Metagenome / Metatranscriptome Family F023290

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F023290
Family Type	Metagenome / Metatranscriptome
Number of Sequences	210
Average Sequence Length	39 residues
Representative Sequence	MFHLVEVLAASPVWLGLCGAGLTVAPIMGIMLIHRNK
Number of Associated Samples	104
Number of Associated Scaffolds	210

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	80.50 %
% of genes near scaffold ends (potentially truncated)	15.24 %
% of genes from short scaffolds (< 2000 bps)	47.62 %
Associated GOLD sequencing projects	98
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (36.667 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (28.571 % of family members)
Environment Ontology (ENVO)	Unclassified (46.190 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (50.000 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 210 Family Scaffolds
PF02604	PhdYeFM_antitox	10.95
PF01786	AOX	7.14
PF16363	GDP_Man_Dehyd	6.67
PF00210	Ferritin	5.24
PF01370	Epimerase	3.81
PF00393	6PGD	3.33
PF13640	2OG-FeII_Oxy_3	3.33
PF00462	Glutaredoxin	2.38
PF00565	SNase	1.90
PF07484	Collar	1.43
PF01844	HNH	1.43
PF03016	Exostosin	0.95
PF03446	NAD_binding_2	0.95
PF03407	Nucleotid_trans	0.95
PF04820	Trp_halogenase	0.95
PF06210	DUF1003	0.95
PF04966	OprB	0.95
PF01531	Glyco_transf_11	0.48
PF00111	Fer2	0.48
PF01467	CTP_transf_like	0.48
PF00124	Photo_RC	0.48
PF00268	Ribonuc_red_sm	0.48
PF13884	Peptidase_S74	0.48
PF12849	PBP_like_2	0.48
PF08534	Redoxin	0.48
PF02672	CP12	0.48
PF00685	Sulfotransfer_1	0.48
PF02543	Carbam_trans_N	0.48
PF16861	Carbam_trans_C	0.48
PF03330	DPBB_1	0.48
PF03734	YkuD	0.48
PF00984	UDPG_MGDP_dh	0.48
PF03237	Terminase_6N	0.48
PF05050	Methyltransf_21	0.48
PF02540	NAD_synthase	0.48
PF13186	SPASM	0.48
PF13759	2OG-FeII_Oxy_5	0.48
PF01041	DegT_DnrJ_EryC1	0.48
PF00386	C1q	0.48
PF00127	Copper-bind	0.48
PF03414	Glyco_transf_6	0.48
PF07728	AAA_5	0.48
PF00149	Metallophos	0.48
PF14393	DUF4422	0.48
PF02562	PhoH	0.48

COG ID	Name	Functional Category	% Frequency in 210 Family Scaffolds
COG4118	Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor	Defense mechanisms [V]	10.95
COG2161	Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family	Defense mechanisms [V]	10.95
COG0362	6-phosphogluconate dehydrogenase	Carbohydrate transport and metabolism [G]	3.33
COG1023	6-phosphogluconate dehydrogenase (decarboxylating)	Carbohydrate transport and metabolism [G]	3.33
COG4420	Uncharacterized membrane protein	Function unknown [S]	0.95
COG3659	Carbohydrate-selective porin OprB	Cell wall/membrane/envelope biogenesis [M]	0.95
COG1104	Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family	Amino acid transport and metabolism [E]	0.48
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.48
COG2873	O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent	Amino acid transport and metabolism [E]	0.48
COG2192	Predicted carbamoyl transferase, NodU family	General function prediction only [R]	0.48
COG1875	Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains	General function prediction only [R]	0.48
COG1702	Phosphate starvation-inducible protein PhoH, predicted ATPase	Signal transduction mechanisms [T]	0.48
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.48
COG0171	NH3-dependent NAD+ synthetase	Coenzyme transport and metabolism [H]	0.48
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.48
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.48
COG0626	Cystathionine beta-lyase/cystathionine gamma-synthase	Amino acid transport and metabolism [E]	0.48
COG0520	Selenocysteine lyase/Cysteine desulfurase	Amino acid transport and metabolism [E]	0.48
COG0436	Aspartate/methionine/tyrosine aminotransferase	Amino acid transport and metabolism [E]	0.48
COG0399	dTDP-4-amino-4,6-dideoxygalactose transaminase	Cell wall/membrane/envelope biogenesis [M]	0.48
COG0208	Ribonucleotide reductase beta subunit, ferritin-like domain	Nucleotide transport and metabolism [F]	0.48

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	63.33 %
Unclassified	root	N/A	36.67 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	58.57 %
Unclassified	root	N/A	36.67 %
cellular organisms	root	All Organisms → cellular organisms	4.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	31.43 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	22.86 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	4.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	31.43 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	22.86 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.43 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	31.43 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	22.86 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.43 %
Oligoflexia	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	31.43 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	22.86 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.43 %
Bdellovibrionales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	31.43 %
Kyanoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae	9.05 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	8.57 %
Vequintavirinae	subfamily	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vequintavirinae	1.43 %
Eneladusvirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Eneladusvirus	0.48 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.48 %
unclassified Bdellovibrionales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales	0.48 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	31.43 %
Myoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	7.62 %
unclassified Kyanoviridae	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae	5.71 %
Charybdisvirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Charybdisvirus	1.43 %
Vequintavirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vequintavirinae → Vequintavirus	1.43 %
Autographiviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae	0.48 %
Shandvirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus	0.48 %
Eneladusvirus BF	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Eneladusvirus → Eneladusvirus BF	0.48 %
Bdellovibrionales bacterium GWB1_55_8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium GWB1_55_8	0.48 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.48 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	31.43 %
Synechococcus phage S-SRM01	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	5.71 %
unclassified Vequintavirus	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vequintavirinae → Vequintavirus → unclassified Vequintavirus	1.43 %
Charybdisvirus scam3	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Charybdisvirus → Charybdisvirus scam3	1.43 %
Cymopoleiavirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus	0.48 %
Spirosomaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae	0.48 %
Autographiviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae	0.48 %
Shandvirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus	0.48 %
Eneladusvirus BF	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Eneladusvirus → Eneladusvirus BF	0.48 %
Bdellovibrionales bacterium GWB1_55_8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium GWB1_55_8	0.48 %
unclassified Myoviridae	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae	0.95 %
Crocinitomicaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	31.43 %
Synechococcus phage S-SRM01	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	5.71 %
Escherichia phage navn	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vequintavirinae → Vequintavirus → unclassified Vequintavirus → Escherichia phage navn	1.43 %
Charybdisvirus scam3	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Charybdisvirus → Charybdisvirus scam3	1.43 %
unclassified Cymopoleiavirus	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus → unclassified Cymopoleiavirus	0.48 %
Fibrella	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Fibrella	0.48 %
Autographiviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae	0.48 %
Shandvirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus	0.48 %
Eneladusvirus BF	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Eneladusvirus → Eneladusvirus BF	0.48 %
Bdellovibrionales bacterium GWB1_55_8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium GWB1_55_8	0.48 %
unclassified Crocinitomicaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae	0.95 %
Synechococcus phage S-CBM2	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	31.43 %
Synechococcus phage S-SRM01	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	5.71 %
Escherichia phage navn	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vequintavirinae → Vequintavirus → unclassified Vequintavirus → Escherichia phage navn	1.43 %
Charybdisvirus scam3	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Charybdisvirus → Charybdisvirus scam3	1.43 %
unclassified Fibrella	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Fibrella → unclassified Fibrella	0.48 %
Synechococcus phage S-RSM4	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus → unclassified Cymopoleiavirus → Synechococcus phage S-RSM4	0.48 %
Autographiviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae	0.48 %
Shandvirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus	0.48 %
Eneladusvirus BF	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Eneladusvirus → Eneladusvirus BF	0.48 %
Bdellovibrionales bacterium GWB1_55_8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium GWB1_55_8	0.48 %
Crocinitomicaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium	0.95 %
Synechococcus phage S-CBM2	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	31.43 %
Synechococcus phage S-SRM01	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	5.71 %
Escherichia phage navn	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vequintavirinae → Vequintavirus → unclassified Vequintavirus → Escherichia phage navn	1.43 %
Charybdisvirus scam3	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Charybdisvirus → Charybdisvirus scam3	1.43 %
Fibrella sp. ES10-3-2-2	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Fibrella → unclassified Fibrella → Fibrella sp. ES10-3-2-2	0.48 %
Synechococcus phage S-RSM4	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus → unclassified Cymopoleiavirus → Synechococcus phage S-RSM4	0.48 %
Autographiviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae	0.48 %
Shandvirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus	0.48 %
Eneladusvirus BF	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Eneladusvirus → Eneladusvirus BF	0.48 %
Bdellovibrionales bacterium GWB1_55_8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium GWB1_55_8	0.48 %
Crocinitomicaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium	0.95 %
Synechococcus phage S-CBM2	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2	0.95 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001846\|ACM22_1136422	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	571	Open in IMG/M
3300001847\|RCM41_1134259	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus	706	Open in IMG/M
3300001968\|GOS2236_1030255	Not Available	902	Open in IMG/M
3300001968\|GOS2236_1083199	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	1536	Open in IMG/M
3300001968\|GOS2236_1085633	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae	1644	Open in IMG/M
3300002040\|GOScombined01_102474852	All Organisms → Viruses → Predicted Viral	2969	Open in IMG/M
3300002835\|B570J40625_100000534	Not Available	64310	Open in IMG/M
3300002835\|B570J40625_101215336	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	630	Open in IMG/M
3300002835\|B570J40625_101617495	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Fibrella → unclassified Fibrella → Fibrella sp. ES10-3-2-2	529	Open in IMG/M
3300004240\|Ga0007787_10154761	Not Available	1102	Open in IMG/M
3300004369\|Ga0065726_13367	Not Available	20114	Open in IMG/M
3300005527\|Ga0068876_10104998	All Organisms → Viruses → Predicted Viral	1683	Open in IMG/M
3300005528\|Ga0068872_10687997	Not Available	537	Open in IMG/M
3300005581\|Ga0049081_10000664	Not Available	13066	Open in IMG/M
3300005805\|Ga0079957_1017398	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5132	Open in IMG/M
3300005805\|Ga0079957_1107694	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae	1503	Open in IMG/M
3300005805\|Ga0079957_1211491	Not Available	927	Open in IMG/M
3300005940\|Ga0073913_10003649	All Organisms → Viruses → Predicted Viral	2035	Open in IMG/M
3300006026\|Ga0075478_10000152	Not Available	24206	Open in IMG/M
3300006810\|Ga0070754_10045564	All Organisms → Viruses	2348	Open in IMG/M
3300006875\|Ga0075473_10181989	Not Available	847	Open in IMG/M
3300007538\|Ga0099851_1039060	All Organisms → Viruses → Predicted Viral	1883	Open in IMG/M
3300007541\|Ga0099848_1012446	All Organisms → Viruses → Predicted Viral	3735	Open in IMG/M
3300007541\|Ga0099848_1019539	All Organisms → Viruses → Predicted Viral	2903	Open in IMG/M
3300007541\|Ga0099848_1049098	All Organisms → Viruses → Predicted Viral	1705	Open in IMG/M
3300007541\|Ga0099848_1250819	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Charybdisvirus → Charybdisvirus scam3	619	Open in IMG/M
3300007541\|Ga0099848_1282278	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	574	Open in IMG/M
3300007545\|Ga0102873_1233817	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	551	Open in IMG/M
3300007551\|Ga0102881_1173100	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	597	Open in IMG/M
3300007634\|Ga0102901_1178989	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	599	Open in IMG/M
3300007735\|Ga0104988_10472	All Organisms → Viruses	15845	Open in IMG/M
3300007960\|Ga0099850_1064722	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Eneladusvirus → Eneladusvirus BF	1540	Open in IMG/M
3300008107\|Ga0114340_1010907	All Organisms → Viruses → Predicted Viral	4514	Open in IMG/M
3300008108\|Ga0114341_10135703	All Organisms → Viruses → Predicted Viral	1449	Open in IMG/M
3300008113\|Ga0114346_1002946	Not Available	12937	Open in IMG/M
3300008113\|Ga0114346_1039642	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	2418	Open in IMG/M
3300008113\|Ga0114346_1072500	All Organisms → Viruses → Predicted Viral	1647	Open in IMG/M
3300008113\|Ga0114346_1294764	All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium GWB1_55_8	563	Open in IMG/M
3300008120\|Ga0114355_1000762	Not Available	30681	Open in IMG/M
3300008262\|Ga0114337_1011389	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus → unclassified Cymopoleiavirus → Synechococcus phage S-RSM4	6542	Open in IMG/M
3300009009\|Ga0105105_10001396	Not Available	10253	Open in IMG/M
3300009085\|Ga0105103_10576391	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	638	Open in IMG/M
3300009221\|Ga0103849_1012670	All Organisms → cellular organisms → Bacteria	1015	Open in IMG/M
3300009228\|Ga0103854_1000442	All Organisms → cellular organisms → Bacteria	3185	Open in IMG/M
3300009230\|Ga0103855_10001153	All Organisms → cellular organisms → Bacteria	3281	Open in IMG/M
3300009466\|Ga0126448_1000618	Not Available	10669	Open in IMG/M
3300009470\|Ga0126447_1101747	Not Available	701	Open in IMG/M
3300010293\|Ga0116204_1049050	All Organisms → Viruses → Predicted Viral	1577	Open in IMG/M
3300010296\|Ga0129348_1334700	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Charybdisvirus → Charybdisvirus scam3	503	Open in IMG/M
3300010318\|Ga0136656_1027503	All Organisms → Viruses → Predicted Viral	2066	Open in IMG/M
3300010354\|Ga0129333_10002085	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	18502	Open in IMG/M
3300010354\|Ga0129333_10002162	All Organisms → Viruses	18183	Open in IMG/M
3300010354\|Ga0129333_10008058	All Organisms → cellular organisms → Bacteria	9931	Open in IMG/M
3300010354\|Ga0129333_10009821	Not Available	9038	Open in IMG/M
3300010354\|Ga0129333_10019130	Not Available	6515	Open in IMG/M
3300010354\|Ga0129333_10033375	Not Available	4861	Open in IMG/M
3300010354\|Ga0129333_10055574	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2	3699	Open in IMG/M
3300010354\|Ga0129333_10061226	All Organisms → Viruses → Predicted Viral	3508	Open in IMG/M
3300010354\|Ga0129333_10104622	All Organisms → Viruses → Predicted Viral	2614	Open in IMG/M
3300010354\|Ga0129333_10160809	Not Available	2058	Open in IMG/M
3300010354\|Ga0129333_10238297	All Organisms → Viruses → Predicted Viral	1644	Open in IMG/M
3300010354\|Ga0129333_10357771	Not Available	1298	Open in IMG/M
3300010354\|Ga0129333_10378475	All Organisms → Viruses → Predicted Viral	1256	Open in IMG/M
3300010354\|Ga0129333_10477909	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	1095	Open in IMG/M
3300010354\|Ga0129333_10489525	All Organisms → Viruses → Predicted Viral	1079	Open in IMG/M
3300010354\|Ga0129333_10635277	Not Available	923	Open in IMG/M
3300010354\|Ga0129333_10690659	Not Available	878	Open in IMG/M
3300010354\|Ga0129333_10912093	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	743	Open in IMG/M
3300010354\|Ga0129333_11154302	Not Available	645	Open in IMG/M
3300010354\|Ga0129333_11619797	Not Available	528	Open in IMG/M
3300010354\|Ga0129333_11663742	Not Available	520	Open in IMG/M
3300010370\|Ga0129336_10121567	All Organisms → Viruses → Predicted Viral	1521	Open in IMG/M
3300010370\|Ga0129336_10323020	Not Available	854	Open in IMG/M
3300010389\|Ga0136549_10023776	All Organisms → Viruses → Predicted Viral	3602	Open in IMG/M
3300010389\|Ga0136549_10036251	All Organisms → Viruses → Predicted Viral	2693	Open in IMG/M
3300012000\|Ga0119951_1016127	All Organisms → Viruses → Predicted Viral	2816	Open in IMG/M
3300012000\|Ga0119951_1045822	All Organisms → Viruses → Predicted Viral	1285	Open in IMG/M
(restricted) 3300013123\|Ga0172368_10120746	Not Available	1477	Open in IMG/M
(restricted) 3300013125\|Ga0172369_10145070	All Organisms → Viruses → Predicted Viral	1448	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10154129	All Organisms → Viruses → Predicted Viral	1512	Open in IMG/M
(restricted) 3300013128\|Ga0172366_10439301	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	789	Open in IMG/M
(restricted) 3300013130\|Ga0172363_10083365	All Organisms → Viruses → Predicted Viral	2265	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10212839	All Organisms → Viruses → Predicted Viral	1305	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10012199	Not Available	10800	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10677620	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vequintavirinae → Vequintavirus → unclassified Vequintavirus → Escherichia phage navn	654	Open in IMG/M
(restricted) 3300013136\|Ga0172370_10086859	All Organisms → Viruses → Predicted Viral	2281	Open in IMG/M
3300020074\|Ga0194113_10002981	Not Available	22864	Open in IMG/M
3300020074\|Ga0194113_10012454	Not Available	9974	Open in IMG/M
3300020074\|Ga0194113_10028007	Not Available	5969	Open in IMG/M
3300020074\|Ga0194113_10044362	All Organisms → Viruses → Predicted Viral	4403	Open in IMG/M
3300020074\|Ga0194113_10125219	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2	2186	Open in IMG/M
3300020074\|Ga0194113_10430177	Not Available	962	Open in IMG/M
3300020074\|Ga0194113_10458746	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	923	Open in IMG/M
3300020074\|Ga0194113_10582674	Not Available	791	Open in IMG/M
3300020083\|Ga0194111_10109308	Not Available	2198	Open in IMG/M
3300020083\|Ga0194111_10609437	Not Available	683	Open in IMG/M
3300020084\|Ga0194110_10196574	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	1526	Open in IMG/M
3300020109\|Ga0194112_10004728	Not Available	18533	Open in IMG/M
3300020109\|Ga0194112_10222250	All Organisms → Viruses → Predicted Viral	1504	Open in IMG/M
3300020109\|Ga0194112_10449263	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	917	Open in IMG/M
3300020109\|Ga0194112_10501460	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vequintavirinae → Vequintavirus → unclassified Vequintavirus → Escherichia phage navn	850	Open in IMG/M
3300020151\|Ga0211736_10745845	Not Available	5109	Open in IMG/M
3300020151\|Ga0211736_10980101	All Organisms → Viruses → Predicted Viral	2320	Open in IMG/M
3300020161\|Ga0211726_10400216	All Organisms → Viruses → Predicted Viral	2523	Open in IMG/M
3300020179\|Ga0194134_10065662	All Organisms → Viruses → Predicted Viral	1915	Open in IMG/M
3300020179\|Ga0194134_10079724	All Organisms → Viruses → Predicted Viral	1672	Open in IMG/M
3300020179\|Ga0194134_10102160	All Organisms → Viruses → Predicted Viral	1401	Open in IMG/M
3300020179\|Ga0194134_10220557	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	798	Open in IMG/M
3300020183\|Ga0194115_10053102	Not Available	2544	Open in IMG/M
3300020183\|Ga0194115_10058263	All Organisms → Viruses → Predicted Viral	2378	Open in IMG/M
3300020183\|Ga0194115_10062680	Not Available	2256	Open in IMG/M
3300020183\|Ga0194115_10074029	All Organisms → Viruses → Predicted Viral	2005	Open in IMG/M
3300020183\|Ga0194115_10088469	All Organisms → Viruses → Predicted Viral	1767	Open in IMG/M
3300020183\|Ga0194115_10125866	All Organisms → Viruses → Predicted Viral	1377	Open in IMG/M
3300020183\|Ga0194115_10152188	All Organisms → Viruses → Predicted Viral	1202	Open in IMG/M
3300020183\|Ga0194115_10177330	Not Available	1077	Open in IMG/M
3300020183\|Ga0194115_10193938	Not Available	1009	Open in IMG/M
3300020183\|Ga0194115_10250128	Not Available	838	Open in IMG/M
3300020183\|Ga0194115_10268849	Not Available	795	Open in IMG/M
3300020183\|Ga0194115_10345239	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	660	Open in IMG/M
3300020183\|Ga0194115_10369742	Not Available	627	Open in IMG/M
3300020190\|Ga0194118_10070843	All Organisms → Viruses → Predicted Viral	2211	Open in IMG/M
3300020190\|Ga0194118_10085923	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium	1958	Open in IMG/M
3300020190\|Ga0194118_10178683	Not Available	1224	Open in IMG/M
3300020196\|Ga0194124_10226082	Not Available	947	Open in IMG/M
3300020197\|Ga0194128_10011606	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	10178	Open in IMG/M
3300020204\|Ga0194116_10076068	All Organisms → Viruses → Predicted Viral	2236	Open in IMG/M
3300020204\|Ga0194116_10347787	Not Available	756	Open in IMG/M
3300020220\|Ga0194119_10013912	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	9950	Open in IMG/M
3300020220\|Ga0194119_10108286	Not Available	2172	Open in IMG/M
3300020220\|Ga0194119_10129989	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae	1909	Open in IMG/M
3300020220\|Ga0194119_10641230	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium	648	Open in IMG/M
3300020222\|Ga0194125_10061886	All Organisms → Viruses → Predicted Viral	3468	Open in IMG/M
3300020222\|Ga0194125_10092857	Not Available	2551	Open in IMG/M
3300020530\|Ga0208235_1000049	Not Available	36399	Open in IMG/M
3300020578\|Ga0194129_10281276	Not Available	946	Open in IMG/M
3300021091\|Ga0194133_10003938	Not Available	20486	Open in IMG/M
3300021091\|Ga0194133_10009380	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	11210	Open in IMG/M
3300021091\|Ga0194133_10099862	All Organisms → Viruses → Predicted Viral	2231	Open in IMG/M
3300021091\|Ga0194133_10127204	All Organisms → Viruses → Predicted Viral	1875	Open in IMG/M
3300021093\|Ga0194123_10028489	All Organisms → Viruses	4098	Open in IMG/M
3300021376\|Ga0194130_10025313	All Organisms → cellular organisms → Bacteria	4810	Open in IMG/M
3300021376\|Ga0194130_10307523	Not Available	877	Open in IMG/M
3300021376\|Ga0194130_10671054	Not Available	505	Open in IMG/M
3300021961\|Ga0222714_10224703	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vequintavirinae → Vequintavirus → unclassified Vequintavirus → Escherichia phage navn	1068	Open in IMG/M
3300021962\|Ga0222713_10019298	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5771	Open in IMG/M
3300021962\|Ga0222713_10020050	Not Available	5643	Open in IMG/M
3300021962\|Ga0222713_10043883	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae	3472	Open in IMG/M
3300021962\|Ga0222713_10117865	All Organisms → Viruses	1875	Open in IMG/M
3300021963\|Ga0222712_10060167	All Organisms → Viruses → Predicted Viral	2790	Open in IMG/M
3300021963\|Ga0222712_10083856	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	2271	Open in IMG/M
3300021963\|Ga0222712_10783325	Not Available	527	Open in IMG/M
3300022198\|Ga0196905_1002107	Not Available	7487	Open in IMG/M
3300022198\|Ga0196905_1003344	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	5883	Open in IMG/M
3300022198\|Ga0196905_1013213	All Organisms → Viruses	2685	Open in IMG/M
3300022198\|Ga0196905_1014591	All Organisms → Viruses	2537	Open in IMG/M
3300022200\|Ga0196901_1022659	All Organisms → Viruses → Predicted Viral	2516	Open in IMG/M
3300022200\|Ga0196901_1058148	All Organisms → Viruses → Predicted Viral	1427	Open in IMG/M
3300022752\|Ga0214917_10027494	All Organisms → Viruses → Predicted Viral	4387	Open in IMG/M
3300022752\|Ga0214917_10357110	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Charybdisvirus → Charybdisvirus scam3	622	Open in IMG/M
3300024239\|Ga0247724_1000383	All Organisms → cellular organisms → Bacteria	10566	Open in IMG/M
3300024239\|Ga0247724_1001101	Not Available	5427	Open in IMG/M
3300024343\|Ga0244777_10386553	All Organisms → Viruses	873	Open in IMG/M
3300024348\|Ga0244776_10101317	Not Available	2153	Open in IMG/M
3300024348\|Ga0244776_10230987	All Organisms → Viruses → Predicted Viral	1297	Open in IMG/M
3300025610\|Ga0208149_1000506	Not Available	14985	Open in IMG/M
3300025646\|Ga0208161_1001295	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	13433	Open in IMG/M
3300027499\|Ga0208788_1010438	All Organisms → Viruses → Predicted Viral	3401	Open in IMG/M
3300027608\|Ga0208974_1027384	All Organisms → Viruses → Predicted Viral	1736	Open in IMG/M
3300027762\|Ga0209288_10000010	All Organisms → Viruses	71431	Open in IMG/M
3300027793\|Ga0209972_10437926	Not Available	548	Open in IMG/M
3300027816\|Ga0209990_10002115	Not Available	15908	Open in IMG/M
3300029930\|Ga0119944_1000634	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	6265	Open in IMG/M
3300029930\|Ga0119944_1001772	All Organisms → Viruses → Predicted Viral	3793	Open in IMG/M
3300029930\|Ga0119944_1002773	All Organisms → Viruses → Predicted Viral	2978	Open in IMG/M
3300029930\|Ga0119944_1004485	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2281	Open in IMG/M
3300029930\|Ga0119944_1008411	All Organisms → Viruses → Predicted Viral	1590	Open in IMG/M
3300029930\|Ga0119944_1012752	All Organisms → Viruses → Predicted Viral	1229	Open in IMG/M
3300029930\|Ga0119944_1015775	All Organisms → Viruses → Predicted Viral	1073	Open in IMG/M
3300029930\|Ga0119944_1018829	Not Available	954	Open in IMG/M
3300029933\|Ga0119945_1003240	All Organisms → Viruses → Predicted Viral	2340	Open in IMG/M
3300029933\|Ga0119945_1020905	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	781	Open in IMG/M
3300031784\|Ga0315899_10164311	All Organisms → Viruses → Predicted Viral	2257	Open in IMG/M
3300031787\|Ga0315900_10042212	All Organisms → Viruses → Predicted Viral	4913	Open in IMG/M
3300031857\|Ga0315909_10934653	Not Available	531	Open in IMG/M
3300032093\|Ga0315902_10008890	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	13532	Open in IMG/M
3300032093\|Ga0315902_10238172	All Organisms → Viruses → Predicted Viral	1783	Open in IMG/M
3300032093\|Ga0315902_10311326	All Organisms → Viruses → Predicted Viral	1482	Open in IMG/M
3300033521\|Ga0316616_104150012	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	545	Open in IMG/M
3300033557\|Ga0316617_100099409	All Organisms → Viruses → Predicted Viral	2046	Open in IMG/M
3300033978\|Ga0334977_0053957	All Organisms → Viruses → Predicted Viral	2229	Open in IMG/M
3300033981\|Ga0334982_0134662	All Organisms → Viruses → Predicted Viral	1272	Open in IMG/M
3300034071\|Ga0335028_0547031	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01	632	Open in IMG/M
3300034073\|Ga0310130_0001202	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	14783	Open in IMG/M
3300034073\|Ga0310130_0015041	All Organisms → Viruses → Predicted Viral	2571	Open in IMG/M
3300034102\|Ga0335029_0000628	Not Available	28224	Open in IMG/M
3300034103\|Ga0335030_0005077	Not Available	10202	Open in IMG/M
3300034106\|Ga0335036_0001516	Not Available	20538	Open in IMG/M
3300034112\|Ga0335066_0000153	Not Available	45427	Open in IMG/M
3300034283\|Ga0335007_0045618	All Organisms → Viruses → Predicted Viral	3395	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	96.19%
Terrestrial	Environmental → Terrestrial	3.81%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	63.81%
Marine	Environmental → Aquatic → Marine	30.00%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	2.38%
Soil	Environmental → Terrestrial → Soil	1.43%
Sediment	Environmental → Aquatic → Sediment	0.95%
Unclassified	Environmental → Aquatic → Unclassified	0.95%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	0.48%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	46.67%
Coastal	Environmental → Aquatic → Marine → Coastal	20.95%
Lentic	Environmental → Aquatic → Freshwater → Lentic	5.71%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	4.76%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	4.76%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	4.29%
Unclassified	Environmental → Aquatic → Marine → Unclassified	3.81%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	2.38%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.90%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.95%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.95%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.95%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.48%
Oceanic	Environmental → Aquatic → Marine → Oceanic	0.48%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	0.48%
Sand	Environmental → Terrestrial → Soil → Sand	0.48%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	45.71%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	20.95%
Unclassified	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified	4.76%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	4.29%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	3.81%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	3.81%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	2.86%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	2.38%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.90%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	1.90%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	1.90%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.95%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.95%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.95%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.95%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.48%
Unclassified	Environmental → Aquatic → Marine → Oceanic → Unclassified	0.48%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	0.48%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.48%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	28.57%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	11.90%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	9.05%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	8.10%
Aquatic	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic	4.76%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	3.81%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	3.81%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	3.33%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	2.86%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	2.86%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	2.38%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.90%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	1.90%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine	1.90%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	1.43%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	1.43%
River Water	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water	1.43%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.95%
Marine Methane Seep Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment	0.95%
Meromictic Pond	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond	0.95%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.95%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	0.95%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.95%
Anoxic Lake Water	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water	0.48%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	0.48%
Marine Plankton	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton	0.48%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline	0.48%
Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Sand	0.48%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.48%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001846	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25b	Environmental	Open in IMG/M
3300001847	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a	Environmental	Open in IMG/M
3300001968	Marine microbial communities from Lake Gatun, Panama - GS020	Environmental	Open in IMG/M
3300002040	GS000c - Sargasso Station 3	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300004240	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN	Environmental	Open in IMG/M
3300004369	Saline microbial communities from the South Caspian sea - cas-15	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300005940	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14	Environmental	Open in IMG/M
3300006026	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA	Environmental	Open in IMG/M
3300006810	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01	Environmental	Open in IMG/M
3300006875	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA	Environmental	Open in IMG/M
3300007538	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG	Environmental	Open in IMG/M
3300007541	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG	Environmental	Open in IMG/M
3300007545	Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3	Environmental	Open in IMG/M
3300007551	Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3	Environmental	Open in IMG/M
3300007634	Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02	Environmental	Open in IMG/M
3300007735	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct	Environmental	Open in IMG/M
3300007960	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008120	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA	Environmental	Open in IMG/M
3300008262	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA	Environmental	Open in IMG/M
3300009009	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009221	Microbial communities of water from Amazon river, Brazil - RCM2	Environmental	Open in IMG/M
3300009228	Microbial communities of water from Amazon river, Brazil - RCM7	Environmental	Open in IMG/M
3300009230	Microbial communities of water from Amazon river, Brazil - RCM8	Environmental	Open in IMG/M
3300009466	Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD	Environmental	Open in IMG/M
3300009470	Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD	Environmental	Open in IMG/M
3300010293	Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG	Environmental	Open in IMG/M
3300010296	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA	Environmental	Open in IMG/M
3300010318	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010370	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA	Environmental	Open in IMG/M
3300010389	Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf	Environmental	Open in IMG/M
3300012000	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A	Environmental	Open in IMG/M
3300013123 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m	Environmental	Open in IMG/M
3300013125 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m	Environmental	Open in IMG/M
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental	Open in IMG/M
3300013128 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm	Environmental	Open in IMG/M
3300013130 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2	Environmental	Open in IMG/M
3300013131 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m	Environmental	Open in IMG/M
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental	Open in IMG/M
3300013136 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental	Open in IMG/M
3300020083	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m	Environmental	Open in IMG/M
3300020084	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m	Environmental	Open in IMG/M
3300020109	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020179	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m	Environmental	Open in IMG/M
3300020183	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface	Environmental	Open in IMG/M
3300020190	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface	Environmental	Open in IMG/M
3300020196	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m	Environmental	Open in IMG/M
3300020197	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m	Environmental	Open in IMG/M
3300020200	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m	Environmental	Open in IMG/M
3300020204	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface	Environmental	Open in IMG/M
3300020220	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m	Environmental	Open in IMG/M
3300020222	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m	Environmental	Open in IMG/M
3300020530	Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020578	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m	Environmental	Open in IMG/M
3300021091	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m	Environmental	Open in IMG/M
3300021093	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface	Environmental	Open in IMG/M
3300021376	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022198	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)	Environmental	Open in IMG/M
3300022200	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300024239	Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E	Environmental	Open in IMG/M
3300024343	Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300025610	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025646	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)	Environmental	Open in IMG/M
3300027499	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027762	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027816	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300029930	Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727	Environmental	Open in IMG/M
3300029933	Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300032093	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117	Environmental	Open in IMG/M
3300033521	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B	Environmental	Open in IMG/M
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300034071	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110	Environmental	Open in IMG/M
3300034073	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034103	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental	Open in IMG/M
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
ACM22_11364221	3300001846	Marine Plankton	MIFHIVEALAKSQIWLGMCGFGLIIAPIIGIQLIHNNK*
RCM41_11342591	3300001847	Marine Plankton	MLNHLVEALAASQIWLGLCGFGIIILPVIGIWAIHK
GOS2236_10302553	3300001968	Marine	MFHLVETLAGSQIWIGLCGFGIIVLPILGIMFIHDKK*
GOS2236_10831996	3300001968	Marine	MIFHIVEALAASPVWLGLCGGGLIIPPIIGIMLIHRSPKNNN*
GOS2236_10856335	3300001968	Marine	MFHLVEVLAASPIWLGACGFGIIVLPIMGIAFIHNTKEKT*
GOScombined01_1024748522	3300002040	Marine	MNMLFHLVEFLAGSKIWLGLCGFGVIVVPIMGIQYIYNKHKNDT*
B570J40625_10000053472	3300002835	Freshwater	MIFHIVEYLAQSPVWLGLCGAGLTVAPIMGIMLIHKQNGK*
B570J40625_1012153362	3300002835	Freshwater	MIFHIVETLAESPIWLGACGFGIIVVPIMGIAFIHNKIK*
B570J40625_1016174951	3300002835	Freshwater	ICKMIFHIVEYLAHSPVWLFICGMGLTTVPIMGIMFIHRTK*
Ga0007787_101547614	3300004240	Freshwater Lake	MFHLVEVLAASPIWIGACGFGIIVLPIMGIAFIHNKEKKQS*
Ga0065726_1336715	3300004369	Saline	MIFHIVEALASSPIWIGMCGFGLIFVPILGIAFIHNKEKQEKKD*
Ga0068876_101049983	3300005527	Freshwater Lake	MIFHIVEALADSPIWLGLCGAGLTIAPIIGIMIIHRSPKK*
Ga0068872_106879972	3300005528	Freshwater Lake	MTFFQVIEFLAASPIWLGLCGFGIIVVPILGIMVIHNNNH*
Ga0049081_1000066420	3300005581	Freshwater Lentic	MFHLVEVLAASQLWLGLCGAGLTVAPILGIMLIHRTK*
Ga0049081_100964565	3300005581	Freshwater Lentic	MFHLVEALAASQIWLGLCGMGLTIIPILGIIAVHSKKDNGA*
Ga0079957_10173989	3300005805	Lake	MIFHIVEALAASPIWIGLCGAGLTIAPIMGIMLIHRTK*
Ga0079957_11076943	3300005805	Lake	MIFHLVETLAASPVWLGLCGFGIIVVPIIGISFIHSNKK*
Ga0079957_12114912	3300005805	Lake	MIFRIVEALASSQIWIGLCGFGLIFVPILGIAFIHNKEKQEKKD*
Ga0073913_100036493	3300005940	Sand	MLHLVEVLASNPAWIGLCGGGLIIPPIIGIMLIHHNK*
Ga0075478_1000015211	3300006026	Aqueous	MIFHIVETLASSPLWIGLCGAGLTLIPFCGIAYIHNKKN*
Ga0070754_100455644	3300006810	Aqueous	MIFHIVETLATSPVWLGICGGGLIIPPIIGIMLTHRNK*
Ga0075473_101819894	3300006875	Aqueous	MKPIFHLVELLASSPLWIGLCGFGIIIIPILGIQLVHKNK*
Ga0099851_10390602	3300007538	Aqueous	MIFHVVETLANSPLWLGLCGFGIIVVPIMGISYIHNNKK*
Ga0099848_10124467	3300007541	Aqueous	MIFHIVEYLAQSPVWLFICGMGLTVVPFMGIMLIHKSPKK*
Ga0099848_10195392	3300007541	Aqueous	MIFHIVETLAASPLWLGLCGFGIIVIPILGIMIIHNNK*
Ga0099848_10490982	3300007541	Aqueous	MIFHIVETLANSPIWLGLCGFGVIVVPIMGISYIHNNKK*
Ga0099848_12508193	3300007541	Aqueous	FHIVETLAASPVWLGICGGGLIIPPIIGIMLIHRDK*
Ga0099848_12822783	3300007541	Aqueous	MFHLVEVLAGSPIWLGLCGFGVIVLPIIGIQYIHNKHENGK*
Ga0102873_12338172	3300007545	Estuarine	MIFNIVETLAASPIWLGLCGFGIIVVPIMGIAYIHKEK*
Ga0102881_11731002	3300007551	Estuarine	MIFNIVETLAASPIWLGLCGFGIIVVSIMGIAFIHNIDKK*
Ga0102901_11789892	3300007634	Estuarine	MIFNIVETLAASPIWLGLCGFGVIVVPIMGIAFIHNIEKK*
Ga0104988_1047210	3300007735	Freshwater	MIFHIVETLASSPIWLGLCGGGLIIPPIIGIMLIHRSSKNNN*
Ga0099850_10647224	3300007960	Aqueous	MIFHIVETLAASPVWLFICGMGLTVVPFMGIMLIHKQKGK*
Ga0114340_10109072	3300008107	Freshwater, Plankton	MIFHLVEVLAASPVWLGVCGAGLTVAPIMGIMLIHRTK*
Ga0114341_101357035	3300008108	Freshwater, Plankton	MFHLVEVLAASPIWIGACGFGIIVLPIMGIAFIHNKEKI*
Ga0114346_100294627	3300008113	Freshwater, Plankton	MIFHIVETLAASPIWLGLCGAGLTIAPIMGIMLIHRTK*
Ga0114346_10396423	3300008113	Freshwater, Plankton	MIFHIVETLAASPVWLGLCGGGLIILPIMGIIYIHDK*
Ga0114346_10725004	3300008113	Freshwater, Plankton	MIFHIVEVLAASPVWLGLCGAGLTVAPIMGIMLIHRNK*
Ga0114346_12947642	3300008113	Freshwater, Plankton	MLDKMFHLVEFLAASPIWIGLCGFGIIIVPIIGIDYIHRRNKT*
Ga0114355_100076227	3300008120	Freshwater, Plankton	MFHLVEVLAASPVWLGLCGAGLTIAPIMGIMLIHRNK*
Ga0114337_10113896	3300008262	Freshwater, Plankton	MLTLVEHLASSPIWLGLCGFGIIVLPIIGIQYIHKDK*
Ga0105105_1000139613	3300009009	Freshwater Sediment	MIFHTVEALAASPIWIGLCGFGIIVVPIIGIAYIHKK*
Ga0105103_105763913	3300009085	Freshwater Sediment	MIFHIVETLAKSPVWLGLCGFGIIVVPILGISYIHNEDKK*
Ga0105102_107958631	3300009165	Freshwater Sediment	NIIFTLVEFLAESKIWIALCGFGLTIVPILGIMYVHSDKK*
Ga0103849_10126701	3300009221	River Water	IMLFKIVEYLASNKIWLGLCGFGITIIPIMGIQYIHHKK*
Ga0103854_10004422	3300009228	River Water	MLFKIVEYLASNKIWLGLCGFGITIIPIMGIQYIHRKK*
Ga0103855_100011538	3300009230	River Water	MLFKIVEYLASNKIWLGLCGFGITIIPIMGIQYIHHKK*
Ga0126448_10006187	3300009466	Meromictic Pond	MIFHIVETLANSTIWLGLCGFGLIIVPIIGISFIHSNKK*
Ga0126447_11017472	3300009470	Meromictic Pond	MIFHIVETLAASPIWLGLCGFGIIVVPIFGIMVIHNRKGGPL*
Ga0116204_10490506	3300010293	Anoxic Lake Water	MFHLIEVLAASPVWLGLCGAGLTVAPILGIMYTHSKTDGV*
Ga0129348_13347002	3300010296	Freshwater To Marine Saline Gradient	HIVERLAESPIWLGLMGGGLIIPPIIGIMLIHRNK*
Ga0136656_10275035	3300010318	Freshwater To Marine Saline Gradient	MIFHIVETLAASPVWLGICGGGLIIPPIIGIMLIHRNK*
Ga0129333_1000208534	3300010354	Freshwater To Marine Saline Gradient	MFHLVEILASSPIWLGLCGFGIIVLPIMGIQYIHRQK*
Ga0129333_1000216212	3300010354	Freshwater To Marine Saline Gradient	MIFHIVETLASSPVWLGLCGAGLTIAPIMGIMLIHRTK*
Ga0129333_1000805815	3300010354	Freshwater To Marine Saline Gradient	MIFHIVEALASSPIWLGLCGFGKIVIPIMGIAFIHNDINKK*
Ga0129333_100098214	3300010354	Freshwater To Marine Saline Gradient	MIFHIVEALAASPIWLGLCGGGLIIPPVIGIILIHNSFKS*
Ga0129333_100191306	3300010354	Freshwater To Marine Saline Gradient	MIFHIVEALAASQLWLGLCGFGIIVVPILGISFIHNIKDKK*
Ga0129333_1003337510	3300010354	Freshwater To Marine Saline Gradient	MIFHVVEALASSPIWLGLCGFGIIVVPIMGIAYIHKENKE*
Ga0129333_100555749	3300010354	Freshwater To Marine Saline Gradient	MFKLVETLANSPVWLGLCGFGVIVLPIMGIQYIHRNK*
Ga0129333_100612267	3300010354	Freshwater To Marine Saline Gradient	MIFHIVETLANSPIWLGLCGMGLTVVPFIGIMLIHRNK*
Ga0129333_101046225	3300010354	Freshwater To Marine Saline Gradient	MFHLVEVLAASKLWLGACGFGIIVLPIMGIAYIHKNKV*
Ga0129333_101608092	3300010354	Freshwater To Marine Saline Gradient	MIFHITEALAASPIWLGLCGFGIIVVPIMGIAFIHNNIK*
Ga0129333_102382977	3300010354	Freshwater To Marine Saline Gradient	MFHLVEVLAASPIWIGLCGFGIICVPIIGIAFIHNKELDKNKK*
Ga0129333_103577712	3300010354	Freshwater To Marine Saline Gradient	MIKLVEFLADSPIWLGFCGFGIIVLPIMGIQYIHNKKDAK*
Ga0129333_103784752	3300010354	Freshwater To Marine Saline Gradient	MFHLVEVLAGSPIWLGACGFGVIVLPIMGIQYIHNKHHDT*
Ga0129333_104779094	3300010354	Freshwater To Marine Saline Gradient	MFHLVEVLAASPIWLGACGFGLIVLPIMGIAFIHNKEQINRKE*
Ga0129333_104895253	3300010354	Freshwater To Marine Saline Gradient	MFHLVEVLAGSPIWLGLCGFGVIVLPIMGIQYIHNKHENGK*
Ga0129333_106352771	3300010354	Freshwater To Marine Saline Gradient	RISTMIFHTVEALAASPVWLGLCGFGIIVVPIMGIAYIHNRR*
Ga0129333_106906592	3300010354	Freshwater To Marine Saline Gradient	MIFHMVEILAASPIWLGLCGFGIVVVPIMGIAYIHKEK*
Ga0129333_109120932	3300010354	Freshwater To Marine Saline Gradient	MIFHVVETLASSKIWLGLCGFGIIVVPIMGISYIHSTDKNR*
Ga0129333_111543022	3300010354	Freshwater To Marine Saline Gradient	MIFHIVETLAASPIWLGICGFGIIVVPIMGISFIHKK*
Ga0129333_116197972	3300010354	Freshwater To Marine Saline Gradient	MIFHIVEALAASPIWLGLCGFGIIVLPIMGIAFIHNIDKK*
Ga0129333_116637421	3300010354	Freshwater To Marine Saline Gradient	IVEVLAASPVWLGLCGAGLTIVPIIGIMVIHNKDNGV*
Ga0129336_101215674	3300010370	Freshwater To Marine Saline Gradient	MIFHIVEALAASPIWLGLCGFGIIVLPIIGIAFIHNIDKK*
Ga0129336_103230201	3300010370	Freshwater To Marine Saline Gradient	MIFHIVEALASSPIWLGLCGFGIIVIPIMGIAFIHNDINKK*
Ga0136549_100237762	3300010389	Marine Methane Seep Sediment	MIFHIVETLAASPIWLGLCGFGIIVVPILGIMIIHNNK*
Ga0136549_100362518	3300010389	Marine Methane Seep Sediment	MIFHIVETLAASPVWLGICGMGLTVVPFMGIMLIHKQKGK*
Ga0119951_10161277	3300012000	Freshwater	MIFDIVEKLAHNPIWIGLCGGGLIIPPIIGIMLIHRTK*
Ga0119951_10458222	3300012000	Freshwater	MFRLVEFLADSPIWLGLCGFGIIVLPIMGIQYIHNKDNAK*
(restricted) Ga0172368_101207466	3300013123	Freshwater	FHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK*
(restricted) Ga0172369_101450702	3300013125	Freshwater	MFHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK*
(restricted) Ga0172367_101541297	3300013126	Freshwater	HLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK*
(restricted) Ga0172366_104393012	3300013128	Sediment	MIFHIVETLAASPVWLGLCGGGLIIPPIIGIMLIHRN
(restricted) Ga0172363_100833656	3300013130	Sediment	MIFHIVETLAASPVWLGLCGGGLIIPPIIGIMLIHRNK*
(restricted) Ga0172373_102128395	3300013131	Freshwater	MFHLVEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK*
(restricted) Ga0172372_100121991	3300013132	Freshwater	LEGILMFHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK*
(restricted) Ga0172372_106776201	3300013132	Freshwater	LEGILMFHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQTK*
(restricted) Ga0172370_100868596	3300013136	Freshwater	MFHLIEALAGSPIWLGLCGAGLTIAPIIGIMITHQNK*
Ga0177922_103529663	3300013372	Freshwater	MFHLVEALAASKIWLGLCGMGLTIVPILGIIAVHSKKDNGA*
Ga0194113_1000298118	3300020074	Freshwater Lake	MFHLIEVLAASPVWLGLCGAGLTVAPIMGIMLIHQTK
Ga0194113_1001245422	3300020074	Freshwater Lake	MFHLVEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK
Ga0194113_100280072	3300020074	Freshwater Lake	MMFHFVEVLAGSKIWLGLCGFGVIVLPIVGIQYIHNKHDAK
Ga0194113_1004436210	3300020074	Freshwater Lake	MFHLIEALAGSPVWLGLCGAGLTIAPIIGIMVTHQNK
Ga0194113_100867353	3300020074	Freshwater Lake	MIFHVVETLANNPIWLGLCGMGLTIIPIIGIMAVHNKK
Ga0194113_101252195	3300020074	Freshwater Lake	MLHLIEVLAASPIWLGLCGFGVIVLPIVGIQYIHNKKDAK
Ga0194113_104301772	3300020074	Freshwater Lake	MFHLIEVLASSPVWLGLCGAGLTIAPIIGIMITHQNK
Ga0194113_104587461	3300020074	Freshwater Lake	MFHFVEVLAGSKIWLGLCGFGVIVLPIMGIQYIHNKHDA
Ga0194113_105826744	3300020074	Freshwater Lake	MFHLIEVLAASPVWLGLCGAGLTVAPILGIMYTHSKTDGV
Ga0194111_101093089	3300020083	Freshwater Lake	MFHLIEVLAASPVWLGLCGAGLTIAPIIGIMITHQNK
Ga0194111_102264095	3300020083	Freshwater Lake	MIFHAVETLANNPIWLGLCGMGLTIIPIIGIMTVHNKK
Ga0194111_106094371	3300020083	Freshwater Lake	MFHFVEVLAGSKIWLGLCGFGVIVLPIMGIQYIHNKHDAK
Ga0194110_1003719612	3300020084	Freshwater Lake	MIFHVVETLANNPIWLGLCGMGLTIIPIIGIMTVHNKK
Ga0194110_101965742	3300020084	Freshwater Lake	MFHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK
Ga0194112_1000472830	3300020109	Freshwater Lake	LEGILMFHLIEVLAASPVWLGLCGAGLTVAPIMGIMLIHQTK
Ga0194112_102222507	3300020109	Freshwater Lake	MFHLIEVLAASPVWLGLCGAGLTVAPIMGIMLIHQT
Ga0194112_104492633	3300020109	Freshwater Lake	MFHFVEVLAGSKIWLGLCGFGVIVLPIMGIQYIHNKH
Ga0194112_105014601	3300020109	Freshwater Lake	EGILMFHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK
Ga0211736_107458452	3300020151	Freshwater	MIFHLVETLAASPVWLGLCGGGLIILPIMGIMYIHDK
Ga0211736_109801016	3300020151	Freshwater	MIFHIVEGLAASPVWLGLCGAGLTVAPIMGIMLIHRTK
Ga0211726_104002166	3300020161	Freshwater	MLHLVEVLATSPIWLGACGFGIIVLPIMGIAFIHKDK
Ga0194134_100656622	3300020179	Freshwater Lake	MFHLIEVLASSPIWLGLCGAGLTVAPIIGIMITHQNK
Ga0194134_100797245	3300020179	Freshwater Lake	MFHLIEVLAASPVWIGLCGAGLTVAPILGIMYTHSKTDGV
Ga0194134_101021601	3300020179	Freshwater Lake	HLIEVLAASPVWLGLCGAGLTIAPIIGIMITHQNK
Ga0194134_102205573	3300020179	Freshwater Lake	MFHLIEVLAASPVWLGLCGAGLTVAPILGIMYTHS
Ga0194115_100531027	3300020183	Freshwater Lake	MFHLIEVLASSPVWLGLCGAGLTVAPIIGIMITHQNK
Ga0194115_100582637	3300020183	Freshwater Lake	MFHLIEVLASSPVWIGLCGGGLIIPPIIGIMITHQNK
Ga0194115_100626806	3300020183	Freshwater Lake	MMLHIVEVLADSPLWIGLCGGALIIPPILGIMAVHRNK
Ga0194115_100740294	3300020183	Freshwater Lake	MFHLIEVLASSPIWLGLCGAGLTVAPILGIMYTHSKTDGV
Ga0194115_100884693	3300020183	Freshwater Lake	MFHLIEVLASSPVWLGLCGAGLTVAPILGIMYTHSKTDGV
Ga0194115_101258666	3300020183	Freshwater Lake	MFHLIEALAGSPVWLGLCGAGLTVAPIIGIMITHSKTDGV
Ga0194115_101521884	3300020183	Freshwater Lake	MFHLIEVLAASPIWLGLCGAGLTVAPILGIMYIHSKTDGV
Ga0194115_101773303	3300020183	Freshwater Lake	MFHLIEVLAASPVWLGLCGAGLTVAPIIGIMITHSKTDGV
Ga0194115_101939382	3300020183	Freshwater Lake	MFHLIEVLAASPVWLGLCGAGLTVAPILGIMYTHQNK
Ga0194115_102501282	3300020183	Freshwater Lake	MFHLIEVLAASPVWLGLCGAGLTVAPILGIMFTHSKTDGV
Ga0194115_102688494	3300020183	Freshwater Lake	MFHFIEVLAASPVWLGLCGAGLTVAPILGIMYTHSKTDGV
Ga0194115_103452391	3300020183	Freshwater Lake	MFHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQ
Ga0194115_103697421	3300020183	Freshwater Lake	MFHLIEVLAASPVWLGLCGAGLTVAPILGIIYTHQNK
Ga0194118_100708433	3300020190	Freshwater Lake	MFHLVETLAASPIWLGLCGFGIIVLPIIGIMFIHRKKSNDR
Ga0194118_100859235	3300020190	Freshwater Lake	MFHLIEVLASSPVWLGLCGAGLTVAPILGIMYTHFGQKLTG
Ga0194118_101786835	3300020190	Freshwater Lake	MFHLMEVLAASPVWLGLCGAGLTVAPILGIMYTHSKTDGV
Ga0194124_101175271	3300020196	Freshwater Lake	LEREMIFHAVETLANNPIWLGLCGMGLTIIPIIGIMAVHNKK
Ga0194124_102260826	3300020196	Freshwater Lake	ILMFHLIEVLAASPVWLGLCGAGLTVAPIMGIMLIHQTK
Ga0194128_100116066	3300020197	Freshwater Lake	MMFHFVEVLAGSKIWLGLCGFGVIVLPIVGIQYIYNKHDAK
Ga0194121_101008237	3300020200	Freshwater Lake	MIFHAVETLANNPIWLGLCGMGLTIIPIIGIMAVHNKK
Ga0194116_100760682	3300020204	Freshwater Lake	MFHLIEVLASSPVWIGFCGGGLIIPPIIGIMITHQNK
Ga0194116_103477871	3300020204	Freshwater Lake	LMFHLIEALAGSPVWLGLCGAGLTVAPIIGIMITHSKTDGV
Ga0194119_100139121	3300020220	Freshwater Lake	YDLMFHFVEVLAGSKIWLGLCGFGVIVLPIVGIQYIHNKHDAK
Ga0194119_101082861	3300020220	Freshwater Lake	IEVLAASPVWLGLCGAGLTVAPILGIMYTHSKTNGV
Ga0194119_101299893	3300020220	Freshwater Lake	MFQLIEVLASNPVWLGLCGAGLTVVPILGIMTVHSKNNGV
Ga0194119_106412303	3300020220	Freshwater Lake	LIEVLASSPVWLGLCGAGLTVAPILGIMYTHFGQKLTG
Ga0194125_100618861	3300020222	Freshwater Lake	FHLIEALAGSPVWLGLCGAGLTIAPIIGIMVTHQNK
Ga0194125_100928573	3300020222	Freshwater Lake	MFHLIEALAGSPVWLGLCGAGLTVAPILGIMYTHSKTDGV
Ga0208235_100004944	3300020530	Freshwater	MIFHIVEYLAQSPVWLGLCGAGLTVAPIMGIMLIHKQNGK
Ga0194129_102812762	3300020578	Freshwater Lake	MFHLIEILAASPIWLGLCGAGLTVAPILGIMYTHSKTDGV
Ga0194133_100039389	3300021091	Freshwater Lake	MIFHIVETLATSSVWLGLCGFGIIVVPILGIMIIHSKKSV
Ga0194133_100093803	3300021091	Freshwater Lake	MFHFVEVLAGSKIWLGLCGFGVIVLPIVGIQYIYNKHDAK
Ga0194133_100998627	3300021091	Freshwater Lake	MIFKIVEFLAESPVWLGLCAGGLIIPPIIGIMLIHRNK
Ga0194133_101200727	3300021091	Freshwater Lake	MIFHVVETLANNSIWLGLCGMGLTIIPIIGIMAVHNKK
Ga0194133_101272042	3300021091	Freshwater Lake	MFHLIEVLATSPVWLGLCGAGLTIAPIIGIMITHQNK
Ga0194123_100284894	3300021093	Freshwater Lake	MFHLIEALAASPVWLGLCGAGLTVAPIIGIMITHQNK
Ga0194130_100253132	3300021376	Freshwater Lake	MFHFIEVLAASPVWLGLCGAGLTIAPIIGIMITHQNK
Ga0194130_103075231	3300021376	Freshwater Lake	GILMFHLIEVLASSPVWLGLCGAGLTIAPIIGIMITHQNK
Ga0194130_106710541	3300021376	Freshwater Lake	MFHLIEVLAASPVWLGLCGAGLTVAPIIGIMITHQNK
Ga0222714_102247033	3300021961	Estuarine Water	ERNMIFHIVEALAASQLWLGLCGFGVIVVPILGISFIHNTKDKK
Ga0222713_100192988	3300021962	Estuarine Water	MIFHIVEALAASQLWLGLCGFGVIVVPILGISFIHNTKDKK
Ga0222713_100200503	3300021962	Estuarine Water	MIFHIVETLAASPIWLGLCGAGLTIAPIMGIMLIHRTK
Ga0222713_100438838	3300021962	Estuarine Water	MIFHIVETLAASPVWLGLCGGGLIIPPIIGIMLIHRTK
Ga0222713_101178652	3300021962	Estuarine Water	MFHLVEVLASSPIWLGLCGAGLTVAPIMGIMYIHSKNNGA
Ga0222712_100601676	3300021963	Estuarine Water	MIFHIVEALAASPIWLGLCGAGLTIAPIMGIMLIHRTK
Ga0222712_100838563	3300021963	Estuarine Water	MFHLVETLAGSQIWIGLCGFGIIIMPILGIMFIHDKK
Ga0222712_107833252	3300021963	Estuarine Water	MFHLVEVLAASQIWLGACGFGVIVLPIMGIQYIHNKNHDT
Ga0196905_100210713	3300022198	Aqueous	MIFHIVETLAASPVWLGICGGGLIIPPIIGIMLIHRNK
Ga0196905_10033447	3300022198	Aqueous	VIFHAVEALANSPLWLGLCGFGIIVVPIMGIAYIHKEK
Ga0196905_10132132	3300022198	Aqueous	MIFHVVETLANSPLWLGLCGFGIIVVPIMGISYIHNNKK
Ga0196905_10145917	3300022198	Aqueous	MIFHIVETLANSPIWLGLCGFGVIVVPIMGISYIHNNKK
Ga0196901_10121965	3300022200	Aqueous	MILHFVETLANSPLWVGLCGFGLVVLPILGIMTVHNNVK
Ga0196901_10226596	3300022200	Aqueous	MIFHIVETLAASPLWLGLCGFGIIVIPILGIMIIHNNK
Ga0196901_10581482	3300022200	Aqueous	MIFHIVEYLAQSPVWLFICGMGLTVVPFMGIMLIHKSPKK
Ga0214917_1002749416	3300022752	Freshwater	MFHLVEKLAHNSIWIGLMGGGLIIPPIIGIMFIHRNK
Ga0214917_103571101	3300022752	Freshwater	TMIFDIVEKLAHNPIWIGLCGGGLIIPPIIGIMLIHRNK
Ga0247724_100038315	3300024239	Deep Subsurface Sediment	MIFHIVETLAASPIWLGLCGFGIIVVPIMGISFIHNIDKK
Ga0247724_100110116	3300024239	Deep Subsurface Sediment	MIFHIVETLAASPIWLGLCGFGIIVVPILGIMVIHSKKSI
Ga0244777_103865531	3300024343	Estuarine	MIFNIVETLAASPIWLGLCGFGIIVVPIMGIAFIHNIDKK
Ga0244776_101013177	3300024348	Estuarine	IVETLAASPIWLGLCGFGIIVVPIMGIAFIHNIDKK
Ga0244776_102309874	3300024348	Estuarine	MIFNIVETLAASPIWLGLCGFGIIVVPIMGIAYIHKEK
Ga0208149_100050620	3300025610	Aqueous	MIFHIVETLASSPLWIGLCGAGLTLIPFCGIAYIHNKKN
Ga0208161_10012953	3300025646	Aqueous	MIFHIVETLAASPVWLFVCGMGLTVVPFMGIMLIHRNK
Ga0208788_10104386	3300027499	Deep Subsurface	MIFHIVEYLAQSPVWLGLCGAGLTVAPIMGIMLIHRTK
Ga0208974_10273848	3300027608	Freshwater Lentic	MFHLVEVLAASQLWLGLCGAGLTVAPILGIMLIHRTK
Ga0209288_1000001076	3300027762	Freshwater Sediment	MIFHTVEALAASPIWIGLCGFGIIVVPIIGIAYIHKK
Ga0209972_104379261	3300027793	Freshwater Lake	FFQVIEFLAASPIWLGLCGFGIIVVPILGIMVIHNNNH
Ga0209990_1000211511	3300027816	Freshwater Lake	MIFHIVEALADSPIWLGLCGAGLTIAPIIGIMIIHRSPKK
Ga0119944_10006348	3300029930	Aquatic	MFHLVEVLAASPIWLGACGFGVIVLPIMGIQYIHNKHHDT
Ga0119944_10017727	3300029930	Aquatic	MFHLVEVLAASKLWLGACGFGIIVLPIMGIAFIHNTKEKT
Ga0119944_10027732	3300029930	Aquatic	MFHLIEVLASNTVWLGLCGAGLTIVPIMGIMYVHRK
Ga0119944_10044859	3300029930	Aquatic	MIFHIVEALAASPVWLGLCGAGLTIAPIMGIMFIHRTK
Ga0119944_10084113	3300029930	Aquatic	VFHLVEVLAASPLWLGACGFGIIVLPIMGIAFIHNTKEKT
Ga0119944_10127523	3300029930	Aquatic	MFHLVEVLAASPIWLGACGFGIIVLPIMGIAFIHNTKEKT
Ga0119944_10157754	3300029930	Aquatic	MFHLVEVLAASPLWLGACGFGIIVLPIMGIAFIHNTKE
Ga0119944_10188295	3300029930	Aquatic	MIFHLVEVLAASPIWLGACGFGIIVLPIMGIAFIHNTKEKT
Ga0119945_10032405	3300029933	Aquatic	MFHLVEVLAASKIWLGACGFGIIVLPIMGIAFIHSTKE
Ga0119945_10209053	3300029933	Aquatic	MFHLVEVLAASKIWLGACGFGIIVLPIMGIAFIHNKDKK
Ga0315899_101643116	3300031784	Freshwater	MFHLVEVLAASPVWLGLCGAGLTIAPIMGIMLIHRNK
Ga0315900_1004221214	3300031787	Freshwater	MIFHLVEVLAASPVWLGVCGAGLTVAPIMGIMLIHRTK
Ga0315909_109346532	3300031857	Freshwater	MIFHVVETLAANPVWLGLCGGGLIIPPIIGIMLIHRSFKSNN
Ga0315902_1000889031	3300032093	Freshwater	MIFHIVETLAASPIWLGLCGAGLTIAPIMGIMLIHRNK
Ga0315902_102381722	3300032093	Freshwater	MTFFQVIEFLAASPIWLGLCGFGIIVVPILGIMVIHNNNH
Ga0315902_103113266	3300032093	Freshwater	MIFHIVETLAASPVWLGLCGAGLTILPFMGIMLIHRTK
Ga0316616_1041500123	3300033521	Soil	MIFHVVEALASSPIWLGLCGFGIIVVPIMGIAYIHKENKE
Ga0316617_1000994095	3300033557	Soil	MIFHIVETLAASPVWLGLCGAGLTVAPIMGIMLIHRTK
Ga0334977_0053957_2035_2148	3300033978	Freshwater	MFHLVEALAASQIWLGLCGMGLTILPIMGIMVVHKTK
Ga0334982_0134662_857_982	3300033981	Freshwater	MFHLVEALAASPIWIGACGFGIIVLPIMGIAFIHNKEKNQS
Ga0335028_0547031_169_288	3300034071	Freshwater	MIFHVVETLANSPIWLGLCGFGIVVVPIMGIAFIHNNIK
Ga0310130_0001202_13374_13496	3300034073	Fracking Water	MIFHIVELLASNPVWIGLCGGGLIIPPIIGIMIIHNNKQK
Ga0310130_0015041_849_971	3300034073	Fracking Water	MIFHIVETLAASPVWLGICGMGLTVVPFMGIMLIHKQKGK
Ga0335029_0000628_7554_7667	3300034102	Freshwater	MFHLVEVLAASPVWLGLCGAGLTVAPIMGIMLIHRNK
Ga0335030_0005077_1403_1531	3300034103	Freshwater	MIFHIVEALAASPIWLGLCGGGLIIPPIIGIMLIHRSSKNNN
Ga0335036_0001516_7201_7320	3300034106	Freshwater	MIFHIVETLAESPIWLGACGFGIIVVPIMGIAFIHNKIK
Ga0335066_0000153_8680_8802	3300034112	Freshwater	MFKLVESLANSPVWLGLCGFGVIVLPIMGIQYIHNKKNDT
Ga0335007_0045618_1662_1778	3300034283	Freshwater	MIFHIVEALAASPVWLGLCGFGIIVVPIMGISYIHNIK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters