| Basic Information | |
|---|---|
| Family ID | F023294 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 210 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSTSGTVGQTVITVQNLIDSGARRAGKLAEELTVEQVQASKQSL |
| Number of Associated Samples | 151 |
| Number of Associated Scaffolds | 210 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 90.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.62 % |
| % of genes from short scaffolds (< 2000 bps) | 87.14 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (86.190 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (28.095 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (74.762 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.56% β-sheet: 0.00% Coil/Unstructured: 44.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 210 Family Scaffolds |
|---|---|---|
| PF07460 | NUMOD3 | 0.95 |
| PF02945 | Endonuclease_7 | 0.95 |
| PF00182 | Glyco_hydro_19 | 0.48 |
| PF00166 | Cpn10 | 0.48 |
| PF09374 | PG_binding_3 | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 210 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.48 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.67 % |
| Unclassified | root | N/A | 3.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001850|RCM37_1207991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300002052|SMTZ1_10005432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12813 | Open in IMG/M |
| 3300002092|JGI24218J26658_1015849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1107 | Open in IMG/M |
| 3300003375|JGI26470J50227_1004656 | All Organisms → cellular organisms → Bacteria | 3922 | Open in IMG/M |
| 3300003375|JGI26470J50227_1063367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300003616|JGI25928J51866_1123176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300003806|Ga0007864_1010445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300003814|Ga0007877_1004631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1989 | Open in IMG/M |
| 3300003820|Ga0007863_1003085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2007 | Open in IMG/M |
| 3300004481|Ga0069718_14148371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300004684|Ga0065168_1038203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300004686|Ga0065173_1011657 | All Organisms → Viruses → Predicted Viral | 1623 | Open in IMG/M |
| 3300004686|Ga0065173_1070390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300004692|Ga0065171_1020785 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
| 3300004777|Ga0007827_10009093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2552 | Open in IMG/M |
| 3300004777|Ga0007827_10152882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300004806|Ga0007854_10041181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2345 | Open in IMG/M |
| 3300004807|Ga0007809_10053463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1309 | Open in IMG/M |
| 3300004807|Ga0007809_10065746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1152 | Open in IMG/M |
| 3300004807|Ga0007809_10132143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300006071|Ga0007876_1021285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1822 | Open in IMG/M |
| 3300006103|Ga0007813_1018389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1673 | Open in IMG/M |
| 3300006104|Ga0007882_10212490 | Not Available | 652 | Open in IMG/M |
| 3300006105|Ga0007819_1105518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300006107|Ga0007836_1125983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300006108|Ga0007862_1028899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1198 | Open in IMG/M |
| 3300006109|Ga0007870_1064280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 711 | Open in IMG/M |
| 3300006111|Ga0007848_1065170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300006112|Ga0007857_1105015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 508 | Open in IMG/M |
| 3300006115|Ga0007816_1063996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300006119|Ga0007866_1054452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300006119|Ga0007866_1055377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300006121|Ga0007824_1019587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1367 | Open in IMG/M |
| 3300006121|Ga0007824_1025260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1180 | Open in IMG/M |
| 3300006128|Ga0007828_1039997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300006129|Ga0007834_1100391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300006802|Ga0070749_10768516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300006917|Ga0075472_10714923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300007234|Ga0075460_10012967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3319 | Open in IMG/M |
| 3300007538|Ga0099851_1293957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300007541|Ga0099848_1180673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300007973|Ga0105746_1292695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300008113|Ga0114346_1066691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1738 | Open in IMG/M |
| 3300009151|Ga0114962_10017720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5084 | Open in IMG/M |
| 3300009151|Ga0114962_10077004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2123 | Open in IMG/M |
| 3300009151|Ga0114962_10187139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1219 | Open in IMG/M |
| 3300009151|Ga0114962_10262921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
| 3300009151|Ga0114962_10272483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 956 | Open in IMG/M |
| 3300009151|Ga0114962_10693317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300009154|Ga0114963_10221069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1087 | Open in IMG/M |
| 3300009154|Ga0114963_10287401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
| 3300009182|Ga0114959_10054449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2305 | Open in IMG/M |
| 3300009182|Ga0114959_10219875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
| 3300009183|Ga0114974_10386900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300009183|Ga0114974_10630843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300009502|Ga0114951_10301747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
| 3300009502|Ga0114951_10496112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300009502|Ga0114951_10506717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300009502|Ga0114951_10515837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300009684|Ga0114958_10643373 | Not Available | 506 | Open in IMG/M |
| 3300010157|Ga0114964_10347745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300010158|Ga0114960_10160516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1201 | Open in IMG/M |
| 3300010158|Ga0114960_10242926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
| 3300010158|Ga0114960_10329485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300010158|Ga0114960_10331392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300010160|Ga0114967_10213226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1031 | Open in IMG/M |
| 3300010160|Ga0114967_10427611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300010312|Ga0102883_1044102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1329 | Open in IMG/M |
| 3300010885|Ga0133913_10191898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5449 | Open in IMG/M |
| 3300012663|Ga0157203_1054346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300012690|Ga0157575_102727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300012695|Ga0157577_1096694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6643 | Open in IMG/M |
| 3300012778|Ga0138269_1110732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
| 3300013014|Ga0164295_10896577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300013093|Ga0164296_1114077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1116 | Open in IMG/M |
| 3300013093|Ga0164296_1212031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300013093|Ga0164296_1300177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300013094|Ga0164297_10103244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1203 | Open in IMG/M |
| 3300013094|Ga0164297_10174708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300013285|Ga0136642_1017819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2106 | Open in IMG/M |
| 3300013285|Ga0136642_1102797 | All Organisms → Viruses | 735 | Open in IMG/M |
| 3300013286|Ga0136641_1200737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300013295|Ga0170791_15957897 | Not Available | 540 | Open in IMG/M |
| 3300014502|Ga0182021_12574424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300015050|Ga0181338_1033600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300017707|Ga0181363_1037603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300017747|Ga0181352_1114192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300017747|Ga0181352_1207520 | Not Available | 502 | Open in IMG/M |
| 3300017754|Ga0181344_1043191 | All Organisms → Viruses → Predicted Viral | 1354 | Open in IMG/M |
| 3300017766|Ga0181343_1228712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300017778|Ga0181349_1317608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300017780|Ga0181346_1039862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1925 | Open in IMG/M |
| 3300017784|Ga0181348_1057929 | All Organisms → Viruses → Predicted Viral | 1573 | Open in IMG/M |
| 3300017785|Ga0181355_1200352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300017951|Ga0181577_10550390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300019783|Ga0181361_116037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300019783|Ga0181361_119165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300019784|Ga0181359_1059904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1458 | Open in IMG/M |
| 3300020176|Ga0181556_1072309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1682 | Open in IMG/M |
| 3300020176|Ga0181556_1136397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
| 3300020205|Ga0211731_10627286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300020551|Ga0208360_1000799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6809 | Open in IMG/M |
| 3300020714|Ga0214182_1048013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300020729|Ga0214251_1059209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300020733|Ga0214172_1030224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300021121|Ga0214173_126625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300021135|Ga0214247_1016018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1416 | Open in IMG/M |
| 3300021138|Ga0214164_1005928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5053 | Open in IMG/M |
| 3300021142|Ga0214192_1098610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
| 3300021424|Ga0194117_10210667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
| 3300021519|Ga0194048_10206427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300021519|Ga0194048_10272870 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 613 | Open in IMG/M |
| 3300021519|Ga0194048_10274291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300021520|Ga0194053_10092349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1277 | Open in IMG/M |
| 3300021956|Ga0213922_1100184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300021963|Ga0222712_10136149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1674 | Open in IMG/M |
| 3300022063|Ga0212029_1036549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300022179|Ga0181353_1139099 | Not Available | 567 | Open in IMG/M |
| 3300022190|Ga0181354_1019886 | All Organisms → Viruses | 2118 | Open in IMG/M |
| 3300022190|Ga0181354_1068346 | All Organisms → Viruses | 1179 | Open in IMG/M |
| 3300022190|Ga0181354_1135636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
| 3300022190|Ga0181354_1142111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300022407|Ga0181351_1122012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
| 3300022591|Ga0236341_1044025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1179 | Open in IMG/M |
| 3300024358|Ga0255173_1001685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4305 | Open in IMG/M |
| 3300024506|Ga0255168_1002631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4229 | Open in IMG/M |
| 3300025316|Ga0209697_10107682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1830 | Open in IMG/M |
| 3300025340|Ga0208866_1002387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1171 | Open in IMG/M |
| 3300025357|Ga0208383_1013415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
| 3300025357|Ga0208383_1024487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
| 3300025357|Ga0208383_1042234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300025375|Ga0208259_1044551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300025375|Ga0208259_1050617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300025375|Ga0208259_1050893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300025389|Ga0208257_1038514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300025390|Ga0208743_1053907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 556 | Open in IMG/M |
| 3300025396|Ga0208874_1051381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300025398|Ga0208251_1001025 | All Organisms → Viruses | 7174 | Open in IMG/M |
| 3300025398|Ga0208251_1042995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300025399|Ga0208107_1041265 | All Organisms → Viruses | 798 | Open in IMG/M |
| 3300025401|Ga0207955_1000868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8413 | Open in IMG/M |
| 3300025401|Ga0207955_1012234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1703 | Open in IMG/M |
| 3300025405|Ga0208381_1022221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
| 3300025424|Ga0208617_1069911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300025435|Ga0208618_1051662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 679 | Open in IMG/M |
| 3300025437|Ga0208742_1072364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300025450|Ga0208744_1013736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1778 | Open in IMG/M |
| 3300025466|Ga0208497_1044680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300025648|Ga0208507_1039679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1619 | Open in IMG/M |
| 3300025648|Ga0208507_1138396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300025655|Ga0208795_1106963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300025789|Ga0208499_1009230 | All Organisms → Viruses → Predicted Viral | 2066 | Open in IMG/M |
| 3300025789|Ga0208499_1038342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300025838|Ga0208872_1170576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300025838|Ga0208872_1226498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300025838|Ga0208872_1294485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300026573|Ga0255269_1018602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1898 | Open in IMG/M |
| 3300027586|Ga0208966_1108382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300027659|Ga0208975_1066127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
| 3300027734|Ga0209087_1149429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
| 3300027741|Ga0209085_1007096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5769 | Open in IMG/M |
| 3300027741|Ga0209085_1130215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1079 | Open in IMG/M |
| 3300027741|Ga0209085_1223648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300027749|Ga0209084_1046728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2105 | Open in IMG/M |
| 3300027749|Ga0209084_1050033 | All Organisms → Viruses → Predicted Viral | 2016 | Open in IMG/M |
| 3300027749|Ga0209084_1313767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300027763|Ga0209088_10425797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300027777|Ga0209829_10145882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1087 | Open in IMG/M |
| 3300027777|Ga0209829_10332783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300027808|Ga0209354_10042957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1817 | Open in IMG/M |
| 3300027808|Ga0209354_10159122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300027836|Ga0209230_10527005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300027896|Ga0209777_10650466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300027896|Ga0209777_10683591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300027896|Ga0209777_10718951 | Not Available | 709 | Open in IMG/M |
| 3300027900|Ga0209253_10311625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1219 | Open in IMG/M |
| 3300028393|Ga0304728_1110265 | All Organisms → Viruses | 1042 | Open in IMG/M |
| 3300031707|Ga0315291_10248070 | All Organisms → Viruses → Predicted Viral | 1780 | Open in IMG/M |
| 3300031759|Ga0316219_1204070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
| 3300031857|Ga0315909_10177192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1718 | Open in IMG/M |
| 3300031885|Ga0315285_10779429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300031951|Ga0315904_11100224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300031963|Ga0315901_10499847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300032018|Ga0315272_10204058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300032046|Ga0315289_10461817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1236 | Open in IMG/M |
| 3300032046|Ga0315289_11503409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300032050|Ga0315906_10892703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300032117|Ga0316218_1173716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300032173|Ga0315268_10611468 | All Organisms → Viruses | 1082 | Open in IMG/M |
| 3300032561|Ga0316222_1168984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
| 3300032562|Ga0316226_1007459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7718 | Open in IMG/M |
| 3300032562|Ga0316226_1075842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1643 | Open in IMG/M |
| 3300032562|Ga0316226_1223144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300032605|Ga0316232_1358212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300032665|Ga0316221_1011253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 5138 | Open in IMG/M |
| 3300032665|Ga0316221_1213257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300032668|Ga0316230_1275603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300032675|Ga0316225_1183631 | All Organisms → Viruses | 657 | Open in IMG/M |
| 3300032676|Ga0316229_1241789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300032677|Ga0316227_1025946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2788 | Open in IMG/M |
| 3300032677|Ga0316227_1134567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300032677|Ga0316227_1154009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300032677|Ga0316227_1265824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300032722|Ga0316231_1027029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3464 | Open in IMG/M |
| 3300034019|Ga0334998_0371361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
| 3300034066|Ga0335019_0149194 | All Organisms → Viruses | 1541 | Open in IMG/M |
| 3300034106|Ga0335036_0728738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300034116|Ga0335068_0484562 | Not Available | 575 | Open in IMG/M |
| 3300034118|Ga0335053_0462229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300034374|Ga0348335_145147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 28.10% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.71% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 9.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.76% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.86% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.86% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.90% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.43% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.43% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.95% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.48% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.48% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.48% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.48% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.48% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.48% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.48% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.48% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.48% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.48% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.48% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300002052 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003616 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
| 3300003814 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 | Environmental | Open in IMG/M |
| 3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
| 3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
| 3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006107 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07 | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
| 3300006111 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul08 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
| 3300006121 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300006129 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012690 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES078 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012695 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES081 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012778 | Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020714 | Freshwater microbial communities from Trout Bog Lake, WI - 14NOV2007 epilimnion | Environmental | Open in IMG/M |
| 3300020729 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021121 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021135 | Freshwater microbial communities from Trout Bog Lake, WI - 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021520 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300024358 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d | Environmental | Open in IMG/M |
| 3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025340 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE20Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025375 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025390 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025399 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025405 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE13Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025424 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025435 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025437 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025648 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| 3300032668 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025 | Environmental | Open in IMG/M |
| 3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
| 3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
| 3300032677 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019 | Environmental | Open in IMG/M |
| 3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM37_12079911 | 3300001850 | Marine Plankton | MAYSGTVGQTVVTVQQFLDQGARLSGKLAEELTVEQVQASKQALFFTLSNLINQGI |
| SMTZ1_100054321 | 3300002052 | Marine Sediment | MAISGTVGQTVINVQQLIDHGARRCGKLAEELTSEQQVSAR* |
| JGI24218J26658_10158493 | 3300002092 | Lentic | MAYSGTVGTTVVTVQQFXXQGARLSGKLAEELTVEQVNGSKQALFFVLSNLINQ |
| JGI26470J50227_10046561 | 3300003375 | Freshwater | MSTSGTVSTTVITVQQLIDHGARRAGKLAEELTVEQVSAAKDSLYYLLSSLANWG |
| JGI26470J50227_10633673 | 3300003375 | Freshwater | MAYSGTVGQTVVTVQNFIDQGARLSGKLAEELTSEQVQGSKQALF |
| JGI25928J51866_11231761 | 3300003616 | Freshwater Lake | MSTSGTVGQTVITVQNLIDSGARRAGKLAEELTSEQVAASKQSL |
| Ga0007864_10104451 | 3300003806 | Freshwater | GTTVVTVQQFIDQGARLSGKLAEELTVEQVQGSKQALFFVLSNLINQGINYWAINKKV* |
| Ga0007877_10046311 | 3300003814 | Freshwater | MAYSGTVGQTVVTVQNFIDQGARLAGKLAEELTVEQVQGSK |
| Ga0007863_10030855 | 3300003820 | Freshwater | MAYSGTVGQTVITVQNFIDQGARLSGKLAEELTSEQVQGS |
| Ga0069718_141483711 | 3300004481 | Sediment | MAYSGTVGQTVVTVQNLIDNGARRAGKLAEELTVEQVQSAKQSLFFL |
| Ga0065168_10382033 | 3300004684 | Freshwater | MAYSGTVGQTVITVQNFIDQGARLSGKLAEELTSEQVQGSKQALFFVLSNLIN |
| Ga0065173_10116571 | 3300004686 | Freshwater | MSTSGTVSQTVVSVQDLIDHGARRAGKLAEELTVEQVSAAKTSLYYLLSS |
| Ga0065173_10703901 | 3300004686 | Freshwater | MSYSGTVGQTVVTVQNFIDQGARLSGKLAEELTIEQVQGSKQALFFVLSNL |
| Ga0065171_10207853 | 3300004692 | Freshwater | MAYSGTVGQTVVTTQQMIDQGARMSGKLAEELTVEQIQASKQALYYVLSN |
| Ga0007827_100090933 | 3300004777 | Freshwater | MSTSGTVGTTVITVQNMIDSGARRCGKLAEELTVEQIQASKQALYYLLSNLVNRGIQYWC |
| Ga0007827_101528821 | 3300004777 | Freshwater | MSTSGTVSTTVVTVQNLIDSGARRAGKLAEELTSEQIFAAK |
| Ga0007854_100411814 | 3300004806 | Freshwater | MSTSGTVSQTVVSVQDLIDHGARRAGKLAEELTVEQVNAAKTSLYYLLSSLTNWGINYW |
| Ga0007809_100534633 | 3300004807 | Freshwater | MAATYSGTVGTTTITVQALIDHAARQSGRVAEELTIEQVQAAKEN |
| Ga0007809_100657461 | 3300004807 | Freshwater | MSTSGTVSTTVVTVQNLIDSGARRAGKLAEELTSEQIFAAKQSLY |
| Ga0007809_101321433 | 3300004807 | Freshwater | MAYSGTVGQTVITVQNFIDQGARLSGKLAEELTSEQVQGSKQAL |
| Ga0007876_10212854 | 3300006071 | Freshwater | MTTSGTVSTTVVTVQNLIDSGARRAGKLAEELTSEEIFAS |
| Ga0007813_10183895 | 3300006103 | Freshwater | MAYSGTVGQTVVTVQQFIDQGARLSGKLAEELTVEQVQASKQALFFSLSN |
| Ga0007882_102124901 | 3300006104 | Freshwater | MAYSGTVGQTVITVQNFIDQGARLSGKLAEELTSEQVQGSKQALFFVLSNLINQ |
| Ga0007819_11055181 | 3300006105 | Freshwater | MAYSGTVGQTVVTVQNFIDQGARLSGTLAESLTVEQVQGSKQALFFVL |
| Ga0007836_11259831 | 3300006107 | Freshwater | MAYSGTVGQTVITVQNFIDKGARLSGKLAEDLTVEQVQGSKQALFFVLSNLINQGINY* |
| Ga0007862_10288993 | 3300006108 | Freshwater | MATSGTVSTTVVTVQNLIDSGARRAGKLAEELTSEQIFASKQSL |
| Ga0007870_10642803 | 3300006109 | Freshwater | MAYSGTVGQTVITVSKLIDHGARRCGKLAEDLTSEQLLSA |
| Ga0007848_10651701 | 3300006111 | Freshwater | MSYSGTVGTTVVSTQKFIDQGARMSGKLAEELTVEQVQAAKQSL |
| Ga0007857_11050151 | 3300006112 | Freshwater | MSTSGTVSQTVVSVQDLIDHGARRAGKLAEELTVEQVSAAKT |
| Ga0007816_10639961 | 3300006115 | Freshwater | VAYSGTVGQTVVSVQNFIDQGARLSGKLAEELTNEQVQGAKQALFFVLSNL |
| Ga0007866_10544521 | 3300006119 | Freshwater | MAYSGTVGQTVITVQNFIDQGARLSGKLAEELTVEQVQGSKQALFFVLSN |
| Ga0007866_10553771 | 3300006119 | Freshwater | MSTSGTVGTTVITVQNMIDSGARRCGKLAEELTVEQIQASKQALYYLLSN |
| Ga0007824_10195871 | 3300006121 | Freshwater | MAYSGTVGQTVITVQNFIDQGARLSGKLAEELTVEQVQGSKQALFFVLS |
| Ga0007824_10252601 | 3300006121 | Freshwater | MAYSGTVGTTVVTVQQFIDQGARLSGKLAEELTVEQVQGSQQALFFVLS |
| Ga0007828_10399973 | 3300006128 | Freshwater | MAYSGTVGQTVVTTQQMIDQGARMSGKLAEELTVEQIQASKQALYYVLSNLINQG |
| Ga0007834_11003913 | 3300006129 | Freshwater | MAYSGTVGTTVVTVQQFIDQGARLSGKLAEELTVEQVQGSQQALFFVLSNL |
| Ga0070749_107685162 | 3300006802 | Aqueous | MAYSNTVGQTVIKVQQLIDHGARRAGKLAEELTPEQLLS |
| Ga0075472_107149232 | 3300006917 | Aqueous | MSTSGTVGTTVINVQKFVDHGARRCGKLAEELTSEQ |
| Ga0075460_100129671 | 3300007234 | Aqueous | MSTSGTVGQTTISVQKLIDHGARRAGKLAEELTDEQVDA |
| Ga0099851_12939571 | 3300007538 | Aqueous | MAYSGTVGQTVVTVQNFIDQGARIAGKLAEELTVEQVQASKQAL |
| Ga0099848_11806734 | 3300007541 | Aqueous | MAYSGTVGTTTVSVQKLIDHGARRAGKLAEELTSEQVQ |
| Ga0105746_12926953 | 3300007973 | Estuary Water | MSTSCTVGQTVISVQNLIDSGARRAGKLAEELTVEQIQAAKQ |
| Ga0114346_10666911 | 3300008113 | Freshwater, Plankton | MAYSGTVGQTVISVQDLIDHGARRAGKLAEELTSEQVYS |
| Ga0114962_100177201 | 3300009151 | Freshwater Lake | MAYSGTVGTTVVTVQAFIDQGARLAGKLAEELTGEQVIAAKQALFFVLSNLINQGINYWA |
| Ga0114962_100770044 | 3300009151 | Freshwater Lake | MAYSGTVGETVISVQDLIDHGARRCGKLAEELTSEQIV |
| Ga0114962_101871394 | 3300009151 | Freshwater Lake | MAYSGTVGQTVITVQQLIDHGARRCGKLAEELTVEQVQSAK |
| Ga0114962_102629213 | 3300009151 | Freshwater Lake | MAYSGTVGQTVITVQQLIDHGARRCGKLAEELTVEQVQSA |
| Ga0114962_102724831 | 3300009151 | Freshwater Lake | MAYSGTIGQTVISVQTLIDHGARRCGKLAEELTVEQVQSAKESL |
| Ga0114962_106933171 | 3300009151 | Freshwater Lake | MAYSGTVGQTVITVQQFIDQGARLSGKLAEELTVEQVNGSKQALYLLLSNLINQGIN |
| Ga0114963_102210691 | 3300009154 | Freshwater Lake | MAYSGTIGQTVTSVQTLIDHGARRCGKLAEELTVEQVQSAKESLFFFLSNLANLGINY |
| Ga0114963_102874013 | 3300009154 | Freshwater Lake | MAYSGTVGQTVITVQQLIDHGARRCGKLAEELTVEQV |
| Ga0114959_100544496 | 3300009182 | Freshwater Lake | MAYSGTVGQTTISVQNLIDDGARRAGKLAEELTVEQVVS |
| Ga0114959_102198751 | 3300009182 | Freshwater Lake | MAYSGTVGTTVINVQQLIDHGARRAGKLAEELTSEQVTSARESLFF |
| Ga0114974_103869001 | 3300009183 | Freshwater Lake | MSTSGTVSTTVITVQNLIDSGARRAGKLAEELTSEQVMASKQSLYYVLSNLTNI |
| Ga0114974_106308433 | 3300009183 | Freshwater Lake | MAYSGTVGQTVVTVQNFIDQGARHSGKLAEELTVEQVQAS |
| Ga0114951_103017474 | 3300009502 | Freshwater | MAYSGTVGTTVVTVQNFIDQGARLSGKLAEELTVEQVSASKQ |
| Ga0114951_104961123 | 3300009502 | Freshwater | MAYSGTVGQTVVTVQNFIDQGARLSGTLAESLTVEQ |
| Ga0114951_105067173 | 3300009502 | Freshwater | MAYSGTVGQTVVTVQNFIDQGARLSGTLAESLTVEQVQGSKQ |
| Ga0114951_105158372 | 3300009502 | Freshwater | MSTSGTVSTTVITVQQLIDHGARRAGKFAEELTDEQVASAKDSLYYLLSNL |
| Ga0114958_106433731 | 3300009684 | Freshwater Lake | MAYSGTVGQTVITVQNFIDQGARLAGKLAEELTVEQVQASKQALFFVLSNLINQ |
| Ga0114964_103477451 | 3300010157 | Freshwater Lake | MSGTTSGTVGQTIVTVQNLIDNGARRAGKLAEELTVEQVQSAKQ |
| Ga0114960_101605161 | 3300010158 | Freshwater Lake | MAYSNTVGTTVINVQQLIDHGARRAGKLAEELTSEQVTSARESLFF |
| Ga0114960_102429261 | 3300010158 | Freshwater Lake | MSTSGTVGQTVITVQNLIDSGARRAGKLAEELTSEQIAASK* |
| Ga0114960_103294851 | 3300010158 | Freshwater Lake | VAYSGTVGQTVVTVQNFIDQGARLSGKLAEELTNEQVIGAKQALFFVLSNLIN |
| Ga0114960_103313921 | 3300010158 | Freshwater Lake | MAYSGTVGQTVITVQQLIDHGARRCGKLAEELTVEQVQS |
| Ga0114967_102132261 | 3300010160 | Freshwater Lake | MSTSGTVSQTVVSVQQMIDSGARRAGKLAEELTSEQVYAAKLSLYYLL |
| Ga0114967_104276112 | 3300010160 | Freshwater Lake | MSYSGTVGQTTVSVQTLIDHGARRAGKFAEELTIEQVQ |
| Ga0102883_10441024 | 3300010312 | Estuarine | MSTSGTVGQTTITVQNLIDHGARRAGKLAEELTVEQVQASKD |
| Ga0133913_101918986 | 3300010885 | Freshwater Lake | MATSGTVGSTVITVQNLIDSGARRAGKLAEELTVEQMQASKQSLYYLLSNLVNRGIQ* |
| Ga0157203_10543461 | 3300012663 | Freshwater | MSTSGTVGQTVISVQKLIDHGARRSGKLAEELTVEQVDASKDS |
| Ga0157575_1027273 | 3300012690 | Freshwater | MAYSGTVGQTVITVQNFIDQGARLSGKLAEELTVEQVQ |
| Ga0157577_10966949 | 3300012695 | Freshwater | MAYSGTVGQTVITVQNFIDQGARLSGKLAEELTVEQVQGSKQALFFVLSNLINQ |
| Ga0138269_11107323 | 3300012778 | Freshwater Lake | MSTSGTVGQTVITVQNLIDSGARRAGKLAEELTVE |
| Ga0164295_108965772 | 3300013014 | Freshwater | MATSGTVGLTTVSVQDLIDDAARASGKLAEELTVEQVQSSKRNLFYV |
| Ga0164296_11140771 | 3300013093 | Freshwater | MSTSGTVGQTVISVQTLIDHGARRAGKLAEELTNEQVNSAKDSLYY |
| Ga0164296_12120312 | 3300013093 | Freshwater | MAYSGTVGQTVITVQNFIDQGARLSGKLAEELTVEQVQGSKQA |
| Ga0164296_13001771 | 3300013093 | Freshwater | MAYSGTVGQTVVTVQNFIDQGARMSGKLAEELTVEQ |
| Ga0164297_101032441 | 3300013094 | Freshwater | MSTSGTVSTTVVTVQNLIDSGARRAGKLAEELTSE |
| Ga0164297_101747083 | 3300013094 | Freshwater | MAYSGTVGTTVVTVQQFIDQGARLSGKLAEELTVEQVQGSKQALFFVLSNLINQGIN |
| Ga0136642_10178193 | 3300013285 | Freshwater | MSYSGTVGQTVISVQTLIDHGARRAGKFAEELTIEQVQSARE |
| Ga0136642_11027973 | 3300013285 | Freshwater | MAYSGTSGQTVVSTQKFIDQGARMSGKLAEELTVEQVQSAKQSLFFILSNLINQGINYWAIEKKVY |
| Ga0136641_12007371 | 3300013286 | Freshwater | MAYSGTVGQTVITVQKLIDHGARRAGKLAEELTVEQVQA |
| Ga0170791_159578972 | 3300013295 | Freshwater | MSTSGTVSQTVVTVQNLIDSGARRAGKLAEELTDEQVAAAKQSLYYLLSSLANWGV |
| Ga0182021_125744241 | 3300014502 | Fen | MAYSGTVGTTVINVQQLIDHGARRAGKLAEELTSEQ |
| Ga0181338_10336001 | 3300015050 | Freshwater Lake | MSTSGTVGQTVISVQDLIDHGARRAGKLAEELTVEQVRS |
| Ga0181363_10376033 | 3300017707 | Freshwater Lake | MAYSGTVGQTVVSVQKFIDQGARMSGKLAEELTVEQVQG |
| Ga0181352_11141921 | 3300017747 | Freshwater Lake | MSTSGTVGQTVITVQNLIDSGARRAGKLAEELTDEQMMAAKQSLYYI |
| Ga0181352_12075201 | 3300017747 | Freshwater Lake | MAYSGTVGTTVVTVQNFIDQGARLSGKLAEELTLEQVVASKQALFFVLSNLINQGINYW |
| Ga0181344_10431914 | 3300017754 | Freshwater Lake | MAYSGTVGQTVVTVQNLIDNGARRCGKLAEELTSEQVLS |
| Ga0181343_12287122 | 3300017766 | Freshwater Lake | MSTSGTVGQTVITVQNLIDSGARRAGKLAEELTDEQMMAAKQSLYY |
| Ga0181349_13176081 | 3300017778 | Freshwater Lake | MSTSGTVGQTVITVQNLIDSGARRAGKLAEELTVEQ |
| Ga0181346_10398621 | 3300017780 | Freshwater Lake | MSTSGTVSQTTISVQQLIDHGARRAGKLAEELTVEQVQAAKESLYYLLS |
| Ga0181348_10579291 | 3300017784 | Freshwater Lake | MATSGTVGLTTVSVQDLIDDAARASGKLAEELTVEQVQSSKRNLFY |
| Ga0181355_12003523 | 3300017785 | Freshwater Lake | VVMDTSGTVGLTRISIMDLIDDGARRAGKLSEELTVQQIQASKRALYYLLSDLVNIGIQYWCI |
| Ga0181577_105503903 | 3300017951 | Salt Marsh | MTTSGTVGETVITAQSLIDHGARRCGKFAETLTVEQVNASRQNLYYLLSNLA |
| Ga0181361_1160371 | 3300019783 | Freshwater Lake | MATSGTVGLTTVSVQDLIDDAARASGKLAEELTVEQVQSSKRN |
| Ga0181361_1191651 | 3300019783 | Freshwater Lake | MSTSGTVGQTVITVQNLIDSGARRAGKLAEELTVEQVQASKQSLYYLPF |
| Ga0181359_10599041 | 3300019784 | Freshwater Lake | MAYSGTVGQTVISVQDLIDHGARRAGKLAEELTSEQA |
| Ga0181556_10723094 | 3300020176 | Salt Marsh | MATSGTVGETVITTQSLIDHGARRCGKFAETLTVEQVNASRQNLYYLLSNLA |
| Ga0181556_11363971 | 3300020176 | Salt Marsh | MAYSGTVGQTVITVQKLIDHGARRAGKLAEELTVEQVQAAKESLF |
| Ga0211731_106272862 | 3300020205 | Freshwater | MAYSGTVGQTVVTVQNLIDNGARRCGKLAEELTSE |
| Ga0208360_100079911 | 3300020551 | Freshwater | MSTSGTVGQTVITVQQLIDHGARRAGKLAEELTNEQVLASKESLY |
| Ga0214182_10480132 | 3300020714 | Freshwater | MAYSGTVGQTVVTVQNFIDQGARLAGKLAEELTIEQVQGSKQALFF |
| Ga0214251_10592092 | 3300020729 | Freshwater | MSTSGTVSQTTISVQQLIDHGARRAGKLAEELTVEQVQASKQSLYY |
| Ga0214172_10302241 | 3300020733 | Freshwater | MSTSGTVSTTVITVQQLIDHGARRAGKLAEELTVEQVSAAKDSLYYLLSSLA |
| Ga0214173_1266251 | 3300021121 | Freshwater | MSTSGTVGQTVISVQTLIDHGARRAGKLAEELTNEQV |
| Ga0214247_10160181 | 3300021135 | Freshwater | MTTSGTVGQTIISVQDLIDHGARRAGKLAEELTNEQVNA |
| Ga0214164_10059281 | 3300021138 | Freshwater | MAYSGTVGQTVVTVQNFIDQGARLAGKLAEELTIEQVQGSKQALFFV |
| Ga0214192_10986101 | 3300021142 | Freshwater | MSTSGTVGQTVVSVQDLIDHGARRAGKLAEELTVEQVNAAKTS |
| Ga0194117_102106671 | 3300021424 | Freshwater Lake | MTTSGTVGTTIVTVQEFIDEGARKCGKLAEELTNEQTRSAKQNLTFLLSALINKG |
| Ga0194048_102064273 | 3300021519 | Anoxic Zone Freshwater | MTIGLNTSGTVGQTVISVQQLIDHGARRAGKLAEELTVEQVSAARDSLY |
| Ga0194048_102728701 | 3300021519 | Anoxic Zone Freshwater | MSTSGTVSATTISVMQLIDHGARRAGKLAEELTVEQVSAARDSLY |
| Ga0194048_102742911 | 3300021519 | Anoxic Zone Freshwater | MSTSGTVSQTTISVQQLIDHGARRAGKLSEELTVEQVQASKQSLYYLLSSLSNYGVNYW |
| Ga0194053_100923494 | 3300021520 | Anoxic Zone Freshwater | MSTSGTVSQTIVTVQNLIDSGARRAGKLAEELTSEQVAA |
| Ga0213922_11001841 | 3300021956 | Freshwater | MAYSGTVGQTVVSVQNFIDQGARLSGKLAEELTVEQVQASKQALFFTLSNLI |
| Ga0222712_101361495 | 3300021963 | Estuarine Water | MAYSGTIGQTVISVQDLIDHGARRSGKLAEELTSEQ |
| Ga0212029_10365491 | 3300022063 | Aqueous | MAYSGTVGTTTVSVQKLIDHGARRAGKLAEELTSEQVQASRTALFYLL |
| Ga0181353_11390991 | 3300022179 | Freshwater Lake | MAYSGTVGQTVVSVQKFIDQGARMSGKLAEELTVEQVQGSK |
| Ga0181354_10198861 | 3300022190 | Freshwater Lake | MSTSGTVGQTVINVQTLIDHGARRCGKLAEELTSEQQLSA |
| Ga0181354_10683461 | 3300022190 | Freshwater Lake | MATSGTVGLTTVSVQDLIDDAARASGKLAEELTVEHFSFSL |
| Ga0181354_11356363 | 3300022190 | Freshwater Lake | MSTSGTVGTTVVNVQKFIDHGARRCGKLAEELTSEQ |
| Ga0181354_11421111 | 3300022190 | Freshwater Lake | MTTSGTVGQTVITTQSLIDHGARRSGKFAESLTVEQVNASRQ |
| Ga0181351_11220121 | 3300022407 | Freshwater Lake | MSTSGTVGQTVITVQNLIDSGARRAGKLAEELTVEQIQ |
| Ga0236341_10440252 | 3300022591 | Freshwater | MTYSGTFGTTITSVQQFIDTGARRAGKLAEELTVEQVEDAKRSLFLLL |
| Ga0255173_10016851 | 3300024358 | Freshwater | MSTSGTVGNTVISVQKFIDHGARRAGKLAEELTSEQVLSARE |
| Ga0255168_10026311 | 3300024506 | Freshwater | MTTSGTVGQTVITTQSLIDHGARRSGKFAESLTVEQV |
| Ga0209697_101076824 | 3300025316 | Freshwater Lake Hypolimnion | MAYSGTVGQTVVTVQNFIDQGARLSGTLAESLTVEQVQGSKQALFFVLSNLINQ |
| Ga0208866_10023874 | 3300025340 | Freshwater | MAYSGTVGQTVITVQNFIDQGARLSGKLAEELTVEQVQGSK |
| Ga0208383_10134154 | 3300025357 | Freshwater | MAYSGTVGTTVVTVQQFIDQGARLSGKLAEELTVEQVQGSQQALFFVLSNLINQGINYW |
| Ga0208383_10244871 | 3300025357 | Freshwater | MSGTTSGTVGQTVVTVQNLIDNGARRAGKLAEELT |
| Ga0208383_10422341 | 3300025357 | Freshwater | MAYSGTVGTTVVTVQQFIDQGARLSGKLAEELTVEQVQGSQQALFFVLSNLINQGINYWAINK |
| Ga0208259_10445512 | 3300025375 | Freshwater | MAYSGTVGTTVVTVQQFIDQGARLSGKLAEELTVEQVQGSQQALFFVLSNLINQGINYWAINKQVY |
| Ga0208259_10506171 | 3300025375 | Freshwater | MAYSGTVGTTVVTVQQFIDQGARLSGKLAEELTVE |
| Ga0208259_10508932 | 3300025375 | Freshwater | MATSGTVSTTVITVQNLIDSGARRAGKLAEELTSEQIQMSKQCLYYVLSN |
| Ga0208257_10385141 | 3300025389 | Freshwater | MAYSGTVGTTVVTVQQFIDQGARLSGKLAEELTVEQVQG |
| Ga0208743_10539071 | 3300025390 | Freshwater | MAYSGTVGQTVITVSKLIDHGARRCGKLAEDLTSEQL |
| Ga0208874_10513811 | 3300025396 | Freshwater | MSTSGTVSQTVISVQQLIDHGARRAGKLAEELTDEQVA |
| Ga0208251_10010256 | 3300025398 | Freshwater | MSTSGTVSTTVVTVQNLIDSGARRAGKLAEELTSEQVAFS |
| Ga0208251_10429951 | 3300025398 | Freshwater | MAYSGTVGTTVVTVQNFIDQGARMSGKLAEELTVEQVQGSKQALFFILSNLINQGINYWA |
| Ga0208107_10412651 | 3300025399 | Freshwater | MAYSGTVGTTVVTVQQFIDQGARLSGKLAEELTVEQVQGSQQALFFVLSNLINQGINYWAINKQ |
| Ga0207955_100086813 | 3300025401 | Freshwater | MAYSGTVGQTVVTTQQMIDQGARMSGKLAEELTVEQIQASKQ |
| Ga0207955_10122345 | 3300025401 | Freshwater | MAYSGTVGQTVVTVQQFIDQGARLSGKLAEELTVEQVQASKQALFFSLSNLINQGINY |
| Ga0208381_10222213 | 3300025405 | Freshwater | MAYSGTVGQTVVTTQQMIDQGARMSGKLAEELTVEQIQASKQAL |
| Ga0208617_10699111 | 3300025424 | Freshwater | MAYSGTVGTTVVTVQQFIDQGARLSGKLAEELTVEQVQGSQQALFFVLSNLINQGINYWAINKQVYGFL |
| Ga0208618_10516621 | 3300025435 | Freshwater | MSTSGTVSQTVVSVQDLIDHGARRAGKLAEELTVEQVSAA |
| Ga0208742_10723642 | 3300025437 | Freshwater | MSTSGTVGQTVVSVQDLIDHGARRAGKLAEELTVEQVNAAKTSLY |
| Ga0208744_10137361 | 3300025450 | Freshwater | MTTSGTVSTTVVTVQNLIDSGARRAGKLAEELTSEEIFASK |
| Ga0208497_10446803 | 3300025466 | Freshwater | MAYSGTVGQTVITVQNFIDQGARLSGKLAEELTSEQVQGSKQALFFV |
| Ga0208507_10396791 | 3300025648 | Freshwater | MAYSGTVGQTVVTVQQFIDQGARLSGKLAEELTVEQV |
| Ga0208507_11383963 | 3300025648 | Freshwater | MSTSGTVSQTVVSVQDLIDHGARRAGKLAEELTVEQVSA |
| Ga0208795_11069634 | 3300025655 | Aqueous | MAYSGTVGTTVVSVQKLIDHGARRCGKLAEELTSEQVQA |
| Ga0208499_10092301 | 3300025789 | Freshwater | MTTSGTVGQTIISVQDLIDHGARRAGKLAEELTNEQVNAAKD |
| Ga0208499_10383423 | 3300025789 | Freshwater | MAYSGTIGQTVITVQNFIDQGARLSGKLAEELTSEQV |
| Ga0208872_11705761 | 3300025838 | Freshwater | MAYSGTVGTTVVTVQQFIDQGARLSGKLAEELTVEQVQGSQQALFFVLSNLINQGINYWAINKQV |
| Ga0208872_12264981 | 3300025838 | Freshwater | VAYSGTVGQTVVSVQNFIDQGARLSGKLAEELTNEQVQGAKQ |
| Ga0208872_12944851 | 3300025838 | Freshwater | MSYSGTVGNTVISVQTLIDHGARRAGKLAEELTDEQVQSAKESLFYILS |
| Ga0255269_10186024 | 3300026573 | Freshwater | MAYSGTVGRTVISVQNLIDDSARACGKLAEELTDEQ |
| Ga0208966_11083821 | 3300027586 | Freshwater Lentic | MSTSGTVGQTVITVQNLIDSGARRAGKLAEELTVEQIQA |
| Ga0208975_10661274 | 3300027659 | Freshwater Lentic | MSTSGTVGQTTITVQNLIDHGARRAGKLAEELTSEQVQ |
| Ga0209087_11494291 | 3300027734 | Freshwater Lake | MAYSGTVSNTVVNVQKLIDHGARRAGKLAEELTVEQVNAARESLYFVLSELVNTG |
| Ga0209085_10070968 | 3300027741 | Freshwater Lake | MAYSGTIGQTVISVQTLIDHGARRCGKLAEELTVEQVQSAKESLFFFLSNLADL |
| Ga0209085_11302153 | 3300027741 | Freshwater Lake | MATSGTVGETVITVQNLIDSGARRAGKLAEELSVEQVQAAKQSLYY |
| Ga0209085_12236482 | 3300027741 | Freshwater Lake | MATSGTTSTTIITVQDLIDDSARRAGKLAEELTVEQVQSA |
| Ga0209084_10467282 | 3300027749 | Freshwater Lake | MAYSGTVGQTVVPVQKFIDQGARMAGKLAEELTVEQVQAAKQALFFILRRCMG |
| Ga0209084_10500331 | 3300027749 | Freshwater Lake | MAYSGTVGQTVITVQQLIDHGARRCGKLAEELTSEQVASSKESL |
| Ga0209084_13137672 | 3300027749 | Freshwater Lake | MAYSGTVGTTVVTVQNFIDQGARLAGKLAEELTGEQVIAAKQALFFVLSNLINQGIN |
| Ga0209088_104257971 | 3300027763 | Freshwater Lake | MSTSGTVGQTVITVQNLIDSGARRAGKLAEELTVEQVQASKQSL |
| Ga0209829_101458824 | 3300027777 | Freshwater Lake | MAYSGTVGQTVVTVQNLIDNGARRAGKLAEELTVEQVQSAKQS |
| Ga0209829_103327832 | 3300027777 | Freshwater Lake | MAYSGTVGQTIITVQKLIDHGARRAGKLAEELTVEQVQAAKE |
| Ga0209354_100429574 | 3300027808 | Freshwater Lake | MSTSGTVGQTVITVQNLIDSGARRAGKLAEELTSEQVA |
| Ga0209354_101591223 | 3300027808 | Freshwater Lake | MSTSGAVGSTTISVQSLIDHGARRAGKLAEELTVEQVQAAKQSL |
| Ga0209230_105270051 | 3300027836 | Freshwater And Sediment | MSTSGTVGQTVITVQNLIDSGARRAGKLAEELTVEQIQASK |
| Ga0209777_106504663 | 3300027896 | Freshwater Lake Sediment | MSTSGTVSQTVISVQQLIDHGARRAGKLAEELTDEQVAASKDSLYYV |
| Ga0209777_106835911 | 3300027896 | Freshwater Lake Sediment | MAYSGTVGTTVVTVQQFIDQGARLSGKLAEELTVEQVQGSQQALFFVLSNLIN |
| Ga0209777_107189511 | 3300027896 | Freshwater Lake Sediment | VSNYSGTVGQTVVTVQNFIDQGARLSGKLAEELTSEQVQGSKQ |
| Ga0209253_103116251 | 3300027900 | Freshwater Lake Sediment | MTNGLNTSGTVGQTVISVQQLIDHGARRAGKLAEELTVEQVSAARDS |
| Ga0304728_11102651 | 3300028393 | Freshwater Lake | MAYSGTVGTTVINVQSLIDHGARRAGKLAEELTSEQV |
| Ga0315291_102480705 | 3300031707 | Sediment | MSTSGTVGQTTITVQNLIDHGARRAGKLAEELTSEQVSASKDSLY |
| Ga0316219_12040702 | 3300031759 | Freshwater | MSTSGTVSQTIITVQQLIDSGARRAGKLAEDLTSEQVNAATQSLYYLLSNLA |
| Ga0315909_101771921 | 3300031857 | Freshwater | MATSGTVGQTVISVQTLIDHGARRAGKLAEELTSEQVQSAKE |
| Ga0315285_107794292 | 3300031885 | Sediment | MSTSGTVGQTTITVQNLIDHGARRAGKLAEELTSE |
| Ga0315904_111002241 | 3300031951 | Freshwater | MAYSGTVGRTVISVQNLIDDGARACGKLAEELTDEQVTSA |
| Ga0315901_104998471 | 3300031963 | Freshwater | MAYSGTVGLTVVSVQDLIDHGARRSGKLAEELTSEQIYASKQSLFYLLSNLANIGINY |
| Ga0315272_102040583 | 3300032018 | Sediment | MAYSGTVGQTVISVQTLIDHGARRCGKLAEELSVE |
| Ga0315289_104618171 | 3300032046 | Sediment | MSTSGTVSQTTISVQQLIDHGARRAGKLAEELTVEQVQAAKESLYYLL |
| Ga0315289_115034091 | 3300032046 | Sediment | MAYSGTVGQTVITVQNLIDNGARRCGKLAEELTSEQVLSAKQS |
| Ga0315906_108927031 | 3300032050 | Freshwater | MAYSGTVGQTVISVQDLIDHGARRSGKLAEELTSEQI |
| Ga0316218_11737163 | 3300032117 | Freshwater | MAYSGTVGQTVITVQNFIDQGARLSGKLAEELTVEQVQGSKQAL |
| Ga0315268_106114681 | 3300032173 | Sediment | MSTSGTVGQTTITVQNLIDHGARRAGKLAEELTSEQVQSSK |
| Ga0316222_11689843 | 3300032561 | Freshwater | MAYSGTVGQTVVTTQQMIDQGARMSGKLAEELTVEQIQASKQALYYVLSNLI |
| Ga0316226_100745911 | 3300032562 | Freshwater | MAYSGTVGQTVVTVQNLIDDGARRAGKLAEELTVEQVQSAKQSL |
| Ga0316226_10758424 | 3300032562 | Freshwater | MAYSGTVGNTVISVQTLIDHGARRAGKLAEELTDEQVQSAKESL |
| Ga0316226_12231441 | 3300032562 | Freshwater | MAYSGTIDQTLITVQQFIDHGARRAGKLAEELSVEQVQS |
| Ga0316232_13582121 | 3300032605 | Freshwater | MSTSGTVSTTVVTVQNLIDSGARRAGKLAEELTSEQ |
| Ga0316221_10112531 | 3300032665 | Freshwater | MSTSGTVSTTVITVQQLIDHGARRAGKLAEELTVEQVSAAKDSLYYLLSSLANWGINY |
| Ga0316221_12132571 | 3300032665 | Freshwater | MSYSGTVGNTVISVQTLIDHGARRAGKLAEELTDEQVQSAKESL |
| Ga0316230_12756031 | 3300032668 | Freshwater | MSTSGTVGQTVVSVQDLIDHGARRAGKLAEELTVEQVNAAKT |
| Ga0316225_11836313 | 3300032675 | Freshwater | MAYSGTVGTTVVTVQNFIDQGARMSGKLAEELTSEQVQSSKQALFFILSNLINQGINYW |
| Ga0316229_12417891 | 3300032676 | Freshwater | MSTSGTVGQTVITVQQLIDSGARRAGKLAEELTSEQ |
| Ga0316227_10259465 | 3300032677 | Freshwater | MSTSGTVSTTVVTVQNLIDSGARRAGKLAEELTSEQIFAAKQSLYYLLS |
| Ga0316227_11345671 | 3300032677 | Freshwater | MSTSGTVSQTVITVQQLIDSGARRAGKLAEDLTVEQVNAATQSLYYLLSN |
| Ga0316227_11540094 | 3300032677 | Freshwater | MAYSGTVGQTVITVQNFIDQGARLSGKLAEELTSEQVQGSKQ |
| Ga0316227_12658241 | 3300032677 | Freshwater | MAYSGTVGQTVVTVQNFIDQGARLAGKLAEELTVEQVQGSKQAL |
| Ga0316231_10270291 | 3300032722 | Freshwater | MSTSGTVSQTVISVQDLIDHGARRAGKLAEELTVEQVNAAKTS |
| Ga0334998_0371361_722_829 | 3300034019 | Freshwater | MAYSGTVGTTVIQVQTLIDHGARRAGKLAEELTSEQ |
| Ga0335019_0149194_1_126 | 3300034066 | Freshwater | MSTSGTVSQTTISVQQLIDHGARRAGKLAEELTVEQVQAAKE |
| Ga0335036_0728738_471_581 | 3300034106 | Freshwater | MSTSGTVGTTVVNVQKFIDHGARRCGKLAEELTSEQV |
| Ga0335068_0484562_410_574 | 3300034116 | Freshwater | MSTSGTVSQTTISVQQLIDHGARRAGKLAEELTVEQVQAAKESLYYLLSSLSNYG |
| Ga0335053_0462229_2_133 | 3300034118 | Freshwater | MAFSGTVGQTVINVQTLIDHGARRCGKLAEELTSEQVLSARQSL |
| Ga0348335_145147_2_118 | 3300034374 | Aqueous | MTTSGTYGTTVINVQEFIDKGARRAGKLAEELTSEQVAT |
| ⦗Top⦘ |