQELQAIIAKGLKGINECRYKTDCEFACTCPGIC* |
| Ga0070699_1005788241 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAEETDQQKKILELRAIIAKGLQGINDCRYKTDCEFACACPGAC* |
| Ga0070697_10000003613 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAEDTEKQNKIRELQAVVAKGLKGINECRYQTECEFAHACPGTC* |
| Ga0070697_1000610193 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDTEDTEKQNKIRELQAVVAKGLKGINECRFQTDCEFAHECPGTC* |
| Ga0066697_100777802 | 3300005540 | Soil | MDAEETDKQNKIRELQAVVARGLNGINECRYQAECEFARACPGTC* |
| Ga0066697_102048931 | 3300005540 | Soil | MDAEETHKQNKIRELQAVVAKGLKGINECRYAADCEFARACPGTC* |
| Ga0066697_105361802 | 3300005540 | Soil | MDAEETDKPNKIRELQAVVAKALKGINECRYAADCEFARACPGTC* |
| Ga0070732_100110343 | 3300005542 | Surface Soil | MDAEHKEKQERIRELQAVIARAKNGINECRYKADCEFARACPATC* |
| Ga0066701_100307385 | 3300005552 | Soil | KKIPELQAIIAKGLKGINECRYKTDCEFACACPGTC* |
| Ga0066661_103135703 | 3300005554 | Soil | MDAEDTEKQNKIRELLAVVAKGKKGINECRYQTDCEFARTCPGTC* |
| Ga0066692_109309172 | 3300005555 | Soil | QKKKIPELQAIVAKGLKGINECRYQTDCEFARTCPGTC* |
| Ga0066704_104687121 | 3300005557 | Soil | TEKQNKIRELQAVIAKGLKGINECRYQTDCEFAHECPGTC* |
| Ga0066670_106083692 | 3300005560 | Soil | MDAEDTQKKDRIQELQALVAKAKKGINECRYKSQCEFARACPATC* |
| Ga0066699_110590402 | 3300005561 | Soil | MDAEDTERQNKIRELQAVVAKGLKGINDCRYKSECEFASACPGTC* |
| Ga0066699_110992892 | 3300005561 | Soil | SSTLMDTEDTEKQNKIRELRAVIAKGLKGINECRYQTDCEFAHECPGTC* |
| Ga0066693_100657663 | 3300005566 | Soil | MDAEETDKQNKIRELQAVVARGLKGINECRYQAGCEFARACPGTC* |
| Ga0066702_100939632 | 3300005575 | Soil | MDAEDTEKRDKIRELQAVIARAKNGIMDCRYKTDCEFARACPGAC* |
| Ga0066708_100997473 | 3300005576 | Soil | MDAEDTQKKDRIRELQALVAKAKKGINECRYKSQCEFARACPATC* |
| Ga0070717_100634891 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAEDTEKQSKIRELQAVVAKGLKGINECRFQTDCEFAHECP |
| Ga0066696_105968651 | 3300006032 | Soil | KKIPELQAIIAKGLKGINECRYKADCEFACACPGTC* |
| Ga0066656_103765452 | 3300006034 | Soil | MDAEETEKQNKIRELQAVVARGLKGINECRYQAECEFARACPGTC* |
| Ga0066653_102844521 | 3300006791 | Soil | KIPELQAIIAKGLKGINECRYKTDCEFACACPGTC* |
| Ga0066665_104637062 | 3300006796 | Soil | MDAEETDKQSKIRELQAVVARGLKGINECRYQAECEFARACPGTC* |
| Ga0066665_106993421 | 3300006796 | Soil | TSMDAEETDKQNKIRELQAVVAKALKGINECRYAADCEFARACPGTC* |
| Ga0099791_102172321 | 3300007255 | Vadose Zone Soil | QQKKIPELQAIIAKGLKGINECRYKADCEFACACPGTC* |
| Ga0099793_101114291 | 3300007258 | Vadose Zone Soil | KIRELQAVIAKGLKGINECRYQTDCEFAHECPGTC* |
| Ga0099794_101708763 | 3300007265 | Vadose Zone Soil | MDAEETDQQKKILELRAIIAKGLQGINECRYKTDCEFACGCPGTC* |
| Ga0104326_1323303 | 3300007740 | Soil | MMDAEDAKKVKRIPELQAVVAKALAGINECRYKSECEFARTCPGTC* |
| Ga0104325_1091141 | 3300007822 | Soil | MDAEDAKKVKRIPELQAVVAKALAGINECRYKSECEFARTCPGTC* |
| Ga0102924_10064038 | 3300007982 | Iron-Sulfur Acid Spring | MEAIPMDAGETEQQKKILELQAIIAKGLKGINECRYKTDCEFACACPGTC* |
| Ga0102924_10180474 | 3300007982 | Iron-Sulfur Acid Spring | MDAEEKKNAKRILELQAVVARAQNGINECRYKAECEFARTCPGTC* |
| Ga0102924_10528472 | 3300007982 | Iron-Sulfur Acid Spring | MDAEDTQKQNKIRELQAVVAKGLKGINECRFQAECEFAHECPGTC* |
| Ga0066710_1045061092 | 3300009012 | Grasslands Soil | MDAEETEKQNKIRELQAVVARGLKGINECRYQAGCEFARACPGTC |
| Ga0099829_100162204 | 3300009038 | Vadose Zone Soil | MDAEDTEKQGKIRELQAVVAKGLKGINECRFQTDCEFAHECPGTC* |
| Ga0099829_107195252 | 3300009038 | Vadose Zone Soil | MDAEDTDQQKKIRELQAVVAKGLKGINDCRYKGECEFAAACPGTC* |
| Ga0099830_101926813 | 3300009088 | Vadose Zone Soil | MDAEDTEKQSKIRELQAVVAKGLKGINECRFQTDCEFAHECPGT |
| Ga0099828_100551294 | 3300009089 | Vadose Zone Soil | MDAEETDQQKKIRELQAIIAKGLQGINDCRYKTDCEFACACPGTC* |
| Ga0099828_105678773 | 3300009089 | Vadose Zone Soil | MDAEETDQQKKIRELQAIIAKGLKGINDCRYKTECEFACACPGTC* |
| Ga0099827_100006817 | 3300009090 | Vadose Zone Soil | MDAEETEQQKKIPELQAIIEKGLKGINECRYKTDCEFACACPGTC* |
| Ga0099827_112242091 | 3300009090 | Vadose Zone Soil | MDAEDTEKQNKIRELQAVVAKGLKGINECRYQTECEFAQACPGTC* |
| Ga0066709_1003825211 | 3300009137 | Grasslands Soil | EQKKKIPELQAIVAKGLKGINECRYQTDCEFARTCPGTC* |
| Ga0066709_1009236662 | 3300009137 | Grasslands Soil | MDAEETEQKKKIPELQAIVAKGLKGINECRYQTDCEFARTCPGTC* |
| Ga0066709_1022128391 | 3300009137 | Grasslands Soil | RTRHSTTSMDAEETDKQNKIRELQAVVAKGLKGINECRYAADCEFARACPGTC* |
| Ga0066709_1040119081 | 3300009137 | Grasslands Soil | KKKIPELQAIIAKGLKGINECRYKTDCEFACACPGTC* |
| Ga0099792_101472812 | 3300009143 | Vadose Zone Soil | MDTEDTEKQSKIRELQAVIAKGLKGINECRYQTDCEFAHECPGTC* |
| Ga0099792_105315332 | 3300009143 | Vadose Zone Soil | MDAEETDQQKKIRELQAIIAKGLQGINDCRYKTDCEFACGCPGTC* |
| Ga0134065_102732693 | 3300010326 | Grasslands Soil | DAEETKQNKIRELQAVVARGLKGINECRYQAECEFARACPGTC* |
| Ga0134063_100341392 | 3300010335 | Grasslands Soil | MDAEETDKQSKIRELQAVVARGLKGINECRYQAGCEFARACPGTC* |
| Ga0134062_101949582 | 3300010337 | Grasslands Soil | MDAEETDKQNKIRELQAVVAKALKGINECRYAADCEFARACPGTC* |
| Ga0137392_106369432 | 3300011269 | Vadose Zone Soil | MDAEETDQQKKILELQAIIAKGLQGINDCRYKTDCEFACGCPGTC* |
| Ga0120114_10638212 | 3300011998 | Permafrost | MDAEETQQQKKLRELQAIVAKGLKGINECRYKSDCEFARTCPATC* |
| Ga0120114_11022982 | 3300011998 | Permafrost | DQQKRIRELQAVVAKGLKGINDCRYKGECEFANACPGTC* |
| Ga0120159_11887342 | 3300012014 | Permafrost | MDAEDAKKVKRIPELQAVVARALAGINECRYKSECEFARTCPGTC* |
| Ga0120139_11059312 | 3300012019 | Permafrost | MDAEDKENPGRIPELQAVVARALEGINDCRYKSECEFARTCPATC* |
| Ga0120139_11106482 | 3300012019 | Permafrost | MDAEDTDQQKRIRELQAVVAKGLKGINDCRYKGECEFANACPGTC* |
| Ga0137364_101504732 | 3300012198 | Vadose Zone Soil | MDAEETQQQKRLRELQAIVAKGLKGINECRYKSDCEFARTCPGTC* |
| Ga0137364_109671431 | 3300012198 | Vadose Zone Soil | MDAGETEQQKKIAELQAIIAKGLKGINECRYKADCEFACACPGTC* |
| Ga0137382_104092761 | 3300012200 | Vadose Zone Soil | DAGETEQQKKIPELQAIIAKGLKGINECRYKTDCEFACACPGTC* |
| Ga0137365_100125977 | 3300012201 | Vadose Zone Soil | MDAGETEQQKKIAELQAIIAKGLKGINECRYKTDCEFACACPGTC* |
| Ga0137399_104907811 | 3300012203 | Vadose Zone Soil | MDAGETEQQKKIRELQAIIAKGLKGINECRYKTDCEFACACPGTC* |
| Ga0137362_103102643 | 3300012205 | Vadose Zone Soil | MDAGETEQQKKIPELQAIIAKGLKGINECRYKTDCEFAGACPGTC* |
| Ga0137380_101015494 | 3300012206 | Vadose Zone Soil | IPMDAGETEQQKKIAELQAIIAKGLKGINECRYKADCEFACACPGTC* |
| Ga0137380_107592371 | 3300012206 | Vadose Zone Soil | IAELQAIIAKGLKGINECRYKTDCEFACACPGTC* |
| Ga0137376_106359271 | 3300012208 | Vadose Zone Soil | TTSMDAEETDKQNKIQELQAVVAKGLKGINECRYAADCEFARACPGTC* |
| Ga0137387_103785501 | 3300012349 | Vadose Zone Soil | MDAGETEQQKKIAELQAIIAKGLKGINECRYKADCEFACACPGT |
| Ga0137371_109595532 | 3300012356 | Vadose Zone Soil | MDAGETEQQKKIAELQAIIAKGLKGINECRYKTDCEFASACPGTC* |
| Ga0137385_105775232 | 3300012359 | Vadose Zone Soil | MDAEEPDKQNKIRKLQAVVAKGLKGINECRYAAECEFARACPGTC* |
| Ga0137390_106191382 | 3300012363 | Vadose Zone Soil | MDAEETDQQKKILELRAIIAKGLQGINDCRYKTDCEFACGCPGTC* |
| Ga0137390_120221711 | 3300012363 | Vadose Zone Soil | MDAEETDQQKKILELRAIIAKGLQGVNDCRYKTDCEFACGCPGTC* |
| Ga0137396_103136692 | 3300012918 | Vadose Zone Soil | MDAGETEQQKKIRELQAIIAKGLKGINECRYKTDCEFACACPGIC* |
| Ga0137394_115734122 | 3300012922 | Vadose Zone Soil | MDTEDTEKRNKIRELQAVVAKGLKGINECRFQTDCEFAHECPGTC* |
| Ga0137416_113449112 | 3300012927 | Vadose Zone Soil | MEAEDTKDQKKIRELQAIVAKGLQGINECRYKTDCEFACACPGTC* |
| Ga0137410_114639582 | 3300012944 | Vadose Zone Soil | MDAGETEQQKKIRELQAIIAKGLKGINECRYQTDCEFACACPGIC* |
| Ga0134110_102540393 | 3300012975 | Grasslands Soil | HVKEAIPMDAGETEQKKKIPELQAIIAKGLKGINECRYKTDCEFACACPGTC* |
| Ga0134081_101059712 | 3300014150 | Grasslands Soil | MDAEVTDKQNKIRELQAVVAKGLKGINECRYAADCEFARACPGTC* |
| Ga0167668_10052783 | 3300015193 | Glacier Forefield Soil | MDAEETDQQKKIRELQAIIAKGLSGINDCRYKKECEFACACPGTC* |
| Ga0134072_100240082 | 3300015357 | Grasslands Soil | MDAEETDKQNKIRELQAVVARGLKGINECRYAADCEFARACPGTC* |
| Ga0134083_103354292 | 3300017659 | Grasslands Soil | MDAEETDKQNKIRELQAVVARGLKGINECRYAADCEFARACPGTC |
| Ga0066655_100872982 | 3300018431 | Grasslands Soil | MDAEETEKQSKIRELQAVVARGLKGINECRYQAECEFARACPGTC |
| Ga0066667_100335132 | 3300018433 | Grasslands Soil | MDAEETDKQNKIRELQAVVARGLKGINECRYQAECEFARACPGTC |
| Ga0066667_103698812 | 3300018433 | Grasslands Soil | MDAEDTDNQKKIRELLAVVAKGKKGINDCRYQTDCEFARECPGTC |
| Ga0066667_105241433 | 3300018433 | Grasslands Soil | MDAENTQKQKRIRELQDTVAKGLKGINECRYRSECPFAQQCPATC |
| Ga0066662_101226603 | 3300018468 | Grasslands Soil | MDAGETEQKKKIPELQAIIAKGLKGINECRYKTDCEFACACPGTC |
| Ga0066662_102337132 | 3300018468 | Grasslands Soil | MDAEDTEKRDKIRELQAVIARAKNGIMDCRYKTDCEFARACPGAC |
| Ga0066662_116054572 | 3300018468 | Grasslands Soil | MDAEDTEKQDKIRELQAVIARAKNGIMDCRYKADCEFARACPGTC |
| Ga0066669_1000099111 | 3300018482 | Grasslands Soil | MDAEETDKQNKIRELQAVVAKALKGINECRYAADCEFARACPGTC |
| Ga0066669_100724803 | 3300018482 | Grasslands Soil | MDAEETKQNKIRELQAVVARGLKGINECRYQAECEFARACPGTC |
| Ga0066669_113418112 | 3300018482 | Grasslands Soil | QNKIRELQAVVARGLKGINECRYQAGCEFARACPGTC |
| Ga0193751_10190104 | 3300019888 | Soil | MDAEDTEKQNKIRELQAVVARGLKGINECRFQTDCEFAHECPGTC |
| Ga0193751_10352793 | 3300019888 | Soil | MDAEDTDQQKRIRELQAVVAKGLKGINDCRYKGECEFANACPGTC |
| Ga0193733_10673883 | 3300020022 | Soil | ETEQQKKLPELQAIIAKGLKGINECRYKTDCEFACACPGTC |
| Ga0210399_113152182 | 3300020581 | Soil | MDAEDTQKQSKIRELQAVVAKGLKGINECRFQTDCEFAHECPGTC |
| Ga0215015_108878931 | 3300021046 | Soil | MDAEDNENQKKIRELLAVVAKGKRGINECRYQSDCEFARECPGTC |
| Ga0210409_106748251 | 3300021559 | Soil | MDAEETDQQKKIRELQAIIAKGLNGINDCRYKTECEFACACPGTC |
| Ga0212123_1001430910 | 3300022557 | Iron-Sulfur Acid Spring | MDAEEKKNVKRIVELQAVVARAQDGINECRYKAECEFARTCPGTC |
| Ga0212123_100346014 | 3300022557 | Iron-Sulfur Acid Spring | MDAEEKKNAKRILELQAVVARAQNGINECRYKAECEFARTCPGTC |
| Ga0212123_101588533 | 3300022557 | Iron-Sulfur Acid Spring | MDAGETEQQKKILELQAIIAKGLKGINECRYKTDCEFACACPGTC |
| Ga0212123_102541041 | 3300022557 | Iron-Sulfur Acid Spring | MDAEDTQKQNKIRELQAVVAKGLKGINECRFQAECEFAHECPGTC |
| Ga0248483_1163272 | 3300022691 | Soil | MDAEDTEQQNKIRELQAIVAKGLKGINECRYKTDCEFASACPGTC |
| Ga0207684_1000138429 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAEDTDNQNKIRELLAVVAKGKKGINECRYQTDCEFARECPGTC |
| Ga0207646_100001246 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAEDTEKQNKIRELQAVVAKGLKGINECRYQTECEFARACPGTC |
| Ga0207664_106043073 | 3300025929 | Agricultural Soil | DAEDTEKQSKIRELQAVVAKGLKGINECRFQTDCEFAHECPGTC |
| Ga0207665_100203733 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAEDTEQQKKIRELQAVVAKGLKGINDCRYKGECEFANACPGTC |
| Ga0209234_10091554 | 3300026295 | Grasslands Soil | MDAEETEQKKKIPELQAIVAKGLKGINECRYQTDCEFARTCPGTC |
| Ga0209235_10551072 | 3300026296 | Grasslands Soil | MDAEETDKQNKIRELQAVVAKGLKGINECRYAADCEFARTCPGTC |
| Ga0209236_11220363 | 3300026298 | Grasslands Soil | MDAEETDKQNKIRELQAVVAKGLKGINECRYAADCEFARACPGTC |
| Ga0209027_12149262 | 3300026300 | Grasslands Soil | MDAEDTEKKDRIRELQALVAKAKKGINECRYKSQCEFARACPATC |
| Ga0209027_12695882 | 3300026300 | Grasslands Soil | MDAEETQQQKKLRELQAIVAKGLKGINDCRYKSDCEFARNCPGTC |
| Ga0209027_12906192 | 3300026300 | Grasslands Soil | MDTEDTEKQNKIRELQAVIAKGLKGINECRYQTDCEFAH |
| Ga0209238_11264682 | 3300026301 | Grasslands Soil | MDTEDTEKQNKIRELQAVIAKGLKGINECRYQTDCEFAHECPGTC |
| Ga0209239_10847332 | 3300026310 | Grasslands Soil | MDAGETEQQKKIPELQAIIAKGLKGINECRYKTDCEFACACPGTC |
| Ga0209686_100169811 | 3300026315 | Soil | MDAEEPDQQNKIRELQAVVAKGLKGINECRYAADCEFARACPGTC |
| Ga0209154_10598873 | 3300026317 | Soil | KILELQAIIAKGLKGINDCRYKTDCEFACACPGIC |
| Ga0209154_11217573 | 3300026317 | Soil | TTSMDAEETDKQNKIRELQAVVAKGLKGINECRYAADCEFARACPGTC |
| Ga0209471_10023977 | 3300026318 | Soil | MDAEETDQQKKILELQAIIAKGLKGINDCRYKTDCEFACACPGIC |
| Ga0209470_12681212 | 3300026324 | Soil | MDAEETKQNKIRELQAVVARGLKGINECRYQAECEFARACP |
| Ga0209802_11016891 | 3300026328 | Soil | MDAEETDKQNKIRKLQAVVAKGLKGINECRYQAECEFARACPGTC |
| Ga0209473_12161293 | 3300026330 | Soil | EQQKKIPELQAIIAKGLKGINECRYKTDCEFACACPGTC |
| Ga0209473_12267112 | 3300026330 | Soil | RHSTTSMDAEETEKQNKIRELQAVVARGLKGINECRYQAGCEFARACPGTC |
| Ga0209267_10212601 | 3300026331 | Soil | MDAGETEQQKKIPELQAIIAKGLKGINECRYKTDCEFACAC |
| Ga0209804_12518912 | 3300026335 | Soil | MDAEDTEKQNKIRELLAVVAKGKKGINECRYQTDCEFAHECPGTC |
| Ga0209057_10009996 | 3300026342 | Soil | MDAEETDKPNKIRELQAVVAKALKGINECRYAADCEFARACPGTC |
| Ga0209057_11185372 | 3300026342 | Soil | MDAEETHKQNKIRELQAVVAKGLKGINECRYAADCEFARACPGTC |
| Ga0209159_10244215 | 3300026343 | Soil | MDAEETKQNKIRELQAVVARGLKGINECRYQAECEFAR |
| Ga0257181_10559012 | 3300026499 | Soil | APIPMDAEETDQQKKILELRAIIAKGLQGINDCRYKTDCEFACGCPGTC |
| Ga0209059_11167781 | 3300026527 | Soil | TSRQRSVMDAENTQKQKRIRELQDTVAKGLKGINECRYRSECPFAQQCPATC |
| Ga0209807_10180592 | 3300026530 | Soil | MDTEDTEKQNKIRELQAVVAKGLKGINECRYQTDCEFAHECPGTC |
| Ga0209058_10364194 | 3300026536 | Soil | MDAEETDKQSKIRELQAVVARGLKGINECRYQAECEFARACPGTC |
| Ga0209157_10069073 | 3300026537 | Soil | MDAEETDKQSKIRELQAVVAKGLKGINECRYAADCEFARACPGTC |
| Ga0209376_10419411 | 3300026540 | Soil | RRRTRHSTTSMDAEETDKQNKIRELQAVVAKALKGINECRYAADCEFARACPGTC |
| Ga0209474_101084413 | 3300026550 | Soil | MDAEDTQKKDRIRELQALVAKAKKGINECRYKSQCEFARACPATC |
| Ga0209648_101310393 | 3300026551 | Grasslands Soil | MDAEETDQQKKILELRAIIAKGLQGINDCRYKTDCEFACGCPGTC |
| Ga0209648_101894972 | 3300026551 | Grasslands Soil | MDAEETDQQKKILELQAIIAKGLKGINECRYKDECEFACACPGTC |
| Ga0208997_10245691 | 3300027181 | Forest Soil | MDAGETEQQNKIRELQAIVAKGLKGINECRYKTDCEF |
| Ga0209213_10958952 | 3300027383 | Forest Soil | MDTEDTEKQSKIRELQAVIAKGLKGINECRYQTDCEFAHECPGTC |
| Ga0209524_10833942 | 3300027521 | Forest Soil | MDAEETDQQKKIRELQAIIAKGLKGINECRYQTDCEFAHTCPGTC |
| Ga0209734_10020042 | 3300027535 | Forest Soil | MDAEETDQQKSIVELQAIIAKGLKGINECRYKTDCEFACACPGTC |
| Ga0208984_10591822 | 3300027546 | Forest Soil | MDAEETDQQKKILELQAIIAKGLKGINDCRYKTDCEFACACPGTC |
| Ga0209220_10022025 | 3300027587 | Forest Soil | MDAGETEQQKKIRELQAIIAKGLKGINECRYKTDCEFACACPGIC |
| Ga0209733_10171833 | 3300027591 | Forest Soil | MDAEETDQQKKIRELQAIIAKGLNGINDCRYKTDCEFACACPGTC |
| Ga0209106_10363392 | 3300027616 | Forest Soil | MDAGETEQQNKIRELQAIVAKGLKGINECRYKTDCEFASACPGTC |
| Ga0209117_10193713 | 3300027645 | Forest Soil | MDAEETDQQRSIVELKAIIAKGLQGINECRYKTDCEFACACPGTC |
| Ga0209217_10208703 | 3300027651 | Forest Soil | MDAEETDQQKKIRELQAIIAKGLKGINDCRYKTECEFAGACPGTC |
| Ga0209217_10520152 | 3300027651 | Forest Soil | MDAEDTQKQSKIRELQAVVAKGLKGINECRFQADCEFAHECPGTC |
| Ga0209217_11921381 | 3300027651 | Forest Soil | MDAEDNENQKKIRELLAVVAKGKKGINECRYQTDCEFAHECPGTC |
| Ga0209626_10374641 | 3300027684 | Forest Soil | DQQKKIRELQAIIAKGLKGINDCRYKNDCEFACACPGTC |
| Ga0208989_100380392 | 3300027738 | Forest Soil | MDAGETEQQNKIRELQAIVAKGLKGINDCRYKTDCEFASTCPGTC |
| Ga0209580_100225144 | 3300027842 | Surface Soil | DHTLRQSTEPMDAEHKEKQERIRELQAVIARAKNGINECRYKADCEFARACPATC |
| Ga0209283_100736713 | 3300027875 | Vadose Zone Soil | MDAEETDQQKKIRELQAIIAKGLQGINDCRYKTDCEFACACPGTC |
| Ga0209283_104399903 | 3300027875 | Vadose Zone Soil | DAEDTQKQSKIRELQAVVAKGLKGINECRFQTDCEFAHECPGTC |
| Ga0209590_100007167 | 3300027882 | Vadose Zone Soil | MDAEETEQQKKIPELQAIIEKGLKGINECRYKTDCEFACACPGTC |
| Ga0209590_102443761 | 3300027882 | Vadose Zone Soil | KQGKIRELQAVVAKGLKGINECRFQTDCEFAHECPGTC |
| Ga0209488_105857431 | 3300027903 | Vadose Zone Soil | QKQNKIKELQAVVAKGLKGINECRFQADCEFAHECPGTC |
| Ga0209526_101141063 | 3300028047 | Forest Soil | MDAEETDQQKKIRELQAIIAKGLKGINDCRYKNDCEFACACPGTC |
| Ga0137415_102639003 | 3300028536 | Vadose Zone Soil | MDAEETDQQKKILELRAIIAKGLQGINECRYKTDCEFACGCPGTC |
| Ga0137415_105124702 | 3300028536 | Vadose Zone Soil | MDAEDTQEQKKIRELQAIVAKGLQGINECRYKADCEFACACPGTC |
| Ga0137415_109394711 | 3300028536 | Vadose Zone Soil | MDTEDTEQHTKIRELQAVVAKGLKGINECRFQTDCEFAHEC |
| Ga0307308_100030904 | 3300028884 | Soil | MDAEETQQQKKLRELQAIVAKGLKGINDCRYKSDCEFARTCPGTC |
| Ga0307477_1000062521 | 3300031753 | Hardwood Forest Soil | MDAEDTQKQNKIRELQATVAKGLKGINECRFQTDCEFAHECPGTC |
| Ga0307477_100166191 | 3300031753 | Hardwood Forest Soil | MDAEDTDNQNKIRELLAVVAKGKKGINECRYQSDCEFARECPGTC |
| Ga0307473_101556623 | 3300031820 | Hardwood Forest Soil | MDAEDTDNQKKIRELLAVVAKGKKGINECRYKTDCEFARECPGTC |
| Ga0307479_100451326 | 3300031962 | Hardwood Forest Soil | MDAEDTENQKKIRELLAVVAKGKKGINECRYQTDCEFAHECPGTC |
| Ga0307479_101027713 | 3300031962 | Hardwood Forest Soil | MDAEDTENQKKIRELLAVVAKGKKGINECRYQTDCEFARECPGTC |
| Ga0307471_1006468221 | 3300032180 | Hardwood Forest Soil | MDAEDTEQKKKIRELLAVVAKGKKGINDCRYKADCEFARDCPGTC |
| Ga0307472_1000876423 | 3300032205 | Hardwood Forest Soil | MDAEDTENQKKIRELLAVVAKGKKGINECRYKTDCEFARECPGTC |
| ⦗Top⦘ |