 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F022340 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 214 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MHADTSFRNGSGASTKWRETFENMSFGPKVVDWACSLLENKKRF |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 211 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 77.10 % |
| % of genes from short scaffolds (< 2000 bps) | 95.33 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.065 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere (41.121 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.776 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (77.570 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.07 % |
| All Organisms | root | All Organisms | 0.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 41.12% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 37.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.80% |
| Fungus Garden | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden | 2.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.40% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010269 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 13_49_3.3_201_A3 metaG | Engineered | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012996 | Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta capiguara ACBM2 | Host-Associated | Open in IMG/M |
| 3300013000 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM1 | Host-Associated | Open in IMG/M |
| 3300013022 | Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta bisphaerica ABBM3 | Host-Associated | Open in IMG/M |
| 3300013025 | Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta bisphaerica ABBM2 | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300020031 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028057 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028063 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028256 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028464 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028466 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028525 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032590 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070666_104094413 | 3300005335 | Switchgrass Rhizosphere | MYADTSFRNGSGALTKWRETFEIMSFGPKVVDWACSLLESKKRFWRHKLVH* |
| Ga0070668_1008262922 | 3300005347 | Switchgrass Rhizosphere | MHADTSFRNRSGASTKWIETFENMSFGPKVVDWACSLLKNKK |
| Ga0070668_1016579861 | 3300005347 | Switchgrass Rhizosphere | MHANTSFRNRSGASTKWRETFENMSFGPKVVDWACSLLENKK |
| Ga0070671_1003944841 | 3300005355 | Switchgrass Rhizosphere | ADTSFHNRSGALTKWRETFENMNFGPKVVDWTCSLLENKKRFRRHKLVP* |
| Ga0070671_1003944844 | 3300005355 | Switchgrass Rhizosphere | MHADTSFRNGSGASTKWRETIKNMSFGPKVVDWAGSLLENKKQFWRHKLVQ* |
| Ga0070671_1008876582 | 3300005355 | Switchgrass Rhizosphere | FNQMHADTSSRNGSGASTKWRETTENMSFGSKVVDWACLLLENKKRFGRHKLVQ* |
| Ga0070688_1011920201 | 3300005365 | Switchgrass Rhizosphere | MHADTSFRNRSGASTKWRETFENMSFRPKVVDWACSLLENKKQF* |
| Ga0070706_1021172122 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MHADSSFCNGSGASTKWRETFENMSFGPKVVDWACSLLENKKR |
| Ga0070707_1018233222 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TFNQMHANTSFRNRSGASTKWRETFDNMSFGPKVVDWACSLLENKKRFWRHKHVH* |
| Ga0070665_1026040661 | 3300005548 | Switchgrass Rhizosphere | MHANTSFHNRSGASTKWRETFENMSFGPKVVDWACSLLENKK |
| Ga0070704_1002212503 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MHADTSFRNGSGASTKLRETFKNMSFGPKVVDWACSVLENKKWF* |
| Ga0068864_1024189331 | 3300005618 | Switchgrass Rhizosphere | MHADTSFRNGSGASTKWRETFENMSFGPKVVDWACSLLENKKRFWRHKLVH* |
| Ga0068861_1005103372 | 3300005719 | Switchgrass Rhizosphere | MHANTSFRNRSGASTKWRETFENMSFGPKVVDWAYSLLENKKLFWRHKLVH* |
| Ga0068863_1007691303 | 3300005841 | Switchgrass Rhizosphere | MHADTSFRNGSGASTKWRETFEIMSFGPKVVDWACSLLESKKRFWRHKLVH* |
| Ga0068863_1010600381 | 3300005841 | Switchgrass Rhizosphere | MHANTSFRNRSGASTKWRKTFENMSFGPKVVDWACLLLQNKKRF |
| Ga0068863_1020468411 | 3300005841 | Switchgrass Rhizosphere | MHADTSFRNRSGALTKWRETTKNMNFGPKVVDLACSLLEN |
| Ga0068863_1024384121 | 3300005841 | Switchgrass Rhizosphere | NTSFRNRSGASTKWHETFENMSFGPKVVDWAYSLLENKKRF* |
| Ga0068863_1025212151 | 3300005841 | Switchgrass Rhizosphere | MHADSSFCNGSGASTKWRETFENMSFGPKVVDWACSLLENKKQF |
| Ga0068860_1009809771 | 3300005843 | Switchgrass Rhizosphere | MHADTSFRNGSGASTKWRETFENMSFGPKVVDWACSLLENKKQFWRHKFMH* |
| Ga0068860_1010572531 | 3300005843 | Switchgrass Rhizosphere | MHVDTSFRNGSGASTKWRETLENMSFGPKVVDWAYSLLKNKKQF* |
| Ga0068860_1019968932 | 3300005843 | Switchgrass Rhizosphere | TSFRNGSGASTKWRETFENMSFGPKVVDWACSLLENKKRFWRHKLMH* |
| Ga0105251_102500631 | 3300009011 | Switchgrass Rhizosphere | NGSGASTKLRETFKNMSFGPKVVDWACSVLENKKRC* |
| Ga0134102_10801601 | 3300010269 | Switchgrass Degrading | MHADTSFRNGSGASTKLRETFKNMSFGPKVVDWAY |
| Ga0134125_118831431 | 3300010371 | Terrestrial Soil | MHPDTSFCNGLGASKKWRETPQNMSFGPKVVDWACSLL |
| Ga0134127_107779471 | 3300010399 | Terrestrial Soil | MHADSSFCNGSGASTKWRETFENMSFGPKVVDWACSLLEN |
| Ga0134122_116642801 | 3300010400 | Terrestrial Soil | MHVDTSFRNMSGASTKWRKTFENMSFGPKVVDWAC |
| Ga0134122_116642803 | 3300010400 | Terrestrial Soil | ETFNQMHVDTSFRNMSGASTKWRKTFENMSFGPKVVDWACLLQKTKKLF* |
| Ga0134123_109049521 | 3300010403 | Terrestrial Soil | MHADTSFRNGSGASTKWRETFENMSFGPKVVDWACSLLENKK |
| Ga0134123_134545861 | 3300010403 | Terrestrial Soil | MHADTSFRNGTSASMKWRETYENMSFGPKVVDWACSLLENKKRFWRQKLVH |
| Ga0157358_10961951 | 3300012996 | Fungus Garden | MHHDTLFQNGSRAATKWRETMPNMSFEPKVVDWACSLQKNKKWFRQNKVIP |
| Ga0157360_12501481 | 3300013000 | Fungus Garden | HPDTHFRNGSRAATKWRETTPNLSLGPKEVDWAYSLQKNKKWFR* |
| Ga0157368_10714651 | 3300013022 | Fungus Garden | PDTRFRNGSRAATKWRETTPNMSFGPKVVDWACSLRKNKKWF* |
| Ga0157367_12140141 | 3300013025 | Fungus Garden | MPCIHHDIRFRNGSRAATKWRETTTNMSFGPKEVD |
| Ga0157367_12999082 | 3300013025 | Fungus Garden | YMHPDTRFRNGSRAATNWRETTPNMSFGPNVVDWAGSLRKNKKWF* |
| Ga0157367_13011351 | 3300013025 | Fungus Garden | MHPDTRFRNGSRAATKRHETTPNMSFGPKEVDWACSLLKNKNWFQGHKLMP |
| Ga0163162_120624891 | 3300013306 | Switchgrass Rhizosphere | MHADTSFCNGSGASTKWRETFENMSFGPKVVDWACSLLENKKRF |
| Ga0163163_127756871 | 3300014325 | Switchgrass Rhizosphere | MHADTSFHNRSGALTKWCETFENMSFGSKVADWACS |
| Ga0182183_10156271 | 3300015270 | Switchgrass Phyllosphere | MHADTSFRNGSGASTKWRETFENMSFGPKVVDWACSLLENKKRFW |
| Ga0182183_10281072 | 3300015270 | Switchgrass Phyllosphere | QMHPDTSFRNGSGASTKSRETTQNMSFEPKVADWECPFAENKKQFWRHKLVH* |
| Ga0182183_10328571 | 3300015270 | Switchgrass Phyllosphere | MHADTSFRNGSGASTKWRETFENLSFGPKVVDWARSLLENKKRFWRQKLVH* |
| Ga0182100_10582171 | 3300015280 | Switchgrass Phyllosphere | MYADNSFRNGSGASTKWCETFENMSFGPKVVDWACSLLENKKRFWSYKLVH* |
| Ga0182101_10082201 | 3300015284 | Switchgrass Phyllosphere | MHADTSFRNGSGASTEWRETFKNMSFGPKVVDWACSLEQNNKRF |
| Ga0182101_10082203 | 3300015284 | Switchgrass Phyllosphere | TSFRNGSGASTEWRETFKNMSFGPKVVDWACSLEQNNKRFWMHKLVH* |
| Ga0182103_10135121 | 3300015293 | Switchgrass Phyllosphere | HADTSFRNGSGASTEWRETFKNMSFGPKVVDWACSLEQNNKRFWMHKLVH* |
| Ga0182104_11096961 | 3300015297 | Switchgrass Phyllosphere | MHADTSFRNRLGVSTKWRETFENTSFGPKVVDWAFSLLENKKQFRWHKL |
| Ga0182104_11199991 | 3300015297 | Switchgrass Phyllosphere | MHADTSFCNGSGASTKWRETFENMSFGPKVVDWACSLLENKKR |
| Ga0182184_10267061 | 3300015301 | Switchgrass Phyllosphere | MHADTSFRNGSGALTKWRETFEIMSFGPKVVDWACSLLESKKRF* |
| Ga0182180_10764871 | 3300015306 | Switchgrass Phyllosphere | SPTVLKKTTLNQMHADTSFRNRSGASTKWRETFENMSFRPKVVDWACSLLENKKQF* |
| Ga0182162_10025621 | 3300015310 | Switchgrass Phyllosphere | MHANTSFRNGSGALTKWRETFEIMSFGPKVVDWACS |
| Ga0182162_10177181 | 3300015310 | Switchgrass Phyllosphere | MHADTSFRNGSGASTEWRETIKNMSFGPKVVDWACSLEQNNKRFWMHKLVH* |
| Ga0182162_10613181 | 3300015310 | Switchgrass Phyllosphere | MHADNSLHNRSGASTKWCKTFENMSFGPKVVDWACSLLKNKKQF |
| Ga0182162_11023521 | 3300015310 | Switchgrass Phyllosphere | ETFNQMDADTSFHNGSGVSTKWRETFENMSFEPKVVDWACSLLENKKRFWRHKLVQ* |
| Ga0182182_10566591 | 3300015311 | Switchgrass Phyllosphere | MHADTSFRNGSGALMKWIETFEIMSFGPKVVDWACSLLESKKRFWRHKLVH* |
| Ga0182168_10370921 | 3300015312 | Switchgrass Phyllosphere | MHADTSFRNRSGASTKWRRTLKNMSFGPKVVDWAYSLLEN |
| Ga0182168_10763841 | 3300015312 | Switchgrass Phyllosphere | HPDTSFRNGSGASTKWRETTQNMSFGPKVADWACPLLENQK* |
| Ga0182164_10872081 | 3300015313 | Switchgrass Phyllosphere | MHHDTSFCNGSGASTKWRETTQNMSFGPKVADWACSLLENKK |
| Ga0182120_10275772 | 3300015315 | Switchgrass Phyllosphere | MHADTSFRNGSGALTKWRETFEIMSFGPKVVDWACSLLESKKRFWRHKLVH* |
| Ga0182136_10004001 | 3300015317 | Switchgrass Phyllosphere | ETFNQMHADTSFRNGSGASIKRRETFENTSFGPKVVDWACSLLKNKKLFWRQKLMH* |
| Ga0182130_10771801 | 3300015319 | Switchgrass Phyllosphere | SFRNKSGASTKWRETFENMSFGPKVVDWACSLLENNKQF* |
| Ga0182130_11196171 | 3300015319 | Switchgrass Phyllosphere | MHADTSFRNRSGASTKWRETFENMSFGPKVVDWACSLLKT |
| Ga0182165_11316671 | 3300015320 | Switchgrass Phyllosphere | MHVDTSFRNGSGASTKWSETFKNMSFGPKVVDWACSLVQNKKRFW |
| Ga0182134_11297661 | 3300015324 | Switchgrass Phyllosphere | MHADSSFCNGSGASTKWRETFENMSFGPKVVDWACSLLENKKQFWR |
| Ga0182148_10642981 | 3300015325 | Switchgrass Phyllosphere | MHADTSFRNRSGASTKWHGTLKNMSFGPKVVDWAYSFLENKK |
| Ga0182148_11193232 | 3300015325 | Switchgrass Phyllosphere | MHADTSFRNGSGASMKWRETFEIMSFGPKVVDWACSLLESKKRFWKHKLVH* |
| Ga0182114_10422331 | 3300015327 | Switchgrass Phyllosphere | MHADTSFRNGSGASTKWRETTENMSFGHKVVDWACSLLENKKQFWRQKLVH* |
| Ga0182114_11007161 | 3300015327 | Switchgrass Phyllosphere | SFHNGLGASTKWRKTFENMSFGPKVVDWAYSLLENKK* |
| Ga0182135_10539921 | 3300015329 | Switchgrass Phyllosphere | MHADSSFCNGSGASTKWRETFENMSFGPKVVDWAC |
| Ga0182152_10996971 | 3300015330 | Switchgrass Phyllosphere | RNGSGASMKWRKTFENMSFGPKVVDWAHSLLENKK* |
| Ga0182152_11334342 | 3300015330 | Switchgrass Phyllosphere | FNQMHADTSFRNGSGASTEWRETTENMSFGPKVVDWAGSLLENKK* |
| Ga0182131_10950211 | 3300015331 | Switchgrass Phyllosphere | SETFNQMYADTSFCNGSGASTKWREIFENMSFVPKVVDGACSLLENKKQF* |
| Ga0182117_10949661 | 3300015332 | Switchgrass Phyllosphere | QTHADTSFRNGSGASTEWRETTENMSFGPKVVDWAGSLLENKKQFWRHKLVH* |
| Ga0182117_11515511 | 3300015332 | Switchgrass Phyllosphere | MHADTSFRDRSSASTKLHETFENTSFGPKVLDWAC |
| Ga0182132_11549321 | 3300015334 | Switchgrass Phyllosphere | HADTSFRNWSGASTKLRETFKNMSFGPKVVDWAGSVLENKKQF* |
| Ga0182116_11145211 | 3300015335 | Switchgrass Phyllosphere | MHADTSFRNGSGASTKWRQTFENMSFGPKVVDWACSL |
| Ga0182150_10595631 | 3300015336 | Switchgrass Phyllosphere | ETFNQMHADTSSRNGSGASMKWRETFENMSFGPEVVDWACSLLENNKRF* |
| Ga0182150_10877862 | 3300015336 | Switchgrass Phyllosphere | MHTDTSFRNGSGASTKWRETFEIMSFGPKVVDWACSLLESKKRFWRHKLVH* |
| Ga0182137_11549341 | 3300015338 | Switchgrass Phyllosphere | MHADTSFRNGSGASTEWRETFKNMSFGPKVVDWAC |
| Ga0182149_10892642 | 3300015339 | Switchgrass Phyllosphere | MHADTSFRNRSGASTKWHGTLKNMSFGPKVVDWAYSLLE |
| Ga0182149_11111151 | 3300015339 | Switchgrass Phyllosphere | MHADTSFRNGSGASTKWRETFEIMSFGPKVVDWACSLLESKKRF* |
| Ga0182149_11499471 | 3300015339 | Switchgrass Phyllosphere | MHADTSFRNGSGASTKWRETFEDMSFGPKVVDWACSLLEN |
| Ga0182133_11419121 | 3300015340 | Switchgrass Phyllosphere | MHADTSFRNGSGASTKWRETTENMSFGPKVVDWACSLL |
| Ga0182115_12266871 | 3300015348 | Switchgrass Phyllosphere | MHADTSFRNGSGASMKWHEIFKNMSFGPKVVDWACLL |
| Ga0182185_11531501 | 3300015349 | Switchgrass Phyllosphere | SFRNRSGASTKWRETFENMSFGPKVVDWACSLLENKKWF* |
| Ga0182185_11566972 | 3300015349 | Switchgrass Phyllosphere | ADTSFRNGSGASTKWRETFENMSFGPKVVDWACSLLENKKRF* |
| Ga0182185_12208591 | 3300015349 | Switchgrass Phyllosphere | MHADTSFHNGSGASMKWRETFENMRFGPKVVDWACSLLENKKWF* |
| Ga0182163_11673681 | 3300015350 | Switchgrass Phyllosphere | MHTDTSFRNGSGASTKWRETTENMSFGHKVVDWACSLLENKKQFWRQ |
| Ga0182163_11940131 | 3300015350 | Switchgrass Phyllosphere | MHADTIFRNRSGASTKWHETFENTSFGPKVLDWACSLLKNKKRFW |
| Ga0182163_12279801 | 3300015350 | Switchgrass Phyllosphere | RNRSGASTKWRETFENMSFGPKVVDWACSLLENKKWF* |
| Ga0182163_12636711 | 3300015350 | Switchgrass Phyllosphere | MHADTSFRNGSGASTKWRETFENMSFGPKVVDWACSLLENKKRF |
| Ga0182169_11929921 | 3300015352 | Switchgrass Phyllosphere | MHAETSFRNRSGALTKWRETTKNMNFGPKVVDLACSLLENKKRFWRHKLVQ* |
| Ga0182169_12944511 | 3300015352 | Switchgrass Phyllosphere | MHADTSFRNGSGVSTKWRKTFENMSFGPKVVDWACLLLENKK |
| Ga0182179_12347231 | 3300015353 | Switchgrass Phyllosphere | MHPDTSFRNGSGASTKWRETTQSMSFGPKVADWACS |
| Ga0182179_12950081 | 3300015353 | Switchgrass Phyllosphere | MHADTSFRNGLGALTKWRETFEIMSFGPKVVDWACSLLESKKRFWRHKLVH* |
| Ga0182197_10276852 | 3300017408 | Switchgrass Phyllosphere | MHADTSFRNGSGASTKWRETFENMSFGPKVVDWACSLLENK |
| Ga0182213_11068561 | 3300017421 | Switchgrass Phyllosphere | MHADTSFCNGSGASTKWRETFENMSFGPKVVDWACSLLENKKQFWRHKLVH |
| Ga0182196_11512011 | 3300017432 | Switchgrass Phyllosphere | MHADTSFRKRSGASTKWRETFENMSFGPKVVDWACS |
| Ga0182200_11352331 | 3300017439 | Switchgrass Phyllosphere | SFRNGSGASTKLRETFKNMSFGPKVVDWACSLLENKKQF |
| Ga0182200_11409012 | 3300017439 | Switchgrass Phyllosphere | MHADTSFRNGSGALMKWNETFEIMSFGPKVVDWACSLLESKKRF |
| Ga0182200_11635251 | 3300017439 | Switchgrass Phyllosphere | MHANTSFRNRSGASTKWRKTFENMSFGPKVVDWAC |
| Ga0182198_11808891 | 3300017445 | Switchgrass Phyllosphere | NGSGASTKWRETFENMSFGPKVVDWACSLLESKNRF |
| Ga0182198_11853092 | 3300017445 | Switchgrass Phyllosphere | ADTSFRKGSGASTKWRETFKNMSFEPKVVDLACSLLENKKWF |
| Ga0182212_10852291 | 3300017691 | Switchgrass Phyllosphere | MHANTSFRNGSGTSTKWRETTENMSFVPKVVDWVGSLLENKKRFWRHKLVQ |
| Ga0182210_10571591 | 3300017692 | Switchgrass Phyllosphere | YSETFNQMHADTSFRNGSGASTEWRETFKNMSFGPKVVDWACSLEQNNKRFWMHKLLH |
| Ga0182210_11615181 | 3300017692 | Switchgrass Phyllosphere | MHANTSFRNRSGASTKWRETFENMSFGPKVVDWAC |
| Ga0182216_11162532 | 3300017693 | Switchgrass Phyllosphere | MHANTSFRNRSGASTKWRETFENMSFGPKVVDWASSLLENKKRFLRHKLVH |
| Ga0182216_11166401 | 3300017693 | Switchgrass Phyllosphere | RNGSGASTKWRETFENMSFGPKVVDWACSLLESKNRF |
| Ga0182216_11398601 | 3300017693 | Switchgrass Phyllosphere | TSFRNGLGASTKWRETFENMSFEPKVVDWACLLLENKKQFWRHKLVH |
| Ga0182216_12155971 | 3300017693 | Switchgrass Phyllosphere | MQPITRFRNLSRAATKLRETTQNMSFGPKEVDWAS |
| Ga0182216_12207991 | 3300017693 | Switchgrass Phyllosphere | RNWSGASTKLRETFKNMSFGPKVVDWACSVLENKKQF |
| Ga0182178_10008761 | 3300020023 | Switchgrass Phyllosphere | MHADTSFRNGSGASTKLRETFKNMSFGPKVVDWACSVLENKKQF |
| Ga0182178_10071851 | 3300020023 | Switchgrass Phyllosphere | QMHADSSFCNGSGASTKWRETFENMSFGPKVVDWACSLLENKKRF |
| Ga0182178_10203371 | 3300020023 | Switchgrass Phyllosphere | TFNQTHADTSFRNGSGASTKWRETTENMSFVPKVVDWVGSLLENKKRFWRHKLVQ |
| Ga0182178_10231621 | 3300020023 | Switchgrass Phyllosphere | MHADTSFRNGLGALTKWRETFEIMSFGPKVVDWACSLLESKKRFWRHKLVH |
| Ga0182119_1020991 | 3300020031 | Switchgrass Phyllosphere | LESYYSETFNQMHANTSFRNRSGASTKWRETFENMSFRPKVVDWACSLLENKKQF |
| Ga0182119_1043181 | 3300020031 | Switchgrass Phyllosphere | MHVDTSFRNGSGASTKWHETTKNMSFGPKVVDWACSLLENKKRFWRHKLV |
| Ga0207703_105190561 | 3300026035 | Switchgrass Rhizosphere | MHADTSFRNGSGASTEWRETFKNMSFGPKVVDWACLLEQNNNR |
| Ga0207641_105775032 | 3300026088 | Switchgrass Rhizosphere | MHADTSFRNGSGASTKWRETFEIMSFGPKVVDWACSLLESKKRFWRHKLVH |
| Ga0207641_116390331 | 3300026088 | Switchgrass Rhizosphere | MHANTSFRNGSGASTKWRETFEKMSFGPKVVDWACSLLESKN |
| Ga0207641_119952271 | 3300026088 | Switchgrass Rhizosphere | ETFNQMHADTSFRNGSGASTKWRETFEKMSFGPKVVDWACSLLENKKRFWRHKLVH |
| Ga0207675_1015979671 | 3300026118 | Switchgrass Rhizosphere | MHANTSFRNRSGASTKWRETFENMSFGPKVVDWACSLLEN |
| Ga0207675_1027392001 | 3300026118 | Switchgrass Rhizosphere | MHANTSFHNRSGASTKWRETFENMSFGPKVVDWACSLLEN |
| Ga0268322_10025921 | 3300028049 | Phyllosphere | MHADTSFRNGSGASTKWRETFENMSFGPKVVDWACSLLENKKRFWRHKLVH |
| Ga0268322_10388051 | 3300028049 | Phyllosphere | FRNGSGASTKWRETFENMSFGPKVVDGACSLLENKKQF |
| Ga0268328_10315291 | 3300028050 | Phyllosphere | FNQMHADTSFRNGSGASTKWRETLKNMSFGPKVVDWASLLLESKKRF |
| Ga0268328_10365722 | 3300028050 | Phyllosphere | MHADTSFRNGLGALTKWRETFEIMSFGPKVVDWACSLLESKKRF |
| Ga0268328_10527971 | 3300028050 | Phyllosphere | MHANTSFCNRSGVSTKWRETFENMSFGPKVVDWACSLLENKKR |
| Ga0268344_10065751 | 3300028051 | Phyllosphere | RNGSGASTKWRETFENMSFGPKVVDWACSLLENKKRFRRHKLVH |
| Ga0268346_10190121 | 3300028053 | Phyllosphere | MHPDTSFRNGSGASMKWRETTQNMSFGPKVADWACPLLENKKRFWRHK |
| Ga0268346_10221291 | 3300028053 | Phyllosphere | MHADTSFRNGSGASTKLRETFKNMSFGPKVVDWACSVLENKK |
| Ga0268346_10362401 | 3300028053 | Phyllosphere | MHIDTSFRNRSGASTKWRKTFENMSFGPKVVDWSCLLLKNQKLFWRQKLV |
| Ga0268346_10432752 | 3300028053 | Phyllosphere | MHADTSFHNGSGASTKWRETFENMSFEPKVVDWACSLLENKKRFWRHKLVHYMH |
| Ga0268330_10020161 | 3300028056 | Phyllosphere | MHADTSFRNGSGALTKWRETFEIMSFGPKVVDWACSLLESKKRFWRHKLVH |
| Ga0268330_10129672 | 3300028056 | Phyllosphere | MLADTSFHNRSGASIKWCETFENTSFGPKVVDWACSLLKNKKLFWRQKL |
| Ga0268330_10291021 | 3300028056 | Phyllosphere | FRNGSGASMKWQEAFENMNFGHKVVDWACSLLEIKKQF |
| Ga0268330_10333941 | 3300028056 | Phyllosphere | MHADTSFRNGSGASTKWRETFENMSFGPKVVDWACSL |
| Ga0268330_10506671 | 3300028056 | Phyllosphere | ETFNHLHADTSFRNRTGASTKWRETFENMSFGPKVVDWACSLLENKKRF |
| Ga0268330_10519971 | 3300028056 | Phyllosphere | NGSGASTKLRETLENMSFGPKVVDWACLVLENKKRF |
| Ga0268330_10533261 | 3300028056 | Phyllosphere | FCNGSGASTKWRETFENMSFGPKVVDWACSLLENKKQF |
| Ga0268330_10573292 | 3300028056 | Phyllosphere | ETFNQLHADTSFRNGSGASTKWRETFENMSFEPKVVDWACSLLENKKRF |
| Ga0268352_10263501 | 3300028057 | Phyllosphere | NTSFRNGSGASTKWRETFENMSFGPKVVDWACSLLESKNRF |
| Ga0268352_10314301 | 3300028057 | Phyllosphere | ADSSFRNRSGASTKWRETFENMSFGPKVVDWACSLLKNKKQFWRKKLVH |
| Ga0268332_10459381 | 3300028058 | Phyllosphere | MHADTSFRNRLGATTKWRETTKNMNFGPKVVDWACSLLENKK |
| Ga0268332_10596471 | 3300028058 | Phyllosphere | MHADTSSRNGSGASMKWSKTTENMSFGPKVVDWACSLLEN |
| Ga0268314_10544731 | 3300028061 | Phyllosphere | MHAYTSFCNRSGASMKWRETFENMSFGPKVVDWAYSLLEN |
| Ga0268314_10550201 | 3300028061 | Phyllosphere | MHADTSYRNRSGASTKWRETFENMSFGHKVVDWACSLLK |
| Ga0268342_10033481 | 3300028062 | Phyllosphere | SKTFNQIHADTSFRNGSGASMKWRETFENMSFEPKVVDWACSLLENKKRF |
| Ga0268342_10059691 | 3300028062 | Phyllosphere | ESYYFETFNQMHADSSFHNGSGASTKWRDTFEIMSFGPKVVDWAYSLLENKKLFWRHKLM |
| Ga0268342_10119361 | 3300028062 | Phyllosphere | MHANTSFRNRSGASMKWRETFKNMSFGPKVVDWACSLLENKK |
| Ga0268342_10138121 | 3300028062 | Phyllosphere | MQADTSFRNGSGESTKLHETFENMSFGPKVVDWACSVLENKKRF |
| Ga0268342_10182641 | 3300028062 | Phyllosphere | MHADTSFRNGSGASTKWRETFENMSFEPKVVDWACSLLENKKRFWRHKLV |
| Ga0268350_10135421 | 3300028063 | Phyllosphere | MHADTSFRNGSGASTKWRETFENMSFGPKVVDWACSLLENKKRFRRHKLVH |
| Ga0268350_10325022 | 3300028063 | Phyllosphere | MHADTSFRNGSGASTEWRETFKNMSFGPKVVDWACSLEQNNKR |
| Ga0268340_10202152 | 3300028064 | Phyllosphere | MHADTSFRNGSGASTKWRETFENMSFEPKVVDWACSLLENKKWF |
| Ga0268340_10410172 | 3300028064 | Phyllosphere | DTSFRNMSGASTKWRKTFENMSFGPKVVDWACSLLKNKKRF |
| Ga0268340_10722001 | 3300028064 | Phyllosphere | KTFNQIHADTSLRNESGASMKWHETFENMSFEPKVVDWACSLLENKKRF |
| Ga0268355_10024571 | 3300028139 | Phyllosphere | DTSFRNGSGASTKWRETTENMSFGPKVVDWAGSLLENKKQFWRHKLVQ |
| Ga0268334_10165871 | 3300028140 | Phyllosphere | MHADTSFRNRSGASTKWHGTLKNMSFGPKVVDWAYSLLENKKQFW |
| Ga0268347_10070862 | 3300028142 | Phyllosphere | MHVDTSFCNGSGASMKWRETFENMSSGPKVVDWAC |
| Ga0268347_10250951 | 3300028142 | Phyllosphere | HADTSFRNGLGASTKWHETFENMSFGPKVVDWACSLLDNKKRF |
| Ga0268347_10348661 | 3300028142 | Phyllosphere | SETFNQMHADTSFRNRSGASTKWIETFENMSFGPKVVDWACSLLKNKK |
| Ga0268348_10009551 | 3300028143 | Phyllosphere | ADTSFRNGSGASRKWRETFESMSFGPKEVDWACSLLENKKQFWRHKHVH |
| Ga0268348_10030682 | 3300028143 | Phyllosphere | MHADTSFRNGSGASTKWRETFEIMSFGPKVVDWACSLLESKKRF |
| Ga0268348_10079801 | 3300028143 | Phyllosphere | MHVDTSFCNGSGASTKWRETFKNMSFGPKVVDWAC |
| Ga0268348_10208701 | 3300028143 | Phyllosphere | SRNGSGASMKWRETTENMSFGPKVVDWACSLLENKKRF |
| Ga0268345_10227451 | 3300028144 | Phyllosphere | MHADSSFCNRSGASTKWRETFENMSFGPKVVDWACSLLENKK |
| Ga0268308_10011931 | 3300028151 | Phyllosphere | QTHADTSFRNGSGASTEWRETTENMSFGPKVVDWAGSLLENKK |
| Ga0268308_10059421 | 3300028151 | Phyllosphere | MHADTSFHNGLGASTKWRETTENMSFGHKVVDWACSLLENKKQFWRQKLVH |
| Ga0268308_10070741 | 3300028151 | Phyllosphere | MHADTSFRNGSGASRKWRETFESMSFGPKEVDWACSLLENKKQF |
| Ga0268308_10202051 | 3300028151 | Phyllosphere | ADTSFRNGSGASTKWRETTENMSFGPKVVDWAGSLLENKKQFWRHKLVQ |
| Ga0268308_10325152 | 3300028151 | Phyllosphere | RNASGASTKWHETFENMSFGPKVVDWAFSLLENKKRF |
| Ga0268336_10016641 | 3300028152 | Phyllosphere | MHPDTSFRNGSGASTKWRETTENMSFGPKVADWACPLQENKK |
| Ga0268336_10108982 | 3300028152 | Phyllosphere | MHTDTSFRNGSGASTKWRETFEIMSFGPKVVDWACSLLESKKRFWRHKLVH |
| Ga0268336_10241311 | 3300028152 | Phyllosphere | FNQMHPDTSFRNGSGASMKWRETTQNMSFGPKLEDWACLLLENKKQFWRHKLVH |
| Ga0268320_10075541 | 3300028153 | Phyllosphere | GTFNQMHPDTSFRNGLGASTKWRETTQNMSFGPKVADWACPLLENQKWFWRHKLVH |
| Ga0268320_10158681 | 3300028153 | Phyllosphere | MHADTSFRNRSGASTKWRETFENMSFGPKVVDWSCSL |
| Ga0268320_10297471 | 3300028153 | Phyllosphere | MHADTSFCNGSGASTKWRETFENMSFGPKVVDWACSLLENKKRFWRHKL |
| Ga0268341_10043851 | 3300028154 | Phyllosphere | DTSFRNGSGASTKSRETTQNMSFGPKVADWACPLLENKKRFWRHKLVH |
| Ga0268341_10051941 | 3300028154 | Phyllosphere | MHADTSFRNGSGASTKFRETFKNMSFGPKVVDWACSVLENKKWF |
| Ga0268341_10083531 | 3300028154 | Phyllosphere | MHVDTSFRNMSGASTKWRKTFENMSFGPKVVDWACSLLKNKKRFWRQKLVH |
| Ga0268341_10218791 | 3300028154 | Phyllosphere | FCNGSGASTKWREIFENMSFVPKVVDGACSLLENKKQF |
| Ga0268312_10011632 | 3300028248 | Phyllosphere | MHPDTSFRNGSGASTKWRETTENMSFGPKVADWACPLQENMKQFWRHKLVH |
| Ga0268312_10260421 | 3300028248 | Phyllosphere | ADTSSRNGSGASMKWRETTENMSFGPKVVDWACSLLENKKRFKRHKVVQ |
| Ga0268312_10354821 | 3300028248 | Phyllosphere | DTSFRNGSGASTEWRETTENMSFGPKVVDWAGSLLENKK |
| Ga0268324_10144842 | 3300028251 | Phyllosphere | SYCSETFNQMHADTSFRNGSGASTKWRETFENMSFEPKVVDWACSLLENKKRF |
| Ga0268324_10234041 | 3300028251 | Phyllosphere | FNQMHADTSFRNGSGASMKWRETFENMSFGPKVVDWAFSLLENKKRFRWHKLVQ |
| Ga0268316_10219971 | 3300028253 | Phyllosphere | IHADASLRNESGASMKWHETFENMSFEPKVVDWACSLLENKKRF |
| Ga0268304_10010352 | 3300028256 | Phyllosphere | YSEIFNQMHADTSFRNGSGTSTKWRETFENMSFEPKVVDWACSLLENKKRFWRHKLVH |
| Ga0268304_10034952 | 3300028256 | Phyllosphere | MYADTSFRNGSGASMKWRETFENMSFGPKVVDGACSLLENKKQF |
| Ga0268304_10120502 | 3300028256 | Phyllosphere | ADTSFRNGSGALTKWRETFEIMSFGPKVVDWACSLLESKKRF |
| Ga0268310_10084161 | 3300028262 | Phyllosphere | MHADTSFCNGSVASTKWRETFKNMSFGPKVVDWACSLLENKKRF |
| Ga0268310_10196051 | 3300028262 | Phyllosphere | ETFNQTHADTSFRNVSGASTKWRETFENMSFEPKVVD |
| Ga0268310_10197011 | 3300028262 | Phyllosphere | ASTEWRETFKNMSFGPKVVDWACSLEQNNKRFWMHKLLH |
| Ga0268310_10244651 | 3300028262 | Phyllosphere | MHANTSFRNRSGASTKWRETFENMSFGPKVVDWASSLLENKKRFLRHKL |
| Ga0268310_10456821 | 3300028262 | Phyllosphere | TSFRNGSGASTKLRETFENMSFGPKVVDWACSLLENKKQF |
| Ga0268266_109968103 | 3300028379 | Switchgrass Rhizosphere | GASTEWRETFKNMSFGPKVVDWACSLEQNNKRFWMHKLVH |
| Ga0268264_120817881 | 3300028381 | Switchgrass Rhizosphere | FRNRSGASTKWRETFENMSFRPKVVDWACSLLENKKQF |
| Ga0268264_125492801 | 3300028381 | Switchgrass Rhizosphere | FRNGSGALTKWRETFENMSFEPKVVDWACSLLENKKRF |
| Ga0268302_1034791 | 3300028464 | Phyllosphere | TDTSFRNRSGASMKWHETFKNMSFGPKVVDWACSLLENKKQF |
| Ga0268321_1011141 | 3300028466 | Phyllosphere | MHADTSFRNGSGASTKWRETFENMSFGPKVVDWACSLLENKKRFWRHKLVHLMHL |
| Ga0268333_10028241 | 3300028467 | Phyllosphere | MHADTSFRNRSGASTKWRETFENMSFRPKVVDWACSLLENKKQF |
| Ga0268307_10056761 | 3300028470 | Phyllosphere | MHADSSFCNGLGASTKWRETFVNMSFGPKVVDWACS |
| Ga0268307_10208802 | 3300028470 | Phyllosphere | MHADNSFRNRSGAWTKWRKTFENMSFGPKVVDWACSLLKNKKQ |
| Ga0268315_10033771 | 3300028472 | Phyllosphere | MHADTSFHNGSGASMKWRETFENMRFGPKVVDWACSLQENKKRS |
| Ga0268315_10164781 | 3300028472 | Phyllosphere | MHIDTSFRNGSGASTKWRETFKNMSFGPKVVDWACSLVQNKKRF |
| Ga0268331_10032452 | 3300028474 | Phyllosphere | MHADTSFRNGSGASTKWRETFEITSFGPKVVDWACSLLESKKWF |
| Ga0268331_10141191 | 3300028474 | Phyllosphere | MHADTSFRNRSGASTKWRETFENMSFGPKVVDWSCSLLKNKKQFSWQE |
| Ga0268331_10141311 | 3300028474 | Phyllosphere | QADTSFRNGSGASTKWHETTENMSFGLKVVDWAGSFLENKKRFWRHKLVQ |
| Ga0268327_10086691 | 3300028475 | Phyllosphere | HADTSFCNGSGASTKWRETFENMSFGPKVVDWAYLLLKNKKLFWRHKLVH |
| Ga0268329_10132461 | 3300028476 | Phyllosphere | FRNGSGTSTKWRETFENMSFESKVVDWACSLLENNKRF |
| Ga0268305_1009832 | 3300028525 | Phyllosphere | DTSFRNGSGASTKLRETFKNMSFGPKVVDWACSVLENKKQF |
| Ga0268305_1014671 | 3300028525 | Phyllosphere | QMHADTSFRNGSGASTEWRETFKNMSFGPKVVDWACSLEQNNKRFWMHKLVH |
| Ga0268311_10226332 | 3300028529 | Phyllosphere | ETFNQTHADSSFRNGSGASMKCRETTKNMSFVPKVEDWACSLLENKKRF |
| Ga0214503_12799281 | 3300032466 | Switchgrass Phyllosphere | MPPDTSFRNRSAASTKWRETFENMSFGPKVVDWAFSLLENKKQFWRHKLVH |
| Ga0214489_10414851 | 3300032590 | Switchgrass Phyllosphere | MHADTSFRNGSGASTKLRETFKNMSFGPKVVDWACLLLENKKRFWRHKLVQ |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |