| Basic Information | |
|---|---|
| Family ID | F022817 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 212 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MGKSSKHYLPSGKEYKGATHKMDGQVHTGAKHSASSKVLKHTKPKKK |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 212 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 71.23 % |
| % of genes near scaffold ends (potentially truncated) | 37.26 % |
| % of genes from short scaffolds (< 2000 bps) | 85.38 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (36.792 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (60.849 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.132 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (86.321 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 212 Family Scaffolds |
|---|---|---|
| PF01391 | Collagen | 1.42 |
| PF02557 | VanY | 1.42 |
| PF03237 | Terminase_6N | 1.42 |
| PF00534 | Glycos_transf_1 | 1.42 |
| PF00166 | Cpn10 | 1.42 |
| PF13692 | Glyco_trans_1_4 | 0.94 |
| PF00436 | SSB | 0.47 |
| PF05257 | CHAP | 0.47 |
| PF07484 | Collar | 0.47 |
| PF02467 | Whib | 0.47 |
| PF13155 | Toprim_2 | 0.47 |
| PF09588 | YqaJ | 0.47 |
| PF13252 | DUF4043 | 0.47 |
| PF01385 | OrfB_IS605 | 0.47 |
| PF13392 | HNH_3 | 0.47 |
| PF13578 | Methyltransf_24 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 212 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 1.42 |
| COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.42 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.42 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.47 |
| COG0675 | Transposase | Mobilome: prophages, transposons [X] | 0.47 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.47 % |
| Unclassified | root | N/A | 24.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003277|JGI25908J49247_10007893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3358 | Open in IMG/M |
| 3300003277|JGI25908J49247_10013411 | All Organisms → cellular organisms → Bacteria | 2519 | Open in IMG/M |
| 3300003277|JGI25908J49247_10015949 | All Organisms → Viruses → Predicted Viral | 2290 | Open in IMG/M |
| 3300003277|JGI25908J49247_10034914 | Not Available | 1396 | Open in IMG/M |
| 3300003277|JGI25908J49247_10078078 | Not Available | 820 | Open in IMG/M |
| 3300003277|JGI25908J49247_10125452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Cystobacter → Cystobacter fuscus | 606 | Open in IMG/M |
| 3300003388|JGI25910J50241_10154156 | Not Available | 597 | Open in IMG/M |
| 3300003394|JGI25907J50239_1038125 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
| 3300003404|JGI25920J50251_10150575 | Not Available | 506 | Open in IMG/M |
| 3300003411|JGI25911J50253_10188950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300003490|JGI25926J51410_1030824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300003491|JGI25924J51412_1039796 | Not Available | 758 | Open in IMG/M |
| 3300004124|Ga0066178_10228003 | Not Available | 538 | Open in IMG/M |
| 3300004126|Ga0066179_10202267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300004448|Ga0065861_1049599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 825 | Open in IMG/M |
| 3300005580|Ga0049083_10139747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300005580|Ga0049083_10152493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 792 | Open in IMG/M |
| 3300005580|Ga0049083_10191018 | Not Available | 697 | Open in IMG/M |
| 3300005580|Ga0049083_10206866 | All Organisms → Viruses | 666 | Open in IMG/M |
| 3300005581|Ga0049081_10139730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 890 | Open in IMG/M |
| 3300005583|Ga0049085_10000832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12164 | Open in IMG/M |
| 3300005583|Ga0049085_10005603 | All Organisms → cellular organisms → Bacteria | 4974 | Open in IMG/M |
| 3300005583|Ga0049085_10046527 | All Organisms → Viruses → Predicted Viral | 1570 | Open in IMG/M |
| 3300005583|Ga0049085_10067138 | All Organisms → Viruses → Predicted Viral | 1266 | Open in IMG/M |
| 3300005583|Ga0049085_10072517 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300005583|Ga0049085_10076120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1176 | Open in IMG/M |
| 3300005583|Ga0049085_10080458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1138 | Open in IMG/M |
| 3300005583|Ga0049085_10112174 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 936 | Open in IMG/M |
| 3300005583|Ga0049085_10185922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300005583|Ga0049085_10239394 | Not Available | 596 | Open in IMG/M |
| 3300005583|Ga0049085_10254317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300005584|Ga0049082_10211523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300006003|Ga0073912_1004337 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
| 3300007537|Ga0102934_1010472 | Not Available | 5731 | Open in IMG/M |
| 3300007611|Ga0102927_1177113 | Not Available | 721 | Open in IMG/M |
| 3300007628|Ga0102937_1022503 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella copri | 2587 | Open in IMG/M |
| 3300007735|Ga0104988_10939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 40821 | Open in IMG/M |
| 3300008107|Ga0114340_1003581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 12063 | Open in IMG/M |
| 3300008107|Ga0114340_1072583 | All Organisms → Viruses → Predicted Viral | 1445 | Open in IMG/M |
| 3300008119|Ga0114354_1071711 | All Organisms → Viruses → Predicted Viral | 1431 | Open in IMG/M |
| 3300008262|Ga0114337_1054547 | All Organisms → cellular organisms → Bacteria | 3055 | Open in IMG/M |
| 3300008448|Ga0114876_1026886 | Not Available | 2878 | Open in IMG/M |
| 3300008963|Ga0102930_1107198 | Not Available | 670 | Open in IMG/M |
| 3300009152|Ga0114980_10007997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6907 | Open in IMG/M |
| 3300009154|Ga0114963_10252437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 999 | Open in IMG/M |
| 3300009155|Ga0114968_10057552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2479 | Open in IMG/M |
| 3300009158|Ga0114977_10035810 | All Organisms → Viruses → Predicted Viral | 3104 | Open in IMG/M |
| 3300009182|Ga0114959_10064249 | All Organisms → Viruses → Predicted Viral | 2086 | Open in IMG/M |
| 3300010160|Ga0114967_10277561 | Not Available | 868 | Open in IMG/M |
| 3300011116|Ga0151516_10488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 19412 | Open in IMG/M |
| 3300012012|Ga0153799_1002703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4731 | Open in IMG/M |
| 3300012012|Ga0153799_1069929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300012017|Ga0153801_1026496 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
| 3300012017|Ga0153801_1053175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 712 | Open in IMG/M |
| 3300013004|Ga0164293_10999485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 522 | Open in IMG/M |
| 3300013372|Ga0177922_10519576 | Not Available | 510 | Open in IMG/M |
| 3300013372|Ga0177922_10678002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 518 | Open in IMG/M |
| 3300015050|Ga0181338_1040888 | All Organisms → Viruses | 689 | Open in IMG/M |
| 3300015050|Ga0181338_1057560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300017701|Ga0181364_1045674 | All Organisms → Viruses | 692 | Open in IMG/M |
| 3300017701|Ga0181364_1067729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300017716|Ga0181350_1021531 | All Organisms → Viruses → Predicted Viral | 1806 | Open in IMG/M |
| 3300017716|Ga0181350_1057254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1022 | Open in IMG/M |
| 3300017716|Ga0181350_1068566 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 914 | Open in IMG/M |
| 3300017716|Ga0181350_1083704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 804 | Open in IMG/M |
| 3300017716|Ga0181350_1143871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300017722|Ga0181347_1130695 | Not Available | 696 | Open in IMG/M |
| 3300017722|Ga0181347_1133964 | Not Available | 686 | Open in IMG/M |
| 3300017723|Ga0181362_1034159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1080 | Open in IMG/M |
| 3300017723|Ga0181362_1039052 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300017723|Ga0181362_1099799 | All Organisms → Viruses | 577 | Open in IMG/M |
| 3300017723|Ga0181362_1107251 | Not Available | 552 | Open in IMG/M |
| 3300017736|Ga0181365_1002432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 4481 | Open in IMG/M |
| 3300017736|Ga0181365_1031026 | All Organisms → Viruses → Predicted Viral | 1348 | Open in IMG/M |
| 3300017736|Ga0181365_1063263 | All Organisms → Viruses | 916 | Open in IMG/M |
| 3300017736|Ga0181365_1083224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300017736|Ga0181365_1128276 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300017736|Ga0181365_1154334 | Not Available | 543 | Open in IMG/M |
| 3300017736|Ga0181365_1160977 | All Organisms → Viruses | 529 | Open in IMG/M |
| 3300017736|Ga0181365_1167732 | All Organisms → Viruses | 516 | Open in IMG/M |
| 3300017736|Ga0181365_1169539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 512 | Open in IMG/M |
| 3300017761|Ga0181356_1096513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 966 | Open in IMG/M |
| 3300017761|Ga0181356_1167084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300017761|Ga0181356_1202931 | All Organisms → Viruses | 586 | Open in IMG/M |
| 3300017761|Ga0181356_1222151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300017774|Ga0181358_1060514 | All Organisms → Viruses → Predicted Viral | 1414 | Open in IMG/M |
| 3300017774|Ga0181358_1072849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1265 | Open in IMG/M |
| 3300017774|Ga0181358_1075529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1238 | Open in IMG/M |
| 3300017774|Ga0181358_1107655 | Not Available | 992 | Open in IMG/M |
| 3300017774|Ga0181358_1144267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 818 | Open in IMG/M |
| 3300017777|Ga0181357_1034955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1980 | Open in IMG/M |
| 3300017777|Ga0181357_1107654 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300017777|Ga0181357_1150484 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
| 3300017777|Ga0181357_1173422 | Not Available | 783 | Open in IMG/M |
| 3300017777|Ga0181357_1180473 | Not Available | 764 | Open in IMG/M |
| 3300017777|Ga0181357_1204159 | Not Available | 704 | Open in IMG/M |
| 3300017777|Ga0181357_1225761 | Not Available | 659 | Open in IMG/M |
| 3300017777|Ga0181357_1250526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300017777|Ga0181357_1268100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300017777|Ga0181357_1268202 | All Organisms → Viruses | 588 | Open in IMG/M |
| 3300017778|Ga0181349_1066110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1393 | Open in IMG/M |
| 3300017778|Ga0181349_1069638 | All Organisms → Viruses → Predicted Viral | 1351 | Open in IMG/M |
| 3300017778|Ga0181349_1207222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300017778|Ga0181349_1255695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300017778|Ga0181349_1315405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300017780|Ga0181346_1084010 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
| 3300017780|Ga0181346_1099501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 1130 | Open in IMG/M |
| 3300017780|Ga0181346_1193339 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300017780|Ga0181346_1195824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 731 | Open in IMG/M |
| 3300017780|Ga0181346_1302880 | Not Available | 542 | Open in IMG/M |
| 3300017780|Ga0181346_1327313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300017784|Ga0181348_1044886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1821 | Open in IMG/M |
| 3300017784|Ga0181348_1097741 | All Organisms → Viruses | 1148 | Open in IMG/M |
| 3300017784|Ga0181348_1154901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
| 3300017784|Ga0181348_1187808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
| 3300017784|Ga0181348_1214695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300017785|Ga0181355_1091970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1260 | Open in IMG/M |
| 3300017785|Ga0181355_1141757 | Not Available | 974 | Open in IMG/M |
| 3300017785|Ga0181355_1229991 | Not Available | 718 | Open in IMG/M |
| 3300017785|Ga0181355_1270228 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 647 | Open in IMG/M |
| 3300017785|Ga0181355_1276173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300019784|Ga0181359_1005558 | All Organisms → cellular organisms → Bacteria | 4121 | Open in IMG/M |
| 3300019784|Ga0181359_1008778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3505 | Open in IMG/M |
| 3300019784|Ga0181359_1019496 | All Organisms → Viruses → Predicted Viral | 2555 | Open in IMG/M |
| 3300019784|Ga0181359_1047736 | All Organisms → Viruses → Predicted Viral | 1654 | Open in IMG/M |
| 3300019784|Ga0181359_1063193 | Not Available | 1414 | Open in IMG/M |
| 3300019784|Ga0181359_1070469 | All Organisms → Viruses → Predicted Viral | 1325 | Open in IMG/M |
| 3300019784|Ga0181359_1102606 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
| 3300019784|Ga0181359_1115342 | Not Available | 968 | Open in IMG/M |
| 3300019784|Ga0181359_1118654 | Not Available | 949 | Open in IMG/M |
| 3300019784|Ga0181359_1128557 | Not Available | 896 | Open in IMG/M |
| 3300019784|Ga0181359_1170808 | Not Available | 727 | Open in IMG/M |
| 3300019784|Ga0181359_1197161 | Not Available | 651 | Open in IMG/M |
| 3300019784|Ga0181359_1203601 | Not Available | 635 | Open in IMG/M |
| 3300019784|Ga0181359_1211196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300019784|Ga0181359_1211900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300019784|Ga0181359_1217753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300019784|Ga0181359_1273372 | Not Available | 500 | Open in IMG/M |
| 3300019784|Ga0181359_1273529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300022190|Ga0181354_1022368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2017 | Open in IMG/M |
| 3300022190|Ga0181354_1114573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 870 | Open in IMG/M |
| 3300022190|Ga0181354_1138029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 772 | Open in IMG/M |
| 3300022190|Ga0181354_1168365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300022190|Ga0181354_1176766 | Not Available | 651 | Open in IMG/M |
| 3300022407|Ga0181351_1034807 | All Organisms → Viruses → Predicted Viral | 2137 | Open in IMG/M |
| 3300022407|Ga0181351_1042674 | All Organisms → Viruses → Predicted Viral | 1912 | Open in IMG/M |
| 3300022407|Ga0181351_1075720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1353 | Open in IMG/M |
| 3300022407|Ga0181351_1079768 | All Organisms → Viruses → Predicted Viral | 1307 | Open in IMG/M |
| 3300022407|Ga0181351_1128955 | Not Available | 938 | Open in IMG/M |
| 3300022407|Ga0181351_1142228 | Not Available | 873 | Open in IMG/M |
| 3300022407|Ga0181351_1169502 | Not Available | 764 | Open in IMG/M |
| 3300022407|Ga0181351_1223602 | Not Available | 609 | Open in IMG/M |
| 3300024289|Ga0255147_1000120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 33085 | Open in IMG/M |
| 3300024481|Ga0256330_1039198 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
| 3300025647|Ga0208160_1081162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 868 | Open in IMG/M |
| 3300026094|Ga0209937_1000231 | Not Available | 19224 | Open in IMG/M |
| 3300026094|Ga0209937_1010138 | Not Available | 2269 | Open in IMG/M |
| 3300026180|Ga0209938_1195250 | Not Available | 524 | Open in IMG/M |
| 3300027143|Ga0255105_1040248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300027586|Ga0208966_1161928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300027627|Ga0208942_1119585 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 733 | Open in IMG/M |
| 3300027627|Ga0208942_1126528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300027627|Ga0208942_1143642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300027627|Ga0208942_1206597 | Not Available | 502 | Open in IMG/M |
| 3300027642|Ga0209135_1132917 | Not Available | 813 | Open in IMG/M |
| 3300027649|Ga0208960_1080044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
| 3300027679|Ga0209769_1115522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 862 | Open in IMG/M |
| 3300027679|Ga0209769_1255276 | Not Available | 532 | Open in IMG/M |
| 3300027688|Ga0209553_1196814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300027708|Ga0209188_1057046 | All Organisms → Viruses → Predicted Viral | 1706 | Open in IMG/M |
| 3300027732|Ga0209442_1280285 | Not Available | 583 | Open in IMG/M |
| 3300027733|Ga0209297_1062446 | All Organisms → Viruses → Predicted Viral | 1658 | Open in IMG/M |
| 3300027744|Ga0209355_1110985 | Not Available | 1223 | Open in IMG/M |
| 3300027770|Ga0209086_10077677 | All Organisms → Viruses | 1760 | Open in IMG/M |
| 3300027772|Ga0209768_10115841 | All Organisms → Viruses → Predicted Viral | 1297 | Open in IMG/M |
| 3300027772|Ga0209768_10224912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
| 3300027785|Ga0209246_10124926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1010 | Open in IMG/M |
| 3300027785|Ga0209246_10194094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300027798|Ga0209353_10070012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1598 | Open in IMG/M |
| 3300027798|Ga0209353_10085598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1429 | Open in IMG/M |
| 3300027798|Ga0209353_10087954 | Not Available | 1408 | Open in IMG/M |
| 3300027798|Ga0209353_10171031 | Not Available | 962 | Open in IMG/M |
| 3300027798|Ga0209353_10304760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300027798|Ga0209353_10379131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300027808|Ga0209354_10042557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1825 | Open in IMG/M |
| 3300027808|Ga0209354_10066877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C449 | 1455 | Open in IMG/M |
| 3300027808|Ga0209354_10340342 | Not Available | 592 | Open in IMG/M |
| 3300027808|Ga0209354_10378468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300027973|Ga0209298_10000298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 33472 | Open in IMG/M |
| 3300029930|Ga0119944_1009298 | All Organisms → Viruses → Predicted Viral | 1496 | Open in IMG/M |
| 3300031510|Ga0308010_1045090 | Not Available | 1821 | Open in IMG/M |
| 3300031510|Ga0308010_1331764 | All Organisms → Viruses | 514 | Open in IMG/M |
| 3300031539|Ga0307380_10113686 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
| 3300031539|Ga0307380_10288196 | All Organisms → Viruses → Predicted Viral | 1531 | Open in IMG/M |
| 3300031566|Ga0307378_11101337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300031578|Ga0307376_10508677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C449 | 778 | Open in IMG/M |
| 3300031707|Ga0315291_10341303 | All Organisms → Viruses | 1449 | Open in IMG/M |
| 3300031707|Ga0315291_10556007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1051 | Open in IMG/M |
| 3300031746|Ga0315293_10251904 | All Organisms → Viruses | 1433 | Open in IMG/M |
| 3300031746|Ga0315293_10639134 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 800 | Open in IMG/M |
| 3300031952|Ga0315294_10205368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1955 | Open in IMG/M |
| 3300031952|Ga0315294_10253767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1715 | Open in IMG/M |
| 3300031952|Ga0315294_11498086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300031999|Ga0315274_10228608 | All Organisms → Viruses → Predicted Viral | 2280 | Open in IMG/M |
| 3300031999|Ga0315274_10857318 | All Organisms → Viruses | 953 | Open in IMG/M |
| 3300031999|Ga0315274_11650594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 598 | Open in IMG/M |
| 3300032046|Ga0315289_10189022 | All Organisms → Viruses → Predicted Viral | 2265 | Open in IMG/M |
| 3300032053|Ga0315284_10726819 | All Organisms → Viruses → Predicted Viral | 1161 | Open in IMG/M |
| 3300032053|Ga0315284_11691810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300032118|Ga0315277_11070782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 729 | Open in IMG/M |
| 3300032118|Ga0315277_11353004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300032173|Ga0315268_10163607 | Not Available | 2117 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 60.85% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 10.85% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.55% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.77% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.89% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.42% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 1.42% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.47% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.47% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.47% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.47% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.47% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006003 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_2-Sept-14 | Environmental | Open in IMG/M |
| 3300007537 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_A_D1_MG | Environmental | Open in IMG/M |
| 3300007611 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007628 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_B_D1_MG | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008963 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026094 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026180 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_C_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027143 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25908J49247_100078933 | 3300003277 | Freshwater Lake | MGKSSKHYLPNGKEYKGATHKMDGQVHTGATHSASSKVLKHTKPKKK* |
| JGI25908J49247_100134113 | 3300003277 | Freshwater Lake | MPKSSKHYLPNGKEYKGAIHKMNGQVHTGAKHTTSSIPLKHSKPKKK* |
| JGI25908J49247_100159492 | 3300003277 | Freshwater Lake | MSKTSKHYLKSGKEYKGAVHRMNGQVHTGAKHTASSKVLTHSKPKKVKK* |
| JGI25908J49247_100349141 | 3300003277 | Freshwater Lake | MSKTSKHYLKSGKEYKGAVHRMNGQVHTGAKHTASSKILTHSKPKKVKK* |
| JGI25908J49247_100780781 | 3300003277 | Freshwater Lake | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTTSSKVLTHTKPKKAK* |
| JGI25908J49247_101254521 | 3300003277 | Freshwater Lake | HYLKSGKEYKGAVHRMNGQVHTGAKHSASSKVLTHSKPKKVKK* |
| JGI25910J50241_101541562 | 3300003388 | Freshwater Lake | MSKTSKHYLKSGKEYKGAVHRMNGEVHTGAKHTASSKVLTHSKPKKVKK* |
| JGI25907J50239_10381251 | 3300003394 | Freshwater Lake | MGKSSKHYLPNGKEYMGAIHKMDGKPYSGAKHSASSKALKHT |
| JGI25920J50251_101505751 | 3300003404 | Freshwater Lake | MSKTSKHYLKSGKEYKGAVHRMNGEVHTGAKHTASSKVLTHSKPK |
| JGI25911J50253_101889503 | 3300003411 | Freshwater Lake | PNGKEHKGPVHTNNGQVMTGAKHSESSKNLSHTKPKKTGSK* |
| JGI25926J51410_10308245 | 3300003490 | Freshwater Lake | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGATHSASSKVLT |
| JGI25924J51412_10397961 | 3300003491 | Freshwater Lake | MSKTSKHYLKSGKEYKGAVHRMNGXVHTGAKHSAXSKVLTHSKPKKVKK* |
| Ga0066178_102280031 | 3300004124 | Freshwater Lake | EKMSKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTTSSKVLTHTKPKKAK* |
| Ga0066179_102022671 | 3300004126 | Freshwater Lake | MGKSSKHYLPNGKEYKGATHKMDGQVHTGAKHTASSKVLKHTKPKKN* |
| Ga0065861_10495992 | 3300004448 | Marine | MSKTSKYYLKSGKLYTGPIHKTGGKPMTGATHTATSKPLTHTKPKKVK* |
| Ga0049083_101397471 | 3300005580 | Freshwater Lentic | EKEIMPKSSKHYLPNGKEYKGAIHKMNGQVHTGAMHSASSKVLKHTKPKKK* |
| Ga0049083_101524931 | 3300005580 | Freshwater Lentic | EKEIMPKSSKHYLPNGKEYKGAIHKMNGQVHTGAKHTTSSIPLKHSKPKKK* |
| Ga0049083_101910182 | 3300005580 | Freshwater Lentic | MGADSKHYLPNGKEHKGPVHKMNGQVHTGAKHTAASKVLTHSKPKKK* |
| Ga0049083_102068662 | 3300005580 | Freshwater Lentic | MGKSSKHYLPNGKEYMGATHKMDGQVHTGAKHTASSKVLKHTKPKKN* |
| Ga0049081_101397302 | 3300005581 | Freshwater Lentic | MGKSSKHYLPSGKEYKGATHKMDGQVHSGAKHSASSKVLKHTKPKKK* |
| Ga0049085_100008329 | 3300005583 | Freshwater Lentic | MAKTSKHYLPSGKEYTGATHKMNGQVHTGAKHSASSKVLKHTKPKKP* |
| Ga0049085_100056035 | 3300005583 | Freshwater Lentic | MAKSSKHYLPNGKEYMGAIHKMDGKPYSGAKHSASSKVLKHSKPKKK* |
| Ga0049085_100465273 | 3300005583 | Freshwater Lentic | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGATHSASSKVLTHTKPKAKKK* |
| Ga0049085_100671382 | 3300005583 | Freshwater Lentic | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGATHSASSKVLTHAKPKAKKK* |
| Ga0049085_100725172 | 3300005583 | Freshwater Lentic | MAKSSKHYLPNGKQYMGATHKMDGKVHTGAKHSDSSKVLTHSKPKKK* |
| Ga0049085_100761203 | 3300005583 | Freshwater Lentic | MPKTSKHYLPSGKEYKGATHKMNGQVHTGAKHTASSKILKHSKPKKK* |
| Ga0049085_100804584 | 3300005583 | Freshwater Lentic | MAKSSKHYLPNGKEYMGATHKMDGQVHTGAKHSASSKVLKHAKPRKK* |
| Ga0049085_101121744 | 3300005583 | Freshwater Lentic | MGKSSKHYLANGKEYMGATHKMDGQVHTGAKHSTSSKVLTHTKPMPKKKK* |
| Ga0049085_101859222 | 3300005583 | Freshwater Lentic | MGKSSKHYLPNGKEYMGAVHKMDGKPYSGAKHSASSKALKHTKPKEK* |
| Ga0049085_102393943 | 3300005583 | Freshwater Lentic | MSASSKHYLPSGKEFTGARHKMNGQIHTGAKHTASSKVLTHAKPKKT* |
| Ga0049085_102543172 | 3300005583 | Freshwater Lentic | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKPKKVK* |
| Ga0049082_102115231 | 3300005584 | Freshwater Lentic | EKIMPKSSKHYLPNGKEYKGAIHKMNGQVHTGAMHSASSKVLKHTKPKKK* |
| Ga0073912_10043375 | 3300006003 | Sand | KASTHYLKNGKVHTGPVHKMNGQVHTGATHTASSKVLTHTKPKAKKK* |
| Ga0102934_10104729 | 3300007537 | Pond Soil | MVKKKYYLPSGKMYKGATHRMNGKVHSGAKHTASSKVLSSKKPKKKK* |
| Ga0102927_11771133 | 3300007611 | Pond Water | MVKKKYYLPSGKIYKGATHKMNGQVHSGAKHTASSKVLSSKKPKKKK* |
| Ga0102937_10225031 | 3300007628 | Pond Soil | MVKKKYYLPSGKMYKGATHRMNGKVHSGAKHTASSKVLSSKKPKK |
| Ga0104988_1093913 | 3300007735 | Freshwater | VSKTAKHYLKNGKEYKGPIHKMNGQIHTGAKHTAASKVLTHRKPKKV* |
| Ga0114340_100358114 | 3300008107 | Freshwater, Plankton | MVMAPKSKHYLKSGKEYKGPVHKMNGQVHTGAKHTAASKVLTHRKPKKGK* |
| Ga0114340_10725833 | 3300008107 | Freshwater, Plankton | MSKTSKHFLPNGKEYTGAIHKTNGKAMTGAKHTASSKPLSHTPPKKAKK* |
| Ga0114354_10717111 | 3300008119 | Freshwater, Plankton | KTSKHYLKSGKEYKGAVHRMNGEVHTGAKHTASSKVLTHSKPKKVKK* |
| Ga0114337_10545472 | 3300008262 | Freshwater, Plankton | MAPKSKHYLKSGKEYKGPVHKMNGQVHTGAKHTAASKVLTHRKPKKGK* |
| Ga0114876_10268869 | 3300008448 | Freshwater Lake | MSKTSKHYLKSGKLYTGAVHRMDGQVHTGATHSASSKVLTHTKPKAKKVK* |
| Ga0102930_11071981 | 3300008963 | Pond Water | MVKKKYYLPSGKMYKGATHRMNGKVHSGAKHTASSKV |
| Ga0114980_1000799715 | 3300009152 | Freshwater Lake | MSKSSKHYLPNGKEYMGATHKMDGQIHTGAKHTASSKVLKHTKPKKK* |
| Ga0114963_102524374 | 3300009154 | Freshwater Lake | MSKTSKHYLKSGKLYTGPIHKTGGKPMTGATHTAASKPLTHTKPKKVK* |
| Ga0114968_100575527 | 3300009155 | Freshwater Lake | MSASSKHYLPSGKEYKGPVHKMDGKVHTGAKHTAASKLVTHTKPKGKK* |
| Ga0114977_100358107 | 3300009158 | Freshwater Lake | MSKTSKHYLKNGKEYKGPVHKMNGQVHTGATHTAASKVLTHTKPKAKKK* |
| Ga0114959_100642493 | 3300009182 | Freshwater Lake | MSKTSKHYLKSGKLYTGPIHKTGGKPMTGATHTATSKPLTHTKPKKVK* |
| Ga0114967_102775611 | 3300010160 | Freshwater Lake | KTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKPKKVK* |
| Ga0151516_1048830 | 3300011116 | Freshwater | VSKTAKHYLKNGKEYKGPVHKMNGQVHTGAKHTAASKVLTHRKPKKVK* |
| Ga0153799_10027036 | 3300012012 | Freshwater | MAASSKHYLPNGKEHKGPVHTNNGQVMTGAKHSESSKNLSHTKPKKTGSK* |
| Ga0153799_10699292 | 3300012012 | Freshwater | LPNGKEYKGATHKMNGQVHTGAKHSPSSKVLKHSKPKKK* |
| Ga0153801_10264963 | 3300012017 | Freshwater | MAKSSKHYLPNGKEYMGATHKMDGQVHTGAKHSASSKVLKHTKPKKK* |
| Ga0153801_10531752 | 3300012017 | Freshwater | MGKTSKHYLPSGKEYKGATHKMDGQVHSGAKHSASSKVLKHNKPKKK* |
| Ga0164293_109994852 | 3300013004 | Freshwater | MAMNSKHYLPSGELYKGPVHKMNGELHSGAKHSDASQVLSHSEGKGVKKKK |
| Ga0177922_105195761 | 3300013372 | Freshwater | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLT |
| Ga0177922_106780022 | 3300013372 | Freshwater | MAKSSKHYLPSGKEYKGATHKMDGQVHSGAKHSASSKVLKHSKPKKAGK* |
| Ga0181338_10408883 | 3300015050 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHKMDGQVHTGAKHTASSKVLKHTKPKKK* |
| Ga0181338_10575602 | 3300015050 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHKMNGQVHTGAKHSASSKALKHTQPKKK* |
| Ga0181364_10456742 | 3300017701 | Freshwater Lake | MSKTSKHYLKSGKEYKGAVHRMNGQVHTAAKHSASSKVLTHSKPKKVKK |
| Ga0181364_10677292 | 3300017701 | Freshwater Lake | MGKSSKHYLPNGKEYMGAIHKMDGKPYSGAKHSASSKALKHTKPKKK |
| Ga0181350_10215312 | 3300017716 | Freshwater Lake | MGKSSKHYLPSGKEYKGATHKMDGQVHTGATHSASSKVLKHTKPKKK |
| Ga0181350_10572544 | 3300017716 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHKMDGKPYSGAKHSASSKPLKHTKPKKK |
| Ga0181350_10685662 | 3300017716 | Freshwater Lake | MGKTSKHYLSSGKLFTGATHKMNGQIHTGASHTASSKVLSHTKPKAKAKK |
| Ga0181350_10837044 | 3300017716 | Freshwater Lake | MGKSSKHYLPSGKEYKGATHKMNGQVHSGAKHSAS |
| Ga0181350_11438711 | 3300017716 | Freshwater Lake | MGKSSKHYLPSGKEYKGATHRMNGQVHTGAKHSASSKVLKHSKPKKK |
| Ga0181347_11306953 | 3300017722 | Freshwater Lake | MPKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTH |
| Ga0181347_11339643 | 3300017722 | Freshwater Lake | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKPKKK |
| Ga0181362_10341591 | 3300017723 | Freshwater Lake | EKVMGKSSKHYLPNGKEYMGAIHKMDGKPYSGAKHSASSKPLKHTKPKEK |
| Ga0181362_10390521 | 3300017723 | Freshwater Lake | HYLPNGKEHKGPVHKMNGQVHTGAKHTAASKVLTHSKPKKK |
| Ga0181362_10997991 | 3300017723 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHKMDGQVHTGAKHTASSKVLKHTKPKTK |
| Ga0181362_11072511 | 3300017723 | Freshwater Lake | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGATHSASSKVL |
| Ga0181365_10024321 | 3300017736 | Freshwater Lake | MSKTSKHYLKSGKLYTGAVHRMNGQVHTGATHSASSKVLTHTKPKAKKVK |
| Ga0181365_10310261 | 3300017736 | Freshwater Lake | MSKTAKHYLPSGKEYTGATHKMNGQVHTGAKHSASSKVLKHTKPKKA |
| Ga0181365_10632631 | 3300017736 | Freshwater Lake | LTSQSRQVLKGKPAKMSKTTKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKPKKVK |
| Ga0181365_10832241 | 3300017736 | Freshwater Lake | MAKSSKHYLPNGKQYMGATHRMNGQVHTGAKHSDSSKVLTHSKPKKAGK |
| Ga0181365_11282763 | 3300017736 | Freshwater Lake | MAPTAKHFLPNGKEYKGATHKMNGQVHTGATHSASSKVLKHSTPKKKK |
| Ga0181365_11543343 | 3300017736 | Freshwater Lake | MGKSSKHYLANGKEYKGAIHKMDGQVHTGAKHSASSKILTHSK |
| Ga0181365_11609772 | 3300017736 | Freshwater Lake | MGKSSKHYLPNGKEYKGATHKMDGQVHTGAKHSASSKVLKHSKAKKS |
| Ga0181365_11677323 | 3300017736 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHKMDGQVHTGAKHTASSKVLKHTK |
| Ga0181365_11695394 | 3300017736 | Freshwater Lake | MSKTAKHYLPSGKEYTGATHKMNGQVHTGAKHSASSKVLK |
| Ga0181356_10965131 | 3300017761 | Freshwater Lake | KHYLPNGKEYKGATHKMDGQVHTGAKHSASSKVLKHTKPKKN |
| Ga0181356_11670843 | 3300017761 | Freshwater Lake | MGKSSKHYLPNGKEYMGAVHKMDGKPYSGAKHSASSKALKHTQPKKK |
| Ga0181356_12029312 | 3300017761 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHKMDGQIHTGAKHSASSKVLKHTKPKEK |
| Ga0181356_12221512 | 3300017761 | Freshwater Lake | MAKSSKHYLPSGKEYKGATHRMNGQVHTGAKHSASSKVLKHSKPKKK |
| Ga0181358_10605142 | 3300017774 | Freshwater Lake | MSATKKHYLPNGKEYKGATHKEGSMLMTGEKHTATSKKLNHTKSKDMK |
| Ga0181358_10728494 | 3300017774 | Freshwater Lake | MGKSSKHYLANGKEYKGAIHKMNGQVHTGAMHSASSKVLTHSKPKKK |
| Ga0181358_10755293 | 3300017774 | Freshwater Lake | MGKSSKHYLSSGKEYKGATHKMNGQVHTGAKHSASSKVLKHSKPKKK |
| Ga0181358_11076551 | 3300017774 | Freshwater Lake | MVMSKTSKHYLKSGKEYTGAVHRMNGQVHTGATHTA |
| Ga0181358_11442672 | 3300017774 | Freshwater Lake | MAKSSKHYLPNGKQYMGATHKMNGQVHTGAKHSDSSKVLTHSKPKKK |
| Ga0181357_10349554 | 3300017777 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHRMDGQVHTGAKHSASSRVLKHSKPKKK |
| Ga0181357_11076541 | 3300017777 | Freshwater Lake | MGKSSKHYLANGKEYKGAIHKMDGQVHTGAKHSPSSKVLKHSKPKKK |
| Ga0181357_11504841 | 3300017777 | Freshwater Lake | MPKSSKHYLPNGKEYKGAIHKMNGQVHTGAMHSASSKVLSHSKPKKK |
| Ga0181357_11734222 | 3300017777 | Freshwater Lake | MAASSKHYLASGKLHKGAVHRMNGQIHTGAKHTAASKVLTHTKPKGSAKTVMGRKGK |
| Ga0181357_11804731 | 3300017777 | Freshwater Lake | MPKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTAS |
| Ga0181357_12041594 | 3300017777 | Freshwater Lake | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGATHSASSKVLTHTKPKAKKK |
| Ga0181357_12257613 | 3300017777 | Freshwater Lake | MAKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKPKKK |
| Ga0181357_12505264 | 3300017777 | Freshwater Lake | MAKSSKHYLPNGKEYTGATHKMDGQVHTGAKNSASSKVLKHTKPKKK |
| Ga0181357_12681003 | 3300017777 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHKMDGQVHTGAKHSASSKVLKHTKPKKK |
| Ga0181357_12682023 | 3300017777 | Freshwater Lake | MGKSSKHYLPSGKEYKGATHKMDGQVHTGAKHSASSKVLKHAKPKK |
| Ga0181349_10661101 | 3300017778 | Freshwater Lake | KSSKHYLPNGKEYMGATHKMDGQIHTGAKHSASSKALKHTQPKKK |
| Ga0181349_10696383 | 3300017778 | Freshwater Lake | MGKSSKHYLPSGKEYKGATHKMDGQVHSGAKHSASSKVLKHTKPKEK |
| Ga0181349_12072221 | 3300017778 | Freshwater Lake | HGSSEEKVMGKSSKHYLPNGKEYMGATHKMDGQVHTGAKHTASSKVLKHTKPKKN |
| Ga0181349_12556951 | 3300017778 | Freshwater Lake | MPKSSKHYLPNGKEYKGAIHKMNGQVHTGAKHTTSSIPLKHSKPKKK |
| Ga0181349_13154053 | 3300017778 | Freshwater Lake | MGKSSKHYLPNGKEYKGATHKMDGQVHTGATHSASSKVLKHT |
| Ga0181346_10840105 | 3300017780 | Freshwater Lake | KHYLPNGKQYMGATHKMNGQVHTGAKHSDSSKVLTHSKPKKK |
| Ga0181346_10995015 | 3300017780 | Freshwater Lake | MAKSSKHYLPNGKQYMGATHKMNGQVHTGAKHSDSSKVLTHSKPK |
| Ga0181346_11933392 | 3300017780 | Freshwater Lake | MGKSSKHYLANGKEYKGAIHKMDGQVHTGAKHSTSSKILTHSKPRKKK |
| Ga0181346_11958244 | 3300017780 | Freshwater Lake | MGKSSKHYLPNGKEYKGATHKMDGQVHTGAKHTASSKVLKHTKPKK |
| Ga0181346_13028803 | 3300017780 | Freshwater Lake | MSKTSKHYLKSGKEYKGAVHRMNGEVHTGAKHTASSKVLTHSKPKKVK |
| Ga0181346_13273132 | 3300017780 | Freshwater Lake | MPKTSKHYLPSGKEYKGATHKMNGQVHTGAKHTASSKVLKHSKPKKK |
| Ga0181348_10448865 | 3300017784 | Freshwater Lake | MGKSSKHYLANCKEYKGAIHKMNGQVHTGAMHSASSKVLTHSK |
| Ga0181348_10977415 | 3300017784 | Freshwater Lake | MGKTSKHYSSSGKLFTGATHKINGQIHTGASHTASSKVLSHSKPKAKAKK |
| Ga0181348_11549012 | 3300017784 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHKMDGKPYSGAKHSASSKALKHSKPKKK |
| Ga0181348_11878083 | 3300017784 | Freshwater Lake | MAKSSKHYLPNGKEYKGATHKMDGQVHTGATHSASS |
| Ga0181348_12146954 | 3300017784 | Freshwater Lake | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKP |
| Ga0181355_10919703 | 3300017785 | Freshwater Lake | MGKSSKHYLPSGKEYKGATHKMDGQVHTGAKHSASSKVLKHTKPKKK |
| Ga0181355_11417573 | 3300017785 | Freshwater Lake | MAPNKKHFLPNGKEYKGATHKMNGQVHTGATHSASSKVLKHTPPKKK |
| Ga0181355_12299911 | 3300017785 | Freshwater Lake | DSKHYLPNGKEHKGPVHKMNGQVHTGAKHTAASKVLTHSKPKKK |
| Ga0181355_12702281 | 3300017785 | Freshwater Lake | MAKNSKHYLANGKEYTGATNKMNGQVHTGATHSASSKVLKHSTPKKKK |
| Ga0181355_12761733 | 3300017785 | Freshwater Lake | KSSKHYLPNGKEYKGATHKMDGQVHTGATHSASSKVLKHTKPKKK |
| Ga0181359_10055584 | 3300019784 | Freshwater Lake | MGADSKHYLPNGKEHKGPVHKMNGQVHTGAKHTAASKVLTHSKPKKK |
| Ga0181359_10087786 | 3300019784 | Freshwater Lake | MGKSSKHYLPNGKEYKGATHKMDGQVHTGAKHTASSKILKHTKPKKSNG |
| Ga0181359_10194967 | 3300019784 | Freshwater Lake | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTTSSKVLTHTKPKKAK |
| Ga0181359_10477363 | 3300019784 | Freshwater Lake | MSKTSKHYLKSGKEYTGAIHKMNGQVHTGAKHTASSKVLTHTKPKKK |
| Ga0181359_10631935 | 3300019784 | Freshwater Lake | MSKTSKHYLKSGKEYKGAVHRMDGQVHTGAKHTASSKVLTHSKPKKVKK |
| Ga0181359_10704696 | 3300019784 | Freshwater Lake | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKPKKVK |
| Ga0181359_11026063 | 3300019784 | Freshwater Lake | MPKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKPKKVK |
| Ga0181359_11153422 | 3300019784 | Freshwater Lake | MSKTSKHYLANGKEHTGPVHKMNGQIHTGAKHSAKSKVVTHSKPKSAKK |
| Ga0181359_11186542 | 3300019784 | Freshwater Lake | MAKNSKHYLANGKEYTGATHKMNGQVHTGATHSASSKVLKHTPPKKKK |
| Ga0181359_11285572 | 3300019784 | Freshwater Lake | MSKTSKHYLKSGKEYKGAVHRMNGQVHTGAKHTASSKVLTHSKPKKVKK |
| Ga0181359_11708083 | 3300019784 | Freshwater Lake | VLKGKPAKMSKTTKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKPKKVK |
| Ga0181359_11971612 | 3300019784 | Freshwater Lake | MSKTSKHYLKSGKEYKGAVHRMNGEVHTGAKHTASSKVLTHSKPKKVKK |
| Ga0181359_12036012 | 3300019784 | Freshwater Lake | MSKTSKHYLKSGKEYKGAVHRMNGQVHTGAKHTASSKILTHSKPKKVKK |
| Ga0181359_12111962 | 3300019784 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHKMDGKPYSGAKHSASSKALKHTQPKKK |
| Ga0181359_12119002 | 3300019784 | Freshwater Lake | MGKSSKHYLSSGKEYKGATHRMNGQVHTGAKHSASSKVLKHSKPKKK |
| Ga0181359_12177532 | 3300019784 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHRMDGQVHTGAKHSASSKVLKHTKPKKK |
| Ga0181359_12733722 | 3300019784 | Freshwater Lake | MSRTSKHYLKNGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKPKKVK |
| Ga0181359_12735292 | 3300019784 | Freshwater Lake | MGKSSKHYLPNGKEYMGAIHKMDGKPYSGAKHSASSKALKHTQPKKK |
| Ga0181354_10223683 | 3300022190 | Freshwater Lake | MGKSSKHYLPNGKEYKGATHKMDGQVHTGATHSASSKVLKHTKPKKK |
| Ga0181354_11145733 | 3300022190 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHKMDGQVHTGAKHTASSKVLKHTKPKKN |
| Ga0181354_11380292 | 3300022190 | Freshwater Lake | MPKSSKHYLPNGKEYKGAIHKMDGQVHTGAKHSASSKILTHSKPKKK |
| Ga0181354_11683653 | 3300022190 | Freshwater Lake | SEEKIMGKSSKHYLPNGKEYMGATHKMDGKPYSGAKHSASSKALKHTQPKKK |
| Ga0181354_11767661 | 3300022190 | Freshwater Lake | MPKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKP |
| Ga0181351_10348074 | 3300022407 | Freshwater Lake | MGKSSKHYLPNGKEYMGAVHKMDGKPYSGAKHSASSKALKHAKPKKK |
| Ga0181351_10426744 | 3300022407 | Freshwater Lake | MAKSSKHFLPNGKEYTGATHKMNGQVHTGATHSASSKVLKHTAPKVKKK |
| Ga0181351_10757205 | 3300022407 | Freshwater Lake | MGADSKHYLPNGKEHKGPVHKMNGQVHTGAKHTAASKVLTHSKPKK |
| Ga0181351_10797681 | 3300022407 | Freshwater Lake | MSKTSKHYLKSGKEYTGAIHKMNGQVHTGAKHTASSKVLTHTKPKKN |
| Ga0181351_11289553 | 3300022407 | Freshwater Lake | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGATHSASSKVLTHTKPKTKKK |
| Ga0181351_11422285 | 3300022407 | Freshwater Lake | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKPKKA |
| Ga0181351_11695021 | 3300022407 | Freshwater Lake | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTH |
| Ga0181351_12236021 | 3300022407 | Freshwater Lake | KHYLKSGKEYTGAIHKMNGQVHTGAKHTASSKVLTHTKPKKK |
| Ga0255147_100012032 | 3300024289 | Freshwater | MSKTSKHYLKSGKEYKGPIHKMNGQIHTGAKHTDASKVLTHKKPKKAK |
| Ga0256330_10391981 | 3300024481 | Freshwater | KTSKHYLKSGKEYKGPIHKMNGQIHTGAKHTDASKVLTHKKPKKAK |
| Ga0208160_10811621 | 3300025647 | Aqueous | RAVGKALKHYLPSGKEYKGATHKMNGQVHTGAKHTASSKVLKHTKPKKK |
| Ga0209937_100023111 | 3300026094 | Pond Water | MVKKKYYLPSGKIYKGATHKMNGQVHSGAKHTASSKVLSSKKPKKKK |
| Ga0209937_10101386 | 3300026094 | Pond Water | MVKKKYYLPSGKMYKGATHRMNGKVHSGAKHTASSKVLS |
| Ga0209938_11952502 | 3300026180 | Pond Soil | MVKKKYYLPSGKMYKGATHRMNGKVHSGAKHTASSKVLSSKKPKKKK |
| Ga0255105_10402484 | 3300027143 | Freshwater | SKHYLPSGKEYKGATHKMDGQVHSGAKHSASSKVLKHTKPKKK |
| Ga0208966_11619283 | 3300027586 | Freshwater Lentic | MPKSSKHYLPNGKEYKGAIHKMNGQVHTGAMHSASSKVLKHTKPKKK |
| Ga0208942_11195854 | 3300027627 | Freshwater Lentic | MGKSSKHYLANGKEYMGATHKMDGQVHTGAKHSTSSKVLTHTKPMPKKKK |
| Ga0208942_11265283 | 3300027627 | Freshwater Lentic | MAKSSKHYLPNGKEYMGATHKMDGQVHTGAKHSASSKVLKHAKPRKK |
| Ga0208942_11436423 | 3300027627 | Freshwater Lentic | MAKSSKHYLPNGKEYMGAIHKMDGKPYSGAKHSASSKVLKHSKPKKK |
| Ga0208942_12065971 | 3300027627 | Freshwater Lentic | LANGKEYKGAIHKMNGQVHTGAMHSASSKPLTHSKPKKKK |
| Ga0209135_11329171 | 3300027642 | Freshwater Lake | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTTSS |
| Ga0208960_10800444 | 3300027649 | Freshwater Lentic | KISKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKPKKK |
| Ga0209769_11155224 | 3300027679 | Freshwater Lake | MSKTTKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTKPKKVK |
| Ga0209769_12552761 | 3300027679 | Freshwater Lake | MSKTSKHYLKSGKEYKGAVHRMNGQVHTGAKHSASSK |
| Ga0209553_11968142 | 3300027688 | Freshwater Lake | MAASSKHYLPNGKEHKGPVHTNNGQVMTGAKHSESSKNLSHTKPKKTGSK |
| Ga0209188_10570465 | 3300027708 | Freshwater Lake | MSKTSKHYLKSGKLYTGPIHKTGGKPMTGATHTATSKPLTHTKPKKVK |
| Ga0209442_12802851 | 3300027732 | Freshwater Lake | MSKTSKHYLKSGKEYKGAVHRMNGQVHTGAKHTASSKILTHSK |
| Ga0209297_10624463 | 3300027733 | Freshwater Lake | MSKTSKHYLKNGKEYKGPVHKMNGQVHTGATHTAASKVLTHTKPKAKKK |
| Ga0209355_11109853 | 3300027744 | Freshwater Lake | MPKSSKHYLPSGKEYKGAIHKMDGQVHTGAKHSASSKILTHSKPRKKK |
| Ga0209086_100776773 | 3300027770 | Freshwater Lake | MSASSKHYLPSGKEYKGPVHKMDGKVHTGAKHTAASKLVTHTKPKGKK |
| Ga0209768_101158411 | 3300027772 | Freshwater Lake | KSSKHYLPNGKEYKGAIHKMDGQVHTGAKHSASSKILTHSKPKKK |
| Ga0209768_102249122 | 3300027772 | Freshwater Lake | MGASSKHYLPNGKEHKGPVHTNNGQVMTGAKHSESSKNLSHTKPKKTGSK |
| Ga0209246_101249266 | 3300027785 | Freshwater Lake | MAKSSKHYLSSGKEYKGATHRMNGQVHTGAKHTSS |
| Ga0209246_101940944 | 3300027785 | Freshwater Lake | IMGKSSKHYLPNGKEYMGAIHKMDGKPYSGAKHSASSKALKHAKPKKK |
| Ga0209353_100700123 | 3300027798 | Freshwater Lake | KTSKHYLPSGKEYKGATHKMNGQVHTGAKHTASSKVLKHSKPKKK |
| Ga0209353_100855981 | 3300027798 | Freshwater Lake | SSKHYLPNGKEYMGAIHKMDGKPYSGAKHSASSKPLKHTKPKEK |
| Ga0209353_100879542 | 3300027798 | Freshwater Lake | MAKNSKHYLANGKEYTGATHKMNGQVHTGATHSASSKVLKHSAPKKKMK |
| Ga0209353_101710311 | 3300027798 | Freshwater Lake | YLPNGKEYKGATHKMNGQVHTGAKHSPSSKVLKHSKPKGK |
| Ga0209353_103047602 | 3300027798 | Freshwater Lake | MAASSKHYLASGKLHKGAVHRMNGQIHTGAKHTAASKVLTHTKPKGSAKTVMGRKEK |
| Ga0209353_103791312 | 3300027798 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHKMDGKPYSGAKHSASSKALKHTKPKKK |
| Ga0209354_100425574 | 3300027808 | Freshwater Lake | MGKSSKHYLPNGKEYMGATHKMNGQVHTGAKHTASSKVLKHTKPKKK |
| Ga0209354_100668771 | 3300027808 | Freshwater Lake | MGKSSKHYLPNGKEYKGATHKMDGQVHTGAKHTASS |
| Ga0209354_103403423 | 3300027808 | Freshwater Lake | MSKTSKHYLKSGKLYTGAVHRMNGQVHTGATHSASSKVLTHTKPK |
| Ga0209354_103784681 | 3300027808 | Freshwater Lake | SKEKVMGKSSKHYLPNGKEYMGAIHKMDGKPYSGAKHSASSKALKHTQPKKK |
| Ga0209298_1000029815 | 3300027973 | Freshwater Lake | MSKSSKHYLPNGKEYMGATHKMDGQIHTGAKHTASSKVLKHTKPKKK |
| Ga0119944_10092982 | 3300029930 | Aquatic | MAPKSKHYLKSGKEYKGPVHKMNGQVHTGAKHTAASKVLTHRKPKKGK |
| Ga0308010_10450903 | 3300031510 | Marine | MAAGMKHYLPNGKEYKGPTHKANGKLMTGAKHTSSSKNLGHKPKGKAK |
| Ga0308010_13317641 | 3300031510 | Marine | MAAGMKHYLPNGKEYKGPTHKANGKLMTGAKHTSSSKNLGHKPK |
| Ga0307380_101136866 | 3300031539 | Soil | MPKSSKHYLPSGKEYKGATHKMNGQVHTGAKHTASSKVLKHTKPKKK |
| Ga0307380_102881964 | 3300031539 | Soil | MAPKSKHYLKSGKEYKGPVHKMNGQVHTGAKHTAASKVLTHRKPKEGK |
| Ga0307378_111013372 | 3300031566 | Soil | MPKLSKHYLPSGKEYKGATHKMNGQVHTGAKHTASSKVLKHTKPRKK |
| Ga0307376_105086771 | 3300031578 | Soil | MPKSSKHYLPSGKEYKGATHKMNGQVHTGAKHTASSRV |
| Ga0315291_103413033 | 3300031707 | Sediment | MGKLSKHYLPNGKEYKGATHKMDGQVHTGATHSASSKVLKHTKPKKK |
| Ga0315291_105560073 | 3300031707 | Sediment | MGKSSKHYLPNGKEYMGATHKMDGQVHTGAKHSASSKPLKHTKPKKK |
| Ga0315293_102519042 | 3300031746 | Sediment | MGKTSKHYLSSGKLFTGATHKMNGQIHTGASHTASSKVLSHSKPKAKAKK |
| Ga0315293_106391342 | 3300031746 | Sediment | MGKTSKHYLSSGKLFTGATHKMNGQIHTGASHTASSKVLTHTKPKAKAKK |
| Ga0315294_102053684 | 3300031952 | Sediment | MAKSSKHYLPSGKLYTGATHKMDGKIHSGASHSASSKVLTHSKPKAKKAK |
| Ga0315294_102537675 | 3300031952 | Sediment | MGKSSKHYLPSGKEYMGATHKMNGQVHTGATHSASSKVLKHTKPKKK |
| Ga0315294_114980862 | 3300031952 | Sediment | MAKSSKHYLPNGKEYMGATHKMDGQVHTGAKHSASSKVLKHTKPKKK |
| Ga0315274_102286085 | 3300031999 | Sediment | MGKSSKHYLPNGKEYKGATHKMDGQVHTGAKHSASSKVLKHTKSKKQ |
| Ga0315274_108573182 | 3300031999 | Sediment | MGKLSKHYLPNGKEYKGATHKMDGQVHTGANHSASSKVLKHTKPKKK |
| Ga0315274_116505942 | 3300031999 | Sediment | MGKSSKHYLPNGKEYKGATHKMDGQVHSGAKHSASSKVLKHTKPKKK |
| Ga0315289_101890222 | 3300032046 | Sediment | MAKSSKHYLPSGKLYTGATHKMGGKIHSGASHSASSKVLTHTKPKAKKK |
| Ga0315284_107268191 | 3300032053 | Sediment | MSKTSKHYLKSGKEYTGAVHRMNGQVHTGAKHTASSKVLTHTK |
| Ga0315284_116918103 | 3300032053 | Sediment | MAKSSKHYLPSGKLYTGATHKMDGKIHSGASHSASSKVLTHSKPKAKK |
| Ga0315277_110707824 | 3300032118 | Sediment | MGKSSKHYLPNGKEYMGATHKMDGQVHTGAKHTASSKVLK |
| Ga0315277_113530042 | 3300032118 | Sediment | MAKSSKHYLPSGKLYTGATHKMGGKIHSGVAHSASSKVLTHTKPKAKKGK |
| Ga0315268_101636073 | 3300032173 | Sediment | MGKSSKHYLANGKEYMGATHRMDGQVHTGAKHSTSSKVLTHTKPMPKKKK |
| ⦗Top⦘ |