NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F021570

Metagenome / Metatranscriptome Family F021570

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F021570
Family Type Metagenome / Metatranscriptome
Number of Sequences 218
Average Sequence Length 48 residues
Representative Sequence MKLAFVRTGTRHRRALRNEASFYAKRLILVEQMEKNGINKEIRRQK
Number of Associated Samples 190
Number of Associated Scaffolds 218

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.85 %
% of genes near scaffold ends (potentially truncated) 53.67 %
% of genes from short scaffolds (< 2000 bps) 88.53 %
Associated GOLD sequencing projects 182
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.440 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(14.679 % of family members)
Environment Ontology (ENVO) Unclassified
(34.862 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.743 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.70%    β-sheet: 0.00%    Coil/Unstructured: 47.30%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 218 Family Scaffolds
PF10090HPTransfase 47.25
PF01627Hpt 34.86
PF02895H-kinase_dim 9.63
PF00459Inositol_P 6.42
PF06577EipA 0.46
PF00069Pkinase 0.46
PF00512HisKA 0.46

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 218 Family Scaffolds
COG0643Chemotaxis protein histidine kinase CheASignal transduction mechanisms [T] 19.27
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.44 %
UnclassifiedrootN/A21.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908038|B3_all_c_ConsensusfromContig105031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei879Open in IMG/M
3300001417|JGI20196J14858_1004775Not Available1175Open in IMG/M
3300002067|JGI24735J21928_10219199All Organisms → cellular organisms → Bacteria → Proteobacteria553Open in IMG/M
3300004114|Ga0062593_102785562All Organisms → cellular organisms → Bacteria → Proteobacteria558Open in IMG/M
3300004156|Ga0062589_100034495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2631Open in IMG/M
3300004643|Ga0062591_101574528All Organisms → cellular organisms → Bacteria → Proteobacteria661Open in IMG/M
3300005347|Ga0070668_102122410All Organisms → cellular organisms → Bacteria → Proteobacteria519Open in IMG/M
3300005364|Ga0070673_101141992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium729Open in IMG/M
3300005451|Ga0066681_10568954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus699Open in IMG/M
3300005455|Ga0070663_100430919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1083Open in IMG/M
3300005457|Ga0070662_100126856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1962Open in IMG/M
3300005459|Ga0068867_100543053All Organisms → cellular organisms → Bacteria → Proteobacteria1006Open in IMG/M
3300005459|Ga0068867_100663272Not Available916Open in IMG/M
3300005471|Ga0070698_101245639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium693Open in IMG/M
3300005548|Ga0070665_100179777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2116Open in IMG/M
3300005548|Ga0070665_101500616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales682Open in IMG/M
3300005548|Ga0070665_102134127All Organisms → cellular organisms → Bacteria → Proteobacteria564Open in IMG/M
3300005559|Ga0066700_10791558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium640Open in IMG/M
3300005560|Ga0066670_10580313All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica684Open in IMG/M
3300005577|Ga0068857_101394465Not Available681Open in IMG/M
3300005577|Ga0068857_101841304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria593Open in IMG/M
3300005578|Ga0068854_100209055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1538Open in IMG/M
3300005602|Ga0070762_10562106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae754Open in IMG/M
3300005660|Ga0073904_10027048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3824Open in IMG/M
3300005713|Ga0066905_101267486All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica662Open in IMG/M
3300005844|Ga0068862_101145333All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica774Open in IMG/M
3300005844|Ga0068862_102750132Not Available503Open in IMG/M
3300005937|Ga0081455_10031631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii4782Open in IMG/M
3300005981|Ga0081538_10047623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2627Open in IMG/M
3300005983|Ga0081540_1048705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii2120Open in IMG/M
3300005983|Ga0081540_1273594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium584Open in IMG/M
3300006048|Ga0075363_100017910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3521Open in IMG/M
3300006057|Ga0075026_100793574All Organisms → cellular organisms → Bacteria → Proteobacteria574Open in IMG/M
3300006059|Ga0075017_101374973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium555Open in IMG/M
3300006195|Ga0075366_10716258Not Available621Open in IMG/M
3300006354|Ga0075021_10682914Not Available659Open in IMG/M
3300006642|Ga0075521_10564106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium560Open in IMG/M
3300006846|Ga0075430_101335652Not Available590Open in IMG/M
3300006864|Ga0066797_1178535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria741Open in IMG/M
3300006881|Ga0068865_100831875All Organisms → cellular organisms → Bacteria → Proteobacteria798Open in IMG/M
3300006881|Ga0068865_101868178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus543Open in IMG/M
3300006953|Ga0074063_14262149All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica722Open in IMG/M
3300009087|Ga0105107_10132031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1758Open in IMG/M
3300009091|Ga0102851_11092829All Organisms → cellular organisms → Bacteria → Proteobacteria872Open in IMG/M
3300009093|Ga0105240_11646748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales671Open in IMG/M
3300009101|Ga0105247_10960341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium664Open in IMG/M
3300009120|Ga0117941_1074576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium916Open in IMG/M
3300009143|Ga0099792_10334759Not Available909Open in IMG/M
3300009148|Ga0105243_11016050Not Available833Open in IMG/M
3300009177|Ga0105248_10512463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1352Open in IMG/M
3300009177|Ga0105248_12444055Not Available595Open in IMG/M
3300009354|Ga0115925_10065536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium571Open in IMG/M
3300009551|Ga0105238_11247101All Organisms → cellular organisms → Bacteria → Proteobacteria769Open in IMG/M
3300009792|Ga0126374_11829131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium509Open in IMG/M
3300010036|Ga0126305_10958348Not Available586Open in IMG/M
3300010037|Ga0126304_10067038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2212Open in IMG/M
3300010320|Ga0134109_10054490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1330Open in IMG/M
3300010333|Ga0134080_10628600Not Available525Open in IMG/M
3300010375|Ga0105239_12214160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium639Open in IMG/M
3300010397|Ga0134124_13105665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria508Open in IMG/M
3300010401|Ga0134121_12488843All Organisms → cellular organisms → Bacteria → Proteobacteria560Open in IMG/M
3300010403|Ga0134123_11783966Not Available668Open in IMG/M
3300012202|Ga0137363_11063007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium688Open in IMG/M
3300012205|Ga0137362_10249706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1532Open in IMG/M
3300012354|Ga0137366_10742290Not Available698Open in IMG/M
3300012357|Ga0137384_11090510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales640Open in IMG/M
3300012469|Ga0150984_113354795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1275Open in IMG/M
3300012895|Ga0157309_10063048All Organisms → cellular organisms → Bacteria → Proteobacteria949Open in IMG/M
3300012900|Ga0157292_10329462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria557Open in IMG/M
3300012906|Ga0157295_10377412Not Available522Open in IMG/M
3300012914|Ga0157297_10165428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium735Open in IMG/M
3300012923|Ga0137359_10527764Not Available1040Open in IMG/M
3300012927|Ga0137416_11298952All Organisms → cellular organisms → Bacteria → Proteobacteria657Open in IMG/M
3300012929|Ga0137404_10315381Not Available1360Open in IMG/M
3300012929|Ga0137404_10946084All Organisms → cellular organisms → Bacteria → Proteobacteria787Open in IMG/M
3300012931|Ga0153915_10487519All Organisms → cellular organisms → Bacteria → Proteobacteria1408Open in IMG/M
3300012957|Ga0164303_11108914All Organisms → cellular organisms → Bacteria → Proteobacteria572Open in IMG/M
3300012958|Ga0164299_11188606All Organisms → cellular organisms → Bacteria → Proteobacteria576Open in IMG/M
3300012975|Ga0134110_10592560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria514Open in IMG/M
3300012981|Ga0168316_100959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae10398Open in IMG/M
3300012989|Ga0164305_10754402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium802Open in IMG/M
3300013308|Ga0157375_11684696Not Available751Open in IMG/M
3300013832|Ga0120132_1073283Not Available690Open in IMG/M
3300014208|Ga0172379_10588778All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica691Open in IMG/M
3300014326|Ga0157380_10065735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii2916Open in IMG/M
3300014326|Ga0157380_12024572All Organisms → cellular organisms → Bacteria → Proteobacteria638Open in IMG/M
3300014498|Ga0182019_10662688All Organisms → cellular organisms → Bacteria → Proteobacteria737Open in IMG/M
3300014657|Ga0181522_10558302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium693Open in IMG/M
3300014745|Ga0157377_11535362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria531Open in IMG/M
3300014969|Ga0157376_11446621All Organisms → cellular organisms → Bacteria → Proteobacteria719Open in IMG/M
3300015242|Ga0137412_10115047All Organisms → cellular organisms → Bacteria → Proteobacteria2182Open in IMG/M
3300015357|Ga0134072_10447763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae520Open in IMG/M
3300015373|Ga0132257_102601218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium658Open in IMG/M
3300017792|Ga0163161_10217717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1478Open in IMG/M
3300017792|Ga0163161_10308158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1249Open in IMG/M
3300017924|Ga0187820_1318985All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300017965|Ga0190266_10029116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1733Open in IMG/M
3300018007|Ga0187805_10433744Not Available612Open in IMG/M
3300018043|Ga0187887_10171917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1293Open in IMG/M
3300018055|Ga0184616_10273256Not Available642Open in IMG/M
3300018067|Ga0184611_1072810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1170Open in IMG/M
3300018070|Ga0184631_10111089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1076Open in IMG/M
3300018072|Ga0184635_10022349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2329Open in IMG/M
3300018422|Ga0190265_10652159All Organisms → cellular organisms → Bacteria → Proteobacteria1173Open in IMG/M
3300018422|Ga0190265_11210182All Organisms → cellular organisms → Bacteria → Proteobacteria874Open in IMG/M
3300018422|Ga0190265_13654841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium513Open in IMG/M
3300018432|Ga0190275_12485871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria595Open in IMG/M
3300018432|Ga0190275_13063542All Organisms → cellular organisms → Bacteria → Proteobacteria541Open in IMG/M
3300018433|Ga0066667_10045709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2602Open in IMG/M
3300018465|Ga0190269_10544686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium767Open in IMG/M
3300018465|Ga0190269_11003496Not Available631Open in IMG/M
3300018476|Ga0190274_11116026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium869Open in IMG/M
3300018476|Ga0190274_11392463All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica790Open in IMG/M
3300018481|Ga0190271_11156380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium897Open in IMG/M
3300018920|Ga0190273_11272081Not Available632Open in IMG/M
3300019362|Ga0173479_10331314Not Available707Open in IMG/M
3300019377|Ga0190264_11080464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium652Open in IMG/M
3300019887|Ga0193729_1108725All Organisms → cellular organisms → Bacteria → Proteobacteria1046Open in IMG/M
3300019889|Ga0193743_1032184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD00692494Open in IMG/M
3300021170|Ga0210400_10323564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1267Open in IMG/M
3300021170|Ga0210400_10542591All Organisms → cellular organisms → Bacteria → Proteobacteria959Open in IMG/M
3300021420|Ga0210394_10337460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1324Open in IMG/M
3300021474|Ga0210390_10329465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1293Open in IMG/M
3300021478|Ga0210402_10269448All Organisms → cellular organisms → Bacteria → Proteobacteria1574Open in IMG/M
3300021976|Ga0193742_1021927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei3188Open in IMG/M
3300022756|Ga0222622_10316209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1079Open in IMG/M
3300022756|Ga0222622_10828907All Organisms → cellular organisms → Bacteria → Proteobacteria676Open in IMG/M
3300022891|Ga0247770_1087101Not Available922Open in IMG/M
3300022906|Ga0247766_1000976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium5258Open in IMG/M
3300022915|Ga0247790_10022671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1354Open in IMG/M
3300023101|Ga0224557_1259650Not Available570Open in IMG/M
3300023263|Ga0247800_1132569All Organisms → cellular organisms → Bacteria → Proteobacteria527Open in IMG/M
3300025297|Ga0209758_1031649All Organisms → cellular organisms → Bacteria → Proteobacteria2166Open in IMG/M
3300025494|Ga0207928_1044161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei853Open in IMG/M
3300025619|Ga0207926_1075445Not Available866Open in IMG/M
3300025862|Ga0209483_1015917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei4005Open in IMG/M
3300025893|Ga0207682_10139838All Organisms → cellular organisms → Bacteria → Proteobacteria1086Open in IMG/M
3300025904|Ga0207647_10502236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium676Open in IMG/M
3300025907|Ga0207645_10939970All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300025908|Ga0207643_10291037Not Available1015Open in IMG/M
3300025913|Ga0207695_10438856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1189Open in IMG/M
3300025915|Ga0207693_10407424Not Available1063Open in IMG/M
3300025916|Ga0207663_11015635All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica665Open in IMG/M
3300025917|Ga0207660_10790110All Organisms → cellular organisms → Bacteria → Proteobacteria775Open in IMG/M
3300025923|Ga0207681_10122787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1907Open in IMG/M
3300025923|Ga0207681_11300486All Organisms → cellular organisms → Bacteria → Proteobacteria611Open in IMG/M
3300025926|Ga0207659_10513229All Organisms → cellular organisms → Bacteria → Proteobacteria1016Open in IMG/M
3300025931|Ga0207644_10096001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2218Open in IMG/M
3300025935|Ga0207709_10231067All Organisms → cellular organisms → Bacteria → Proteobacteria1340Open in IMG/M
3300025935|Ga0207709_10955845All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica699Open in IMG/M
3300025938|Ga0207704_10578821All Organisms → cellular organisms → Bacteria → Proteobacteria916Open in IMG/M
3300025938|Ga0207704_11175807All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300025941|Ga0207711_11306550Not Available667Open in IMG/M
3300025942|Ga0207689_10686677Not Available863Open in IMG/M
3300025972|Ga0207668_10495129Not Available1050Open in IMG/M
3300025986|Ga0207658_11050657All Organisms → cellular organisms → Bacteria → Proteobacteria743Open in IMG/M
3300026023|Ga0207677_10075004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2402Open in IMG/M
3300026118|Ga0207675_101993936All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria598Open in IMG/M
3300026142|Ga0207698_11951426All Organisms → cellular organisms → Bacteria → Proteobacteria602Open in IMG/M
3300026273|Ga0209881_1026981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1383Open in IMG/M
3300026276|Ga0209847_1014536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1718Open in IMG/M
3300026300|Ga0209027_1133432Not Available857Open in IMG/M
3300026318|Ga0209471_1175022Not Available855Open in IMG/M
3300026550|Ga0209474_10337977All Organisms → cellular organisms → Bacteria → Proteobacteria854Open in IMG/M
3300027545|Ga0209008_1036386Not Available1138Open in IMG/M
3300027809|Ga0209574_10185659All Organisms → cellular organisms → Bacteria → Proteobacteria656Open in IMG/M
3300027855|Ga0209693_10116825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1321Open in IMG/M
3300027895|Ga0209624_10838036Not Available602Open in IMG/M
3300027902|Ga0209048_10253480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium nitroreducens1253Open in IMG/M
3300027908|Ga0209006_10480608Not Available1038Open in IMG/M
3300027908|Ga0209006_11503440All Organisms → cellular organisms → Bacteria → Proteobacteria510Open in IMG/M
3300027959|Ga0209477_1054719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1487Open in IMG/M
3300028379|Ga0268266_10301214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1495Open in IMG/M
3300028379|Ga0268266_12254896All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300028711|Ga0307293_10234780All Organisms → cellular organisms → Bacteria → Proteobacteria583Open in IMG/M
3300028712|Ga0307285_10099864All Organisms → cellular organisms → Bacteria → Proteobacteria766Open in IMG/M
3300028712|Ga0307285_10149343All Organisms → cellular organisms → Bacteria → Proteobacteria639Open in IMG/M
3300028778|Ga0307288_10223886All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica730Open in IMG/M
3300028784|Ga0307282_10645201Not Available513Open in IMG/M
3300028810|Ga0307294_10038768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1344Open in IMG/M
3300028889|Ga0247827_11340115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria502Open in IMG/M
3300029984|Ga0311332_11039719Not Available658Open in IMG/M
3300029989|Ga0311365_10650950All Organisms → cellular organisms → Bacteria → Proteobacteria913Open in IMG/M
3300029990|Ga0311336_10075933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2631Open in IMG/M
3300031232|Ga0302323_101002241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae928Open in IMG/M
3300031235|Ga0265330_10023551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2796Open in IMG/M
3300031235|Ga0265330_10521236Not Available506Open in IMG/M
3300031247|Ga0265340_10077992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1562Open in IMG/M
3300031250|Ga0265331_10090526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1414Open in IMG/M
3300031474|Ga0170818_109414324Not Available788Open in IMG/M
3300031524|Ga0302320_11476941All Organisms → cellular organisms → Bacteria → Proteobacteria670Open in IMG/M
3300031548|Ga0307408_100619252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium964Open in IMG/M
3300031616|Ga0307508_10422361All Organisms → cellular organisms → Bacteria → Proteobacteria925Open in IMG/M
3300031649|Ga0307514_10378759All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica736Open in IMG/M
3300031708|Ga0310686_105694070Not Available941Open in IMG/M
3300031711|Ga0265314_10092842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1961Open in IMG/M
3300031718|Ga0307474_11173281Not Available607Open in IMG/M
3300031824|Ga0307413_10320007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1184Open in IMG/M
3300031911|Ga0307412_11023361All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica731Open in IMG/M
3300031911|Ga0307412_11533694All Organisms → cellular organisms → Bacteria → Proteobacteria607Open in IMG/M
3300031918|Ga0311367_10685073All Organisms → cellular organisms → Bacteria → Proteobacteria1042Open in IMG/M
3300031938|Ga0308175_100078158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2974Open in IMG/M
3300031938|Ga0308175_100911713Not Available967Open in IMG/M
3300031944|Ga0310884_10859768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus558Open in IMG/M
3300031949|Ga0214473_10568694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1255Open in IMG/M
3300032000|Ga0310903_10770813Not Available524Open in IMG/M
3300032002|Ga0307416_101677745All Organisms → cellular organisms → Bacteria → Proteobacteria740Open in IMG/M
3300032012|Ga0310902_10702683All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica681Open in IMG/M
3300032126|Ga0307415_100665415All Organisms → cellular organisms → Bacteria → Proteobacteria935Open in IMG/M
3300032126|Ga0307415_100799751All Organisms → cellular organisms → Bacteria → Proteobacteria861Open in IMG/M
3300032160|Ga0311301_12298761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium614Open in IMG/M
3300032164|Ga0315283_12297322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium528Open in IMG/M
3300032180|Ga0307471_103417091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus562Open in IMG/M
3300033408|Ga0316605_11647423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae624Open in IMG/M
3300033434|Ga0316613_10618522All Organisms → cellular organisms → Bacteria → Proteobacteria740Open in IMG/M
3300033481|Ga0316600_10097331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1780Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.13%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.75%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.75%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.29%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.29%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.29%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.83%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.83%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.38%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.38%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.38%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.38%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.92%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.92%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.92%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.92%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.46%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.46%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.46%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.46%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.46%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.46%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.46%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.46%
Lake SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment0.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.46%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.46%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.46%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.46%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.46%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.46%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.46%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.46%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.46%
Weathered Mine TailingsEnvironmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings0.46%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.46%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.46%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.46%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.46%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.46%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.46%
Swimming Pool Sandfilter BackwashEngineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash0.46%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908038Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
3300001417Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012EnvironmentalOpen in IMG/M
3300002067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005660Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitateEngineeredOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009120Lake sediment microbial communities from Tanners Lake, St. Paul, MNEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009354Microbial communities from sand-filter backwash in Singapore swimming pools - PR-2EngineeredOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012981Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DT8EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014208Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Groundwater well OW334 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018070Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021976Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022891Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L136-409B-6EnvironmentalOpen in IMG/M
3300022906Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300025297Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes)Host-AssociatedOpen in IMG/M
3300025494Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025619Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026273Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes)EnvironmentalOpen in IMG/M
3300026276Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027959Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_supernatant (SPAdes)EngineeredOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B3_all_c_008303302124908038SoilMKQAFERTGARFRHAFQNEASFSAKRLILVEQLEKNGLNKEIRRPEQSSGAS
JGI20196J14858_100477523300001417Arctic Peat SoilMKQAFEPTGVHLRDAFRSLASFYAKRLILVEQLEKNALNKEIRRS
JGI24735J21928_1021919923300002067Corn RhizosphereMKLAFVRTGTRHRRALRNQASFYAKRLILVEQMEKNGINKEIRRQK*
Ga0062593_10278556223300004114SoilMKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR*
Ga0062589_10003449513300004156SoilMKLAFERTGARHRRALPGSASFSAKRLILVEHSEKNGLNKEIIASQAIATQP*
Ga0062591_10157452813300004643SoilSTVSRLSLVSVRNSRNKSSMKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR*
Ga0070668_10212241013300005347Switchgrass RhizosphereKSSMKLAFERTGARHRRALPGSASFSAKRLILVEHSEKNGLNKEIIASQAIATQP*
Ga0070673_10114199223300005364Switchgrass RhizosphereMKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQKSILPPVLTAG*
Ga0066681_1056895413300005451SoilSLVSVKNSRNKSSMKLAFVRTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK*
Ga0070663_10043091923300005455Corn RhizosphereMKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK*
Ga0070662_10012685623300005457Corn RhizosphereMKLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK*
Ga0068867_10054305313300005459Miscanthus RhizosphereSSMKLAFAPTGTRHRRALRNEVSLYANRLILVEQMEKNGLNKEIRWRH*
Ga0068867_10066327223300005459Miscanthus RhizosphereMKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEI
Ga0070698_10124563923300005471Corn, Switchgrass And Miscanthus RhizosphereMKLAFVRTGTRHRRTLRNEASFYAKRLILVAQMEKNGINKEIRRQKSILPPVLTAG*
Ga0070665_10017977723300005548Switchgrass RhizosphereMKLAFARSGTPHRRALRNEASFYANRLILVAQMEKNGINKEIRRQK*
Ga0070665_10150061623300005548Switchgrass RhizosphereMKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGIN
Ga0070665_10213412723300005548Switchgrass RhizosphereRNRSSMKLAFARTGTRHRRALRNEVSFHAKRLILVAQMEKNGINKEIRRQK*
Ga0066700_1079155823300005559SoilMKLAFERTGARHRRAFWSSASFYRKRLILVEQMEKNGLNKEIRRPQ*
Ga0066670_1058031313300005560SoilSVKNSRNKSSMKPAFVRTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK*
Ga0068857_10139446523300005577Corn RhizosphereMKLAFARTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK*
Ga0068857_10184130413300005577Corn RhizosphereMKSAFERSGARHRRACRNQASFYANRLILVEQMEKNGLNKEIRRR
Ga0068854_10020905523300005578Corn RhizosphereMKLAFAPIGPRHRRALRNEASFYAKRLILVEQMEKNGLNKEIR
Ga0070762_1056210623300005602SoilMGAQLQRAFSSLASIGVKRLILVEQSEKNGLNKEIRRLARPRGAP*
Ga0073904_1002704833300005660Activated SludgeMKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNGLNKEIRRLR*
Ga0066905_10126748613300005713Tropical Forest SoilAFARSGTRHRRALRNEASFYAKRLILVEQMEKNGINK*
Ga0068862_10114533323300005844Switchgrass RhizosphereNKSSMKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK*
Ga0068862_10275013223300005844Switchgrass RhizosphereMKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRR
Ga0081455_1003163123300005937Tabebuia Heterophylla RhizosphereMKLAFARSGTRHRRALRNEASFYAKRLILVEQVEKNGINKEIRRQKSSLPPVFTVD*
Ga0081538_1004762323300005981Tabebuia Heterophylla RhizosphereMKLAFVRTGARHRRALPNEASFYAKRLILVEQMEKNGINKEIRRLN*
Ga0081540_104870523300005983Tabebuia Heterophylla RhizosphereMKLAFARSGTRHRRALRNVASFYAKRLILVEQVEKNGINKEIRRLK*
Ga0081540_127359413300005983Tabebuia Heterophylla RhizosphereMEPAFARSGAQLWRARQTSASFSAKRLILVEYPQMNGLNKEIRRRQGNLAPPLNH
Ga0075363_10001791033300006048Populus EndosphereMKLAFARTGTRHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRLQ*
Ga0075026_10079357413300006057WatershedsNSRNKSSMKLAFARSGTRHRRALRNEPSFYAKRLILVAQMEKNGINKEIRRQK*
Ga0075017_10137497323300006059WatershedsMKQAFKRAGAPLRHAFRNLASFVAKRLILVEQLEKNGLNKEIRRPQRTADHL*
Ga0075366_1071625813300006195Populus EndosphereMKLAFVRTGTRHRRALRNEASFYAKRLILVEQMEKNGINKEI
Ga0075021_1068291423300006354WatershedsMKLAFEHTGARHRRALWNSASFYRKRLILVEQLEKNGLNKEI
Ga0075521_1056410623300006642Arctic Peat SoilMKQAFDRTGARLRHAFQNEASFSAKRLILVEQLEKNGLNKEIRRPHGIEGRT*
Ga0075430_10133565223300006846Populus RhizosphereMKLAFARSGTRHRRALRNEASFYAKRLILVEQEEKNGINKEIRRQKSNLPSVFTVG*
Ga0066797_117853523300006864SoilMKQAFERTGARLRHAFQNMASFSAKRLILVEQLEKNGLNKEIRPPH*
Ga0068865_10083187523300006881Miscanthus RhizosphereRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK*
Ga0068865_10186817823300006881Miscanthus RhizosphereVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK*
Ga0074063_1426214923300006953SoilSRNKSSMKLAFARSGTRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRHR*
Ga0105107_1013203123300009087Freshwater SedimentMKQAFERRGARLRHAFQNVASFYAKRLILVEQLEKNGLNKEIRRLH*
Ga0102851_1109282913300009091Freshwater WetlandsNKSSMKQAFERIGARFRHASRNVASLYAKGLILVEQLEKNGLNKEIRRLQ*
Ga0105240_1164674833300009093Corn RhizosphereMKLAFARSGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQ
Ga0105247_1096034123300009101Switchgrass RhizosphereMKLAFVRTGTRHRRALRNQGSFYAKRLILVAQMEKNGINKEIRRQKSILPPVLTAG*
Ga0117941_107457623300009120Lake SedimentMKQAFERNGARLRHAFLSSASFYAKRLILVEQLEKNGINKEIRRRH*
Ga0099792_1033475923300009143Vadose Zone SoilMKLAFVRTGTRYRRALRNLVSFYAKGLILVEQMEKNGLNKE
Ga0105243_1101605023300009148Miscanthus RhizosphereMKLAFARSGTRHRRALRNEISFYAKRLILVAQMEKNGINKEIRRQKWILPPVFN
Ga0105248_1051246313300009177Switchgrass RhizosphereMKLAFARTGTRHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRWR*
Ga0105248_1244405513300009177Switchgrass RhizosphereMKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEI
Ga0115925_1006553623300009354Swimming Pool Sandfilter BackwashMKLAFEHTGARHRRTLWSSASFYGKRLSLVEQKEKNGLNKYIRRIP*
Ga0105238_1124710113300009551Corn RhizosphereAFVRTGTRHRRALRNQASFYAKRLILVEQMEKNGINKEIRRQK*
Ga0126374_1182913123300009792Tropical Forest SoilMKLAFARSGTRHRRALRNEASFYANRLSLVEQMEKNGINKGIRRLK*
Ga0126305_1095834823300010036Serpentine SoilMKPAFERNGARHRRAFWNSASFYRKRLILVEQLEKNGLNKEIRWPP*
Ga0126304_1006703823300010037Serpentine SoilMKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK*
Ga0134109_1005449013300010320Grasslands SoilSRNKSSMKPAFVRTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK*
Ga0134080_1062860013300010333Grasslands SoilMKLAFERTGARHRRAFWSSASFYRKRLILVEQMEKNGLNKEIRRSQ*
Ga0105239_1221416023300010375Corn RhizosphereMKLAFARSGARHRRALPNEASFYAKRLILVEQLEKNGINKEIRADH*
Ga0134124_1310566523300010397Terrestrial SoilMKLAFENTQGARHRRALPGSASFSAKRLILVEYSQKNGLNKEIMPQQAIAAQP*
Ga0134121_1248884313300010401Terrestrial SoilGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK*
Ga0134123_1178396613300010403Terrestrial SoilMKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKE
Ga0137363_1106300723300012202Vadose Zone SoilMKLAFERTGTRHRRALRNLVSFYAKGLILVKQMEKNGLNKEIRRLH*
Ga0137362_1024970623300012205Vadose Zone SoilMKLAFVRTGTRHRRALRNEVSFYANRLILVEQMEKNGINKEISGSQ*
Ga0137366_1074229023300012354Vadose Zone SoilMKLAFARSGTRHRRALRNEDSFYANRLILVEQMEKNGINKEIRADH*
Ga0137384_1109051013300012357Vadose Zone SoilMKLAFARSGTRHRRALRNEASFYANRLILVEQMEKNGINKEIRADH*
Ga0150984_11335479513300012469Avena Fatua RhizosphereTVSRLSLVSVKNSRNKSSMKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK*
Ga0157309_1006304823300012895SoilVSVKNSRNKSSMKLAFARSGTRHRRALRNEPSFYAKRLILVAQMEKNGINKEIRRQK*
Ga0157292_1032946223300012900SoilMKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRQLR*
Ga0157295_1037741213300012906SoilMKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNGLNKEIR
Ga0157297_1016542823300012914SoilMKLAFARTGTRHRRALRNEASFHAKRLILVAQMEKNGINKEIRRQK*
Ga0137359_1052776423300012923Vadose Zone SoilMKLAFARSGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEI
Ga0137416_1129895213300012927Vadose Zone SoilKSSMKLAFVRTGTRHRRALRNEASFYANRLILVEQMEKNGINKEISGSQ*
Ga0137404_1031538123300012929Vadose Zone SoilMKLAFVRTGTRHRRALRNEVSFYANRLILVEQMEKNGI
Ga0137404_1094608413300012929Vadose Zone SoilMKLAFVRTGTRHRRALRNLASFYAKRLILVEQMEKNGINKEISGSQ*
Ga0153915_1048751933300012931Freshwater WetlandsMEQAFERTGARLRHALQNEASFSAKRLILVEQMKKNGLNKEIRRPTESVGNL*
Ga0164303_1110891413300012957SoilRNSRNKSSMKLAFARSGARHRRALPNEASFYAKRLILVEQLEKNGINKEIRADH*
Ga0164299_1118860613300012958SoilVKNTRNKSSMKLAFARSGTRHRRAIRNEPSFYAKRLILVAQMEKNGINKEIRRQK*
Ga0164301_1046029923300012960SoilMKLAFARSGTRHRRALRNEISFYAKRLILVAQMEKNGINKEIRRQKWILPPVFNYWLTMFAC*
Ga0134110_1059256023300012975Grasslands SoilMKLAFERTGARHRRAFWSSASFYRKRLILVEQMEKNGLNKEIRRLQ*
Ga0168316_100959143300012981Weathered Mine TailingsMKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRQQK*
Ga0164305_1075440223300012989SoilMKLAFARSGARHRRALPNETSFYAKRLILVEQLEKNGINKEIRADH*
Ga0157375_1168469613300013308Miscanthus RhizosphereMKLAFARTGTRHRRALRNLASFYAKRLILVEQMEKN
Ga0120132_107328313300013832PermafrostMKQAFEPTGARLRDAFRSLASFYAKRLILVEQLEKNALNKEIRRPY
Ga0172379_1058877823300014208GroundwaterKNSRNKSSMKQAFERNGARLRHAFLSSASFYAKRLILVEQLEKNGLNKEIRRLH*
Ga0157380_1006573553300014326Switchgrass RhizosphereSRNKSSMKLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK*
Ga0157380_1202457213300014326Switchgrass RhizosphereNSLNKSSMKLAFVRTGTRHRRALRNDASFYAKRLILVAQMEKNGINKEIRRQK*
Ga0182019_1066268823300014498FenMKQAFRRTGARFRHAFQNEASFSAKRLILVEQMKKNGLNNEIRRREESSGTLSTVG*
Ga0181522_1055830223300014657BogMKQAFARTGARLRHAFQSEASFSAKRLILVEQLEKNGINKEISSLAGCPGRP*
Ga0157377_1153536213300014745Miscanthus RhizosphereMKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNGLNK*
Ga0157376_1144662123300014969Miscanthus RhizosphereLVSVKNSRNRSSMKKAFERKGARHRRAFRSLASISAKRLILVEQLEKNGLNKEIRRLRRNRRHA*
Ga0137412_1011504723300015242Vadose Zone SoilMKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK*
Ga0134072_1044776323300015357Grasslands SoilMKLAFERTGARHRRAFWSSASFYRKRLILVEQMEKNGLNKEIRPRQKIRGLHINV*
Ga0132257_10260121823300015373Arabidopsis RhizosphereMKLAFENAQGARHRRALPGSASFSAKRLILVEYSQKNGLNKEIMPQQAIAAQL*
Ga0163161_1021771713300017792Switchgrass RhizosphereSSMKLAFAPTGTRHRRALRNLASFYAKGLILVEQMEKNGLNK
Ga0163161_1030815823300017792Switchgrass RhizosphereMKLAFAPTGTRHRRALRNEASFYANRLILVEQMEKNGLNKEIRRRQ
Ga0187820_131898513300017924Freshwater SedimentSSMKQAFGPTGERLRHALWGLASFYPKRLILVEQMEKNAHNK
Ga0190266_1002911633300017965SoilMKQAAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR
Ga0187805_1043374423300018007Freshwater SedimentMKPAFGRTGARLRHAFQNEASFSAKRLILVEQMQKNGIN
Ga0187887_1017191723300018043PeatlandMKQAFARTGARLRHAFQSEASFSAKRLILVEQLEKNGINKEISSLAGCPGRP
Ga0184616_1027325623300018055Groundwater SedimentMKPAFERTGARHRRAFRSLASFYAKRLILVEQMEKNGLNKEIRRLR
Ga0184611_107281023300018067Groundwater SedimentMKQAFERIGARFRHASRNVASFNAKRLILVEQLEKNEINKEIRRLR
Ga0184631_1011108923300018070Groundwater SedimentMKPAFERTGARHRRAFRSLASFYAKRLILVEQLEKNELNKEIRRPH
Ga0184635_1002234923300018072Groundwater SedimentMKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0190265_1065215923300018422SoilMKLAFVRTGTRHRRTLRNEASFYAKRLILVAQMEKNGINKEIRRQKSILPPVLTAG
Ga0190265_1121018223300018422SoilMKQAFERIGARFRHASQNVASFYAKRLIMVEQLEKNGLNKEIRRLR
Ga0190265_1365484123300018422SoilMKQAFERIGARFRHAFWNVASFYAKRLILVEQMEKNGLNKEIRRVRRSRGHA
Ga0190275_1248587113300018432SoilMKQAFERIGARFRHASQNVASFYAKRLIVVEQLEKNGLNKEIRPPR
Ga0190275_1306354223300018432SoilMKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQKSILPPVLTAG
Ga0066667_1004570923300018433Grasslands SoilMKLAFERTGARHRRAFWSSASFYRKRLILVEQMEKNGLNKEIRRPQ
Ga0190269_1054468623300018465SoilMKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQKSILPPVLIAG
Ga0190269_1100349623300018465SoilMKLAFVRTGTRHRRALRNEASFYAKRLILVEQVEKNGINKEIRRQK
Ga0190274_1111602623300018476SoilMKLAFAPTGARHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRLQ
Ga0190274_1139246313300018476SoilMKLAFARSGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK
Ga0190271_1115638023300018481SoilMKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR
Ga0190273_1127208123300018920SoilMKLAFVRTGTRHRRTLRNEASFYAKRLILVAQMEKNGINKEI
Ga0173479_1033131413300019362SoilMKLAFARTGTRHRRALRNEVSFYAKRLILVAQMEKNG
Ga0190264_1108046423300019377SoilMKQAFERIGARFRNAFQNVASFYAKGLILVEQMEKNGLNKEIRRIR
Ga0193729_110872513300019887SoilSLVSVRNSRNKSSMKLAFARTGTRHRRALRNLASFYANRLILVEQLEKNGINKEIRRLH
Ga0193743_103218443300019889SoilMKQAFERIGARFRHAFRNVASFYAKRLILVEQSEKNGLNKEIRRLR
Ga0210400_1032356433300021170SoilFERTGARPRHAFRSLASFYAKRLILVEQLQKNGLNKEIRRPD
Ga0210400_1054259123300021170SoilRTGARLRHAFQNEASFTAKRLILVEQMKKNGLNKEIRRPEESSGALSTVG
Ga0210394_1033746023300021420SoilMKQAFRRTGARFRHAFQNEASFSAKRLILVEQMKKNGLNKEIRRPEESSGAQ
Ga0210390_1032946513300021474SoilVSVRNSRNKSSMKQAFEPTGARLRHAFRGLASFHAKRLILVEQSPNNALNKGIRCPTELWRRLQTTG
Ga0210402_1026944823300021478SoilMKLAFARSGARHRRALPNEASFYAKRLILVEQLEKNGINKEIRADH
Ga0193742_102192753300021976SoilMKLAFARTGTRHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRLQ
Ga0222622_1031620923300022756Groundwater SedimentMKLAFERTGARHRRALPGSASFSAKRLILVEHSEKNGLNKEIIASQAIATQP
Ga0222622_1082890713300022756Groundwater SedimentPVSVKNSRNKSSMKLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0247770_108710113300022891Plant LitterMKLAFARTGTRHRRALRNEVSFHAKRLILVAQMEKNGINKEIRRQK
Ga0247766_100097623300022906Plant LitterMKLAFARTGTRHRRALRNEASFHAKRLILVAQMEKNGINKEIRRQK
Ga0247790_1002267123300022915SoilMKLAFARTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK
Ga0224557_125965013300023101SoilMKQAFEPTGVRLRDAFRSLASFYAKRLILVEQLEKNAIN
Ga0247800_113256913300023263SoilVSVKNSRNKSSMKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0209758_103164923300025297Arabidopsis RhizosphereMKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0207928_104416123300025494Arctic Peat SoilMKQAFERTGARFRHAFQNEASFSAKRLILVEQMQKNGINKEIRRPWESPGAL
Ga0207926_107544513300025619Arctic Peat SoilMKQALGRTGARLRHAFQSVASFSAKRLILVEQLEKNGLNKEIRRTHGI
Ga0209483_101591763300025862Arctic Peat SoilMKQAFERKGARFRHAFQSLASFYAKRLILIEQLEKNAINKQIMWNSEP
Ga0207682_1013983823300025893Miscanthus RhizosphereMKLAFARTGTRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRRQ
Ga0207647_1050223623300025904Corn RhizosphereMKLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0207645_1093997023300025907Miscanthus RhizosphereMKLAFAPTGTRHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRLQ
Ga0207643_1029103723300025908Miscanthus RhizosphereMKLAFARTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQKRILP
Ga0207695_1043885633300025913Corn RhizosphereKNSRNKSSMKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0207693_1040742423300025915Corn, Switchgrass And Miscanthus RhizosphereMKPAFARSGTRHRRALRNQASFYANRLILVEQMEKNGINKE
Ga0207663_1101563523300025916Corn, Switchgrass And Miscanthus RhizosphereVSVKNSRKRSSMKLAFARNGTRHRRALRNLASFYAKRLILVEQLEKNGLNKEIRPLQ
Ga0207660_1079011023300025917Corn RhizosphereLVSVKNSRNKSSMKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0207681_1012278733300025923Switchgrass RhizosphereLVSVRNSRNKSSMKLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0207681_1130048613300025923Switchgrass RhizosphereKNSRNRSSMKLAFAPIGPRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRRQ
Ga0207659_1051322913300025926Miscanthus RhizosphereKNSRNKSSMKLAFARSGTRHRRALRNEPSFYAKRLILVAQMEKNGINKEIRRQK
Ga0207644_1009600143300025931Switchgrass RhizosphereLAFAPIGPRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRRQ
Ga0207709_1023106733300025935Miscanthus RhizosphereMKLAFAPIGPRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRRQ
Ga0207709_1095584523300025935Miscanthus RhizosphereKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0207704_1057882123300025938Miscanthus RhizosphereKLAFAPTGTRHRRALRNEVSLYANRLILVEQMEKNGLNKEIRRRH
Ga0207704_1117580723300025938Miscanthus RhizosphereRNKSSMKLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0207711_1130655023300025941Switchgrass RhizosphereMKLAFARTGTRHRRALRNEVSFYAKRLILVAQMEKNGI
Ga0207689_1068667713300025942Miscanthus RhizosphereMKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0207651_1077935723300025960Switchgrass RhizosphereMKLAFARSGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQKWILPPVFNYWLTMFAC
Ga0207668_1049512913300025972Switchgrass RhizosphereMKLAFARSGTRHRRALRNEISFYAKRLILVAQMEKNGINKEI
Ga0207658_1105065723300025986Switchgrass RhizosphereKLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0207677_1007500423300026023Miscanthus RhizosphereMKLAFAPTGTRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRRQ
Ga0207675_10199393613300026118Switchgrass RhizosphereRIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR
Ga0207698_1195142613300026142Corn RhizosphereSVKNSRNRSSMKLAFAPIGTRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRRQ
Ga0209881_102698123300026273SoilMKQAFERTGARLRHAFQNMASFSAKRLILVEQLEKNGLNKEIRPPH
Ga0209847_101453623300026276Permafrost SoilMNQAFERTGAQLRRAFSSLPSICAKRLILVEQSEKNGLNKEITRFTALRGRAVNR
Ga0209027_113343223300026300Grasslands SoilMKLAFERTGARHRRAFWSSASFYRKRLILVEQMEKN
Ga0209471_117502213300026318SoilMKLAFVRTGTRHRRALRNEVSFYAKRLILVAQMEKNGINK
Ga0209474_1033797723300026550SoilSVKNSRNKSSMKPAFVRTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK
Ga0209008_103638613300027545Forest SoilMKQAFEPTGARLRDAFRSLASFYAKRLILVEQLEKNSLNKEI
Ga0209574_1018565923300027809AgaveKLAFARSGTPHRRALRNKASFYANRLILVAQMEKNGINKEIRRQN
Ga0209693_1011682513300027855SoilAFERTGARFRHAFQSSASICANRLILVEQLEKNGINK
Ga0209624_1083803623300027895Forest SoilMKQAFEPTGVRLRDAFRSLASFYAKRLILVEQLEKNALNKEI
Ga0209048_1025348013300027902Freshwater Lake SedimentMKQAFGRTGARLRHAFQNEASFFAKRLILVEQMKKNGLNKEIRRPAESADLL
Ga0209006_1048060823300027908Forest SoilMKQAFEPTGARLRDAFRSLASFYAKRLILVEQLEKNSLN
Ga0209006_1150344023300027908Forest SoilMKHAFERTGARFRHAFQSWASICANRLILVEQLEKNGINK
Ga0209477_105471923300027959Activated SludgeMKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNGLNKEIRRLR
Ga0268266_1030121423300028379Switchgrass RhizosphereMKLAFARSGTPHRRALRNEASFYANRLILVAQMEKNGINKEIRRQK
Ga0268266_1225489623300028379Switchgrass RhizosphereAFARTGTRHRRALRNSASFYAKRLILVEQMEKNGLNKEIRRPQ
Ga0307293_1023478023300028711SoilSLVSVKNSRNKSSMKLAFVRTGTRHRRALRNLASFYAKRLILVAQMEKNGINKEIRRQK
Ga0307285_1009986413300028712SoilLAFAPTGTRHRRALRNLASFYAKGLILVEQMEKNGLNK
Ga0307285_1014934323300028712SoilSLLSLVSVRNSRNKSSMKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR
Ga0307288_1022388623300028778SoilIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR
Ga0307282_1064520113300028784SoilMKLAFARTGTRHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRP
Ga0307294_1003876813300028810SoilKNSRNKSSMKLAFERTGARHRRALPGSASFSAKRLILVEHSEKNGLNKEIIASQAIATQP
Ga0247827_1134011523300028889SoilMKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEISGFVESGSGCK
Ga0311332_1103971923300029984FenMKQAFERKGARHRRAFRSLASISAKRLILVEQLEKNGINKEIRRLHRIRAR
Ga0311365_1065095023300029989FenSRNKSSMKLAFARSGTRHRRALRNKPSFYAKRLILVAQMEKNGINKEIRRQK
Ga0311336_1007593343300029990FenMKLAFARSGTRHRRALRNKPSFYAKRLILVAQMEKNGINKEIRRQK
Ga0302323_10100224123300031232FenMKQAFGRTGARFRHAFQNEASFSAKRLILVEQMKKNGLNK
Ga0265330_1002355153300031235RhizosphereMKQAFGRTGARFRHALQNEASFSANRLILVEQMKKNGLNKEISRPEPSSGAL
Ga0265330_1052123613300031235RhizosphereMKQAFRRTGARLRHAFQNEASFSAKRLILVEQMKK
Ga0265340_1007799223300031247RhizosphereMKQAFRRTGARFRHAFQNEASFSAKRLILVEQMKKNGLNKEIRRPEESSGTLSTGG
Ga0265331_1009052623300031250RhizosphereMKPAFERTGARHRRAFQCQASFSAKRLILVEQLEKNGINKEIR
Ga0170818_10941432423300031474Forest SoilMKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKN
Ga0302320_1147694123300031524BogMKPAFEPVGRAQFRRAFRSLASFNAKRLILIEQLEKNALNKKIMTAQCSG
Ga0307408_10061925223300031548RhizosphereMKLAFVRTGTRHRRALRNEASFYAKRLILVEQMEKNGINKEIRRQK
Ga0307508_1042236113300031616EctomycorrhizaRNKSSMKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0307514_1037875913300031649EctomycorrhizaSLVSVKNSRNKSSMKLAFARSGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK
Ga0310686_10569407023300031708SoilMKQAFEPTGARLRAAFRSLASFYAKRLILVEQLEKNSLN
Ga0265314_1009284243300031711RhizosphereTGARFRHALQNEASFSANRLILVEQMKKNGLNKEISRPEPSSGAL
Ga0307474_1117328113300031718Hardwood Forest SoilMKQAFEPTGERLRDAFRSLASFYAKRLILVEQLEKNALNKE
Ga0307413_1032000713300031824RhizosphereNSRNRSSMKLAFARTGTRHRRALRNEVSFHAKRLILVAQMEKNGINKEIRRQK
Ga0307412_1102336123300031911RhizosphereKNSRNKSSMKLAFVRTGTRHRRALRNEASFYAKRLILVEQMEKNGINKEIRRQK
Ga0307412_1153369423300031911RhizosphereLVSVRNSRNKSSMNQAFERIGARFRHASRNGASFYAKRLILVEQLEKNGLNKEIRRLR
Ga0311367_1068507313300031918FenSRNKSSMKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK
Ga0308175_10007815843300031938SoilMKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRLN
Ga0308175_10091171313300031938SoilMKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGI
Ga0310884_1085976813300031944SoilRNKSSMKLAFVRTGTRHRRALRNQASFYAKRLILVEQMEKNGLNKEIRPRQ
Ga0214473_1056869423300031949SoilMKPAFERTGARHRRAFRSLASFYAKRLILVEQMEKNGLNKEIRRLHGIRGAL
Ga0310903_1077081323300032000SoilMKLAFAPTGTRHRRALRNEASFYANRLILVEQMEKNGLNKEIR
Ga0307416_10167774513300032002RhizosphereMKQAFERIGARFRRAFRNEASFYAKRLILVEQLEKNGLNKEIRRLQ
Ga0310902_1070268323300032012SoilLSLVSVKNSRNRSSMKLAFAPTGTRHRRALRNEASFYANRLILVEQMEKNGLNKEIRPRQ
Ga0307415_10066541523300032126RhizosphereLSLVSVRNSRNKSSMKLAFARTGTRHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRLQ
Ga0307415_10079975113300032126RhizosphereKLAFVRTGTRHRRALRNEASFYAKRLILVEQMEKNGINKEIRRQK
Ga0311301_1229876123300032160Peatlands SoilMKQAFERTGARLRHAFQNVASICGKRLILVEQLEKNGLNKEIRRPQ
Ga0315283_1229732223300032164SedimentMKQAFERIGARLRHASRNVASFYAKRLILVEQLEKNGLNKEIRRLQ
Ga0307471_10341709113300032180Hardwood Forest SoilRNKSSMKLAFVRTGTRHRRALRNEASFYANRLILVEQMEKNGLNKEIRPRQ
Ga0316605_1164742323300033408SoilMKLAFERIGARLRHAFRNVASFYAKRLILVEQLEKNGLNKEIRRLR
Ga0316613_1061852213300033434SoilFERIGARFRHASRNVASFYAKRLILVEQLEKNGLNKEIRRLH
Ga0316600_1009733123300033481SoilMKQAFERIGARLRHAFRNGASFYAKRLILVEQLEKNGLNKEIRRLQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.