| Basic Information | |
|---|---|
| Family ID | F021570 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 218 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKLAFVRTGTRHRRALRNEASFYAKRLILVEQMEKNGINKEIRRQK |
| Number of Associated Samples | 190 |
| Number of Associated Scaffolds | 218 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.85 % |
| % of genes near scaffold ends (potentially truncated) | 53.67 % |
| % of genes from short scaffolds (< 2000 bps) | 88.53 % |
| Associated GOLD sequencing projects | 182 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.440 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.679 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.862 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.743 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.70% β-sheet: 0.00% Coil/Unstructured: 47.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 218 Family Scaffolds |
|---|---|---|
| PF10090 | HPTransfase | 47.25 |
| PF01627 | Hpt | 34.86 |
| PF02895 | H-kinase_dim | 9.63 |
| PF00459 | Inositol_P | 6.42 |
| PF06577 | EipA | 0.46 |
| PF00069 | Pkinase | 0.46 |
| PF00512 | HisKA | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 218 Family Scaffolds |
|---|---|---|---|
| COG0643 | Chemotaxis protein histidine kinase CheA | Signal transduction mechanisms [T] | 19.27 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.44 % |
| Unclassified | root | N/A | 21.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908038|B3_all_c_ConsensusfromContig105031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 879 | Open in IMG/M |
| 3300001417|JGI20196J14858_1004775 | Not Available | 1175 | Open in IMG/M |
| 3300002067|JGI24735J21928_10219199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300004114|Ga0062593_102785562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300004156|Ga0062589_100034495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2631 | Open in IMG/M |
| 3300004643|Ga0062591_101574528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300005347|Ga0070668_102122410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300005364|Ga0070673_101141992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 729 | Open in IMG/M |
| 3300005451|Ga0066681_10568954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | 699 | Open in IMG/M |
| 3300005455|Ga0070663_100430919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1083 | Open in IMG/M |
| 3300005457|Ga0070662_100126856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1962 | Open in IMG/M |
| 3300005459|Ga0068867_100543053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1006 | Open in IMG/M |
| 3300005459|Ga0068867_100663272 | Not Available | 916 | Open in IMG/M |
| 3300005471|Ga0070698_101245639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 693 | Open in IMG/M |
| 3300005548|Ga0070665_100179777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2116 | Open in IMG/M |
| 3300005548|Ga0070665_101500616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 682 | Open in IMG/M |
| 3300005548|Ga0070665_102134127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300005559|Ga0066700_10791558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 640 | Open in IMG/M |
| 3300005560|Ga0066670_10580313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 684 | Open in IMG/M |
| 3300005577|Ga0068857_101394465 | Not Available | 681 | Open in IMG/M |
| 3300005577|Ga0068857_101841304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| 3300005578|Ga0068854_100209055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1538 | Open in IMG/M |
| 3300005602|Ga0070762_10562106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 754 | Open in IMG/M |
| 3300005660|Ga0073904_10027048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3824 | Open in IMG/M |
| 3300005713|Ga0066905_101267486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 662 | Open in IMG/M |
| 3300005844|Ga0068862_101145333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 774 | Open in IMG/M |
| 3300005844|Ga0068862_102750132 | Not Available | 503 | Open in IMG/M |
| 3300005937|Ga0081455_10031631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 4782 | Open in IMG/M |
| 3300005981|Ga0081538_10047623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2627 | Open in IMG/M |
| 3300005983|Ga0081540_1048705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2120 | Open in IMG/M |
| 3300005983|Ga0081540_1273594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 584 | Open in IMG/M |
| 3300006048|Ga0075363_100017910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3521 | Open in IMG/M |
| 3300006057|Ga0075026_100793574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300006059|Ga0075017_101374973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 555 | Open in IMG/M |
| 3300006195|Ga0075366_10716258 | Not Available | 621 | Open in IMG/M |
| 3300006354|Ga0075021_10682914 | Not Available | 659 | Open in IMG/M |
| 3300006642|Ga0075521_10564106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 560 | Open in IMG/M |
| 3300006846|Ga0075430_101335652 | Not Available | 590 | Open in IMG/M |
| 3300006864|Ga0066797_1178535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 741 | Open in IMG/M |
| 3300006881|Ga0068865_100831875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 798 | Open in IMG/M |
| 3300006881|Ga0068865_101868178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | 543 | Open in IMG/M |
| 3300006953|Ga0074063_14262149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 722 | Open in IMG/M |
| 3300009087|Ga0105107_10132031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1758 | Open in IMG/M |
| 3300009091|Ga0102851_11092829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 872 | Open in IMG/M |
| 3300009093|Ga0105240_11646748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 671 | Open in IMG/M |
| 3300009101|Ga0105247_10960341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 664 | Open in IMG/M |
| 3300009120|Ga0117941_1074576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 916 | Open in IMG/M |
| 3300009143|Ga0099792_10334759 | Not Available | 909 | Open in IMG/M |
| 3300009148|Ga0105243_11016050 | Not Available | 833 | Open in IMG/M |
| 3300009177|Ga0105248_10512463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1352 | Open in IMG/M |
| 3300009177|Ga0105248_12444055 | Not Available | 595 | Open in IMG/M |
| 3300009354|Ga0115925_10065536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 571 | Open in IMG/M |
| 3300009551|Ga0105238_11247101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300009792|Ga0126374_11829131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 509 | Open in IMG/M |
| 3300010036|Ga0126305_10958348 | Not Available | 586 | Open in IMG/M |
| 3300010037|Ga0126304_10067038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2212 | Open in IMG/M |
| 3300010320|Ga0134109_10054490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1330 | Open in IMG/M |
| 3300010333|Ga0134080_10628600 | Not Available | 525 | Open in IMG/M |
| 3300010375|Ga0105239_12214160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 639 | Open in IMG/M |
| 3300010397|Ga0134124_13105665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300010401|Ga0134121_12488843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300010403|Ga0134123_11783966 | Not Available | 668 | Open in IMG/M |
| 3300012202|Ga0137363_11063007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 688 | Open in IMG/M |
| 3300012205|Ga0137362_10249706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1532 | Open in IMG/M |
| 3300012354|Ga0137366_10742290 | Not Available | 698 | Open in IMG/M |
| 3300012357|Ga0137384_11090510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 640 | Open in IMG/M |
| 3300012469|Ga0150984_113354795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1275 | Open in IMG/M |
| 3300012895|Ga0157309_10063048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 949 | Open in IMG/M |
| 3300012900|Ga0157292_10329462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
| 3300012906|Ga0157295_10377412 | Not Available | 522 | Open in IMG/M |
| 3300012914|Ga0157297_10165428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 735 | Open in IMG/M |
| 3300012923|Ga0137359_10527764 | Not Available | 1040 | Open in IMG/M |
| 3300012927|Ga0137416_11298952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300012929|Ga0137404_10315381 | Not Available | 1360 | Open in IMG/M |
| 3300012929|Ga0137404_10946084 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
| 3300012931|Ga0153915_10487519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1408 | Open in IMG/M |
| 3300012957|Ga0164303_11108914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300012958|Ga0164299_11188606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300012975|Ga0134110_10592560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300012981|Ga0168316_100959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 10398 | Open in IMG/M |
| 3300012989|Ga0164305_10754402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 802 | Open in IMG/M |
| 3300013308|Ga0157375_11684696 | Not Available | 751 | Open in IMG/M |
| 3300013832|Ga0120132_1073283 | Not Available | 690 | Open in IMG/M |
| 3300014208|Ga0172379_10588778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 691 | Open in IMG/M |
| 3300014326|Ga0157380_10065735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2916 | Open in IMG/M |
| 3300014326|Ga0157380_12024572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300014498|Ga0182019_10662688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 737 | Open in IMG/M |
| 3300014657|Ga0181522_10558302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 693 | Open in IMG/M |
| 3300014745|Ga0157377_11535362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300014969|Ga0157376_11446621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300015242|Ga0137412_10115047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2182 | Open in IMG/M |
| 3300015357|Ga0134072_10447763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 520 | Open in IMG/M |
| 3300015373|Ga0132257_102601218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 658 | Open in IMG/M |
| 3300017792|Ga0163161_10217717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1478 | Open in IMG/M |
| 3300017792|Ga0163161_10308158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1249 | Open in IMG/M |
| 3300017924|Ga0187820_1318985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300017965|Ga0190266_10029116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1733 | Open in IMG/M |
| 3300018007|Ga0187805_10433744 | Not Available | 612 | Open in IMG/M |
| 3300018043|Ga0187887_10171917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1293 | Open in IMG/M |
| 3300018055|Ga0184616_10273256 | Not Available | 642 | Open in IMG/M |
| 3300018067|Ga0184611_1072810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1170 | Open in IMG/M |
| 3300018070|Ga0184631_10111089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1076 | Open in IMG/M |
| 3300018072|Ga0184635_10022349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2329 | Open in IMG/M |
| 3300018422|Ga0190265_10652159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1173 | Open in IMG/M |
| 3300018422|Ga0190265_11210182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300018422|Ga0190265_13654841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 513 | Open in IMG/M |
| 3300018432|Ga0190275_12485871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
| 3300018432|Ga0190275_13063542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300018433|Ga0066667_10045709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2602 | Open in IMG/M |
| 3300018465|Ga0190269_10544686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 767 | Open in IMG/M |
| 3300018465|Ga0190269_11003496 | Not Available | 631 | Open in IMG/M |
| 3300018476|Ga0190274_11116026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 869 | Open in IMG/M |
| 3300018476|Ga0190274_11392463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 790 | Open in IMG/M |
| 3300018481|Ga0190271_11156380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 897 | Open in IMG/M |
| 3300018920|Ga0190273_11272081 | Not Available | 632 | Open in IMG/M |
| 3300019362|Ga0173479_10331314 | Not Available | 707 | Open in IMG/M |
| 3300019377|Ga0190264_11080464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 652 | Open in IMG/M |
| 3300019887|Ga0193729_1108725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
| 3300019889|Ga0193743_1032184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 2494 | Open in IMG/M |
| 3300021170|Ga0210400_10323564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1267 | Open in IMG/M |
| 3300021170|Ga0210400_10542591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 959 | Open in IMG/M |
| 3300021420|Ga0210394_10337460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1324 | Open in IMG/M |
| 3300021474|Ga0210390_10329465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1293 | Open in IMG/M |
| 3300021478|Ga0210402_10269448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1574 | Open in IMG/M |
| 3300021976|Ga0193742_1021927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3188 | Open in IMG/M |
| 3300022756|Ga0222622_10316209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1079 | Open in IMG/M |
| 3300022756|Ga0222622_10828907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
| 3300022891|Ga0247770_1087101 | Not Available | 922 | Open in IMG/M |
| 3300022906|Ga0247766_1000976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5258 | Open in IMG/M |
| 3300022915|Ga0247790_10022671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1354 | Open in IMG/M |
| 3300023101|Ga0224557_1259650 | Not Available | 570 | Open in IMG/M |
| 3300023263|Ga0247800_1132569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300025297|Ga0209758_1031649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2166 | Open in IMG/M |
| 3300025494|Ga0207928_1044161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 853 | Open in IMG/M |
| 3300025619|Ga0207926_1075445 | Not Available | 866 | Open in IMG/M |
| 3300025862|Ga0209483_1015917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4005 | Open in IMG/M |
| 3300025893|Ga0207682_10139838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1086 | Open in IMG/M |
| 3300025904|Ga0207647_10502236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 676 | Open in IMG/M |
| 3300025907|Ga0207645_10939970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300025908|Ga0207643_10291037 | Not Available | 1015 | Open in IMG/M |
| 3300025913|Ga0207695_10438856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1189 | Open in IMG/M |
| 3300025915|Ga0207693_10407424 | Not Available | 1063 | Open in IMG/M |
| 3300025916|Ga0207663_11015635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 665 | Open in IMG/M |
| 3300025917|Ga0207660_10790110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300025923|Ga0207681_10122787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1907 | Open in IMG/M |
| 3300025923|Ga0207681_11300486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300025926|Ga0207659_10513229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1016 | Open in IMG/M |
| 3300025931|Ga0207644_10096001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2218 | Open in IMG/M |
| 3300025935|Ga0207709_10231067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1340 | Open in IMG/M |
| 3300025935|Ga0207709_10955845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 699 | Open in IMG/M |
| 3300025938|Ga0207704_10578821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
| 3300025938|Ga0207704_11175807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300025941|Ga0207711_11306550 | Not Available | 667 | Open in IMG/M |
| 3300025942|Ga0207689_10686677 | Not Available | 863 | Open in IMG/M |
| 3300025972|Ga0207668_10495129 | Not Available | 1050 | Open in IMG/M |
| 3300025986|Ga0207658_11050657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300026023|Ga0207677_10075004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2402 | Open in IMG/M |
| 3300026118|Ga0207675_101993936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 598 | Open in IMG/M |
| 3300026142|Ga0207698_11951426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300026273|Ga0209881_1026981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1383 | Open in IMG/M |
| 3300026276|Ga0209847_1014536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1718 | Open in IMG/M |
| 3300026300|Ga0209027_1133432 | Not Available | 857 | Open in IMG/M |
| 3300026318|Ga0209471_1175022 | Not Available | 855 | Open in IMG/M |
| 3300026550|Ga0209474_10337977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 854 | Open in IMG/M |
| 3300027545|Ga0209008_1036386 | Not Available | 1138 | Open in IMG/M |
| 3300027809|Ga0209574_10185659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300027855|Ga0209693_10116825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1321 | Open in IMG/M |
| 3300027895|Ga0209624_10838036 | Not Available | 602 | Open in IMG/M |
| 3300027902|Ga0209048_10253480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium nitroreducens | 1253 | Open in IMG/M |
| 3300027908|Ga0209006_10480608 | Not Available | 1038 | Open in IMG/M |
| 3300027908|Ga0209006_11503440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300027959|Ga0209477_1054719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1487 | Open in IMG/M |
| 3300028379|Ga0268266_10301214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1495 | Open in IMG/M |
| 3300028379|Ga0268266_12254896 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300028711|Ga0307293_10234780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300028712|Ga0307285_10099864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300028712|Ga0307285_10149343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300028778|Ga0307288_10223886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 730 | Open in IMG/M |
| 3300028784|Ga0307282_10645201 | Not Available | 513 | Open in IMG/M |
| 3300028810|Ga0307294_10038768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1344 | Open in IMG/M |
| 3300028889|Ga0247827_11340115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300029984|Ga0311332_11039719 | Not Available | 658 | Open in IMG/M |
| 3300029989|Ga0311365_10650950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
| 3300029990|Ga0311336_10075933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2631 | Open in IMG/M |
| 3300031232|Ga0302323_101002241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 928 | Open in IMG/M |
| 3300031235|Ga0265330_10023551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2796 | Open in IMG/M |
| 3300031235|Ga0265330_10521236 | Not Available | 506 | Open in IMG/M |
| 3300031247|Ga0265340_10077992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1562 | Open in IMG/M |
| 3300031250|Ga0265331_10090526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1414 | Open in IMG/M |
| 3300031474|Ga0170818_109414324 | Not Available | 788 | Open in IMG/M |
| 3300031524|Ga0302320_11476941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300031548|Ga0307408_100619252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 964 | Open in IMG/M |
| 3300031616|Ga0307508_10422361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 925 | Open in IMG/M |
| 3300031649|Ga0307514_10378759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 736 | Open in IMG/M |
| 3300031708|Ga0310686_105694070 | Not Available | 941 | Open in IMG/M |
| 3300031711|Ga0265314_10092842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1961 | Open in IMG/M |
| 3300031718|Ga0307474_11173281 | Not Available | 607 | Open in IMG/M |
| 3300031824|Ga0307413_10320007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1184 | Open in IMG/M |
| 3300031911|Ga0307412_11023361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 731 | Open in IMG/M |
| 3300031911|Ga0307412_11533694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300031918|Ga0311367_10685073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1042 | Open in IMG/M |
| 3300031938|Ga0308175_100078158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2974 | Open in IMG/M |
| 3300031938|Ga0308175_100911713 | Not Available | 967 | Open in IMG/M |
| 3300031944|Ga0310884_10859768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | 558 | Open in IMG/M |
| 3300031949|Ga0214473_10568694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1255 | Open in IMG/M |
| 3300032000|Ga0310903_10770813 | Not Available | 524 | Open in IMG/M |
| 3300032002|Ga0307416_101677745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300032012|Ga0310902_10702683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 681 | Open in IMG/M |
| 3300032126|Ga0307415_100665415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
| 3300032126|Ga0307415_100799751 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 861 | Open in IMG/M |
| 3300032160|Ga0311301_12298761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 614 | Open in IMG/M |
| 3300032164|Ga0315283_12297322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 528 | Open in IMG/M |
| 3300032180|Ga0307471_103417091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | 562 | Open in IMG/M |
| 3300033408|Ga0316605_11647423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 624 | Open in IMG/M |
| 3300033434|Ga0316613_10618522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300033481|Ga0316600_10097331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1780 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.13% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.75% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.29% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.29% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.29% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.38% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.38% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.92% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.92% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.92% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.92% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.46% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.46% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.46% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.46% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.46% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.46% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.46% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.46% |
| Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.46% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.46% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.46% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.46% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.46% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.46% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.46% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.46% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.46% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.46% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.46% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.46% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.46% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.46% |
| Swimming Pool Sandfilter Backwash | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908038 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 3300001417 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 | Environmental | Open in IMG/M |
| 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005660 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate | Engineered | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009354 | Microbial communities from sand-filter backwash in Singapore swimming pools - PR-2 | Engineered | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012981 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DT8 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014208 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Groundwater well OW334 metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021976 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022891 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L136-409B-6 | Environmental | Open in IMG/M |
| 3300022906 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025619 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026276 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027959 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_supernatant (SPAdes) | Engineered | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B3_all_c_00830330 | 2124908038 | Soil | MKQAFERTGARFRHAFQNEASFSAKRLILVEQLEKNGLNKEIRRPEQSSGAS |
| JGI20196J14858_10047752 | 3300001417 | Arctic Peat Soil | MKQAFEPTGVHLRDAFRSLASFYAKRLILVEQLEKNALNKEIRRS |
| JGI24735J21928_102191992 | 3300002067 | Corn Rhizosphere | MKLAFVRTGTRHRRALRNQASFYAKRLILVEQMEKNGINKEIRRQK* |
| Ga0062593_1027855622 | 3300004114 | Soil | MKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR* |
| Ga0062589_1000344951 | 3300004156 | Soil | MKLAFERTGARHRRALPGSASFSAKRLILVEHSEKNGLNKEIIASQAIATQP* |
| Ga0062591_1015745281 | 3300004643 | Soil | STVSRLSLVSVRNSRNKSSMKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR* |
| Ga0070668_1021224101 | 3300005347 | Switchgrass Rhizosphere | KSSMKLAFERTGARHRRALPGSASFSAKRLILVEHSEKNGLNKEIIASQAIATQP* |
| Ga0070673_1011419922 | 3300005364 | Switchgrass Rhizosphere | MKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQKSILPPVLTAG* |
| Ga0066681_105689541 | 3300005451 | Soil | SLVSVKNSRNKSSMKLAFVRTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0070663_1004309192 | 3300005455 | Corn Rhizosphere | MKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0070662_1001268562 | 3300005457 | Corn Rhizosphere | MKLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0068867_1005430531 | 3300005459 | Miscanthus Rhizosphere | SSMKLAFAPTGTRHRRALRNEVSLYANRLILVEQMEKNGLNKEIRWRH* |
| Ga0068867_1006632722 | 3300005459 | Miscanthus Rhizosphere | MKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEI |
| Ga0070698_1012456392 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLAFVRTGTRHRRTLRNEASFYAKRLILVAQMEKNGINKEIRRQKSILPPVLTAG* |
| Ga0070665_1001797772 | 3300005548 | Switchgrass Rhizosphere | MKLAFARSGTPHRRALRNEASFYANRLILVAQMEKNGINKEIRRQK* |
| Ga0070665_1015006162 | 3300005548 | Switchgrass Rhizosphere | MKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGIN |
| Ga0070665_1021341272 | 3300005548 | Switchgrass Rhizosphere | RNRSSMKLAFARTGTRHRRALRNEVSFHAKRLILVAQMEKNGINKEIRRQK* |
| Ga0066700_107915582 | 3300005559 | Soil | MKLAFERTGARHRRAFWSSASFYRKRLILVEQMEKNGLNKEIRRPQ* |
| Ga0066670_105803131 | 3300005560 | Soil | SVKNSRNKSSMKPAFVRTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0068857_1013944652 | 3300005577 | Corn Rhizosphere | MKLAFARTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0068857_1018413041 | 3300005577 | Corn Rhizosphere | MKSAFERSGARHRRACRNQASFYANRLILVEQMEKNGLNKEIRRR |
| Ga0068854_1002090552 | 3300005578 | Corn Rhizosphere | MKLAFAPIGPRHRRALRNEASFYAKRLILVEQMEKNGLNKEIR |
| Ga0070762_105621062 | 3300005602 | Soil | MGAQLQRAFSSLASIGVKRLILVEQSEKNGLNKEIRRLARPRGAP* |
| Ga0073904_100270483 | 3300005660 | Activated Sludge | MKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNGLNKEIRRLR* |
| Ga0066905_1012674861 | 3300005713 | Tropical Forest Soil | AFARSGTRHRRALRNEASFYAKRLILVEQMEKNGINK* |
| Ga0068862_1011453332 | 3300005844 | Switchgrass Rhizosphere | NKSSMKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0068862_1027501322 | 3300005844 | Switchgrass Rhizosphere | MKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRR |
| Ga0081455_100316312 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKLAFARSGTRHRRALRNEASFYAKRLILVEQVEKNGINKEIRRQKSSLPPVFTVD* |
| Ga0081538_100476232 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MKLAFVRTGARHRRALPNEASFYAKRLILVEQMEKNGINKEIRRLN* |
| Ga0081540_10487052 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKLAFARSGTRHRRALRNVASFYAKRLILVEQVEKNGINKEIRRLK* |
| Ga0081540_12735941 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MEPAFARSGAQLWRARQTSASFSAKRLILVEYPQMNGLNKEIRRRQGNLAPPLNH |
| Ga0075363_1000179103 | 3300006048 | Populus Endosphere | MKLAFARTGTRHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRLQ* |
| Ga0075026_1007935741 | 3300006057 | Watersheds | NSRNKSSMKLAFARSGTRHRRALRNEPSFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0075017_1013749732 | 3300006059 | Watersheds | MKQAFKRAGAPLRHAFRNLASFVAKRLILVEQLEKNGLNKEIRRPQRTADHL* |
| Ga0075366_107162581 | 3300006195 | Populus Endosphere | MKLAFVRTGTRHRRALRNEASFYAKRLILVEQMEKNGINKEI |
| Ga0075021_106829142 | 3300006354 | Watersheds | MKLAFEHTGARHRRALWNSASFYRKRLILVEQLEKNGLNKEI |
| Ga0075521_105641062 | 3300006642 | Arctic Peat Soil | MKQAFDRTGARLRHAFQNEASFSAKRLILVEQLEKNGLNKEIRRPHGIEGRT* |
| Ga0075430_1013356522 | 3300006846 | Populus Rhizosphere | MKLAFARSGTRHRRALRNEASFYAKRLILVEQEEKNGINKEIRRQKSNLPSVFTVG* |
| Ga0066797_11785352 | 3300006864 | Soil | MKQAFERTGARLRHAFQNMASFSAKRLILVEQLEKNGLNKEIRPPH* |
| Ga0068865_1008318752 | 3300006881 | Miscanthus Rhizosphere | RTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0068865_1018681782 | 3300006881 | Miscanthus Rhizosphere | VRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0074063_142621492 | 3300006953 | Soil | SRNKSSMKLAFARSGTRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRHR* |
| Ga0105107_101320312 | 3300009087 | Freshwater Sediment | MKQAFERRGARLRHAFQNVASFYAKRLILVEQLEKNGLNKEIRRLH* |
| Ga0102851_110928291 | 3300009091 | Freshwater Wetlands | NKSSMKQAFERIGARFRHASRNVASLYAKGLILVEQLEKNGLNKEIRRLQ* |
| Ga0105240_116467483 | 3300009093 | Corn Rhizosphere | MKLAFARSGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQ |
| Ga0105247_109603412 | 3300009101 | Switchgrass Rhizosphere | MKLAFVRTGTRHRRALRNQGSFYAKRLILVAQMEKNGINKEIRRQKSILPPVLTAG* |
| Ga0117941_10745762 | 3300009120 | Lake Sediment | MKQAFERNGARLRHAFLSSASFYAKRLILVEQLEKNGINKEIRRRH* |
| Ga0099792_103347592 | 3300009143 | Vadose Zone Soil | MKLAFVRTGTRYRRALRNLVSFYAKGLILVEQMEKNGLNKE |
| Ga0105243_110160502 | 3300009148 | Miscanthus Rhizosphere | MKLAFARSGTRHRRALRNEISFYAKRLILVAQMEKNGINKEIRRQKWILPPVFN |
| Ga0105248_105124631 | 3300009177 | Switchgrass Rhizosphere | MKLAFARTGTRHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRWR* |
| Ga0105248_124440551 | 3300009177 | Switchgrass Rhizosphere | MKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEI |
| Ga0115925_100655362 | 3300009354 | Swimming Pool Sandfilter Backwash | MKLAFEHTGARHRRTLWSSASFYGKRLSLVEQKEKNGLNKYIRRIP* |
| Ga0105238_112471011 | 3300009551 | Corn Rhizosphere | AFVRTGTRHRRALRNQASFYAKRLILVEQMEKNGINKEIRRQK* |
| Ga0126374_118291312 | 3300009792 | Tropical Forest Soil | MKLAFARSGTRHRRALRNEASFYANRLSLVEQMEKNGINKGIRRLK* |
| Ga0126305_109583482 | 3300010036 | Serpentine Soil | MKPAFERNGARHRRAFWNSASFYRKRLILVEQLEKNGLNKEIRWPP* |
| Ga0126304_100670382 | 3300010037 | Serpentine Soil | MKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0134109_100544901 | 3300010320 | Grasslands Soil | SRNKSSMKPAFVRTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0134080_106286001 | 3300010333 | Grasslands Soil | MKLAFERTGARHRRAFWSSASFYRKRLILVEQMEKNGLNKEIRRSQ* |
| Ga0105239_122141602 | 3300010375 | Corn Rhizosphere | MKLAFARSGARHRRALPNEASFYAKRLILVEQLEKNGINKEIRADH* |
| Ga0134124_131056652 | 3300010397 | Terrestrial Soil | MKLAFENTQGARHRRALPGSASFSAKRLILVEYSQKNGLNKEIMPQQAIAAQP* |
| Ga0134121_124888431 | 3300010401 | Terrestrial Soil | GTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0134123_117839661 | 3300010403 | Terrestrial Soil | MKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKE |
| Ga0137363_110630072 | 3300012202 | Vadose Zone Soil | MKLAFERTGTRHRRALRNLVSFYAKGLILVKQMEKNGLNKEIRRLH* |
| Ga0137362_102497062 | 3300012205 | Vadose Zone Soil | MKLAFVRTGTRHRRALRNEVSFYANRLILVEQMEKNGINKEISGSQ* |
| Ga0137366_107422902 | 3300012354 | Vadose Zone Soil | MKLAFARSGTRHRRALRNEDSFYANRLILVEQMEKNGINKEIRADH* |
| Ga0137384_110905101 | 3300012357 | Vadose Zone Soil | MKLAFARSGTRHRRALRNEASFYANRLILVEQMEKNGINKEIRADH* |
| Ga0150984_1133547951 | 3300012469 | Avena Fatua Rhizosphere | TVSRLSLVSVKNSRNKSSMKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0157309_100630482 | 3300012895 | Soil | VSVKNSRNKSSMKLAFARSGTRHRRALRNEPSFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0157292_103294622 | 3300012900 | Soil | MKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRQLR* |
| Ga0157295_103774121 | 3300012906 | Soil | MKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNGLNKEIR |
| Ga0157297_101654282 | 3300012914 | Soil | MKLAFARTGTRHRRALRNEASFHAKRLILVAQMEKNGINKEIRRQK* |
| Ga0137359_105277642 | 3300012923 | Vadose Zone Soil | MKLAFARSGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEI |
| Ga0137416_112989521 | 3300012927 | Vadose Zone Soil | KSSMKLAFVRTGTRHRRALRNEASFYANRLILVEQMEKNGINKEISGSQ* |
| Ga0137404_103153812 | 3300012929 | Vadose Zone Soil | MKLAFVRTGTRHRRALRNEVSFYANRLILVEQMEKNGI |
| Ga0137404_109460841 | 3300012929 | Vadose Zone Soil | MKLAFVRTGTRHRRALRNLASFYAKRLILVEQMEKNGINKEISGSQ* |
| Ga0153915_104875193 | 3300012931 | Freshwater Wetlands | MEQAFERTGARLRHALQNEASFSAKRLILVEQMKKNGLNKEIRRPTESVGNL* |
| Ga0164303_111089141 | 3300012957 | Soil | RNSRNKSSMKLAFARSGARHRRALPNEASFYAKRLILVEQLEKNGINKEIRADH* |
| Ga0164299_111886061 | 3300012958 | Soil | VKNTRNKSSMKLAFARSGTRHRRAIRNEPSFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0164301_104602992 | 3300012960 | Soil | MKLAFARSGTRHRRALRNEISFYAKRLILVAQMEKNGINKEIRRQKWILPPVFNYWLTMFAC* |
| Ga0134110_105925602 | 3300012975 | Grasslands Soil | MKLAFERTGARHRRAFWSSASFYRKRLILVEQMEKNGLNKEIRRLQ* |
| Ga0168316_10095914 | 3300012981 | Weathered Mine Tailings | MKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRQQK* |
| Ga0164305_107544022 | 3300012989 | Soil | MKLAFARSGARHRRALPNETSFYAKRLILVEQLEKNGINKEIRADH* |
| Ga0157375_116846961 | 3300013308 | Miscanthus Rhizosphere | MKLAFARTGTRHRRALRNLASFYAKRLILVEQMEKN |
| Ga0120132_10732831 | 3300013832 | Permafrost | MKQAFEPTGARLRDAFRSLASFYAKRLILVEQLEKNALNKEIRRPY |
| Ga0172379_105887782 | 3300014208 | Groundwater | KNSRNKSSMKQAFERNGARLRHAFLSSASFYAKRLILVEQLEKNGLNKEIRRLH* |
| Ga0157380_100657355 | 3300014326 | Switchgrass Rhizosphere | SRNKSSMKLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0157380_120245721 | 3300014326 | Switchgrass Rhizosphere | NSLNKSSMKLAFVRTGTRHRRALRNDASFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0182019_106626882 | 3300014498 | Fen | MKQAFRRTGARFRHAFQNEASFSAKRLILVEQMKKNGLNNEIRRREESSGTLSTVG* |
| Ga0181522_105583022 | 3300014657 | Bog | MKQAFARTGARLRHAFQSEASFSAKRLILVEQLEKNGINKEISSLAGCPGRP* |
| Ga0157377_115353621 | 3300014745 | Miscanthus Rhizosphere | MKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNGLNK* |
| Ga0157376_114466212 | 3300014969 | Miscanthus Rhizosphere | LVSVKNSRNRSSMKKAFERKGARHRRAFRSLASISAKRLILVEQLEKNGLNKEIRRLRRNRRHA* |
| Ga0137412_101150472 | 3300015242 | Vadose Zone Soil | MKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK* |
| Ga0134072_104477632 | 3300015357 | Grasslands Soil | MKLAFERTGARHRRAFWSSASFYRKRLILVEQMEKNGLNKEIRPRQKIRGLHINV* |
| Ga0132257_1026012182 | 3300015373 | Arabidopsis Rhizosphere | MKLAFENAQGARHRRALPGSASFSAKRLILVEYSQKNGLNKEIMPQQAIAAQL* |
| Ga0163161_102177171 | 3300017792 | Switchgrass Rhizosphere | SSMKLAFAPTGTRHRRALRNLASFYAKGLILVEQMEKNGLNK |
| Ga0163161_103081582 | 3300017792 | Switchgrass Rhizosphere | MKLAFAPTGTRHRRALRNEASFYANRLILVEQMEKNGLNKEIRRRQ |
| Ga0187820_13189851 | 3300017924 | Freshwater Sediment | SSMKQAFGPTGERLRHALWGLASFYPKRLILVEQMEKNAHNK |
| Ga0190266_100291163 | 3300017965 | Soil | MKQAAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR |
| Ga0187805_104337442 | 3300018007 | Freshwater Sediment | MKPAFGRTGARLRHAFQNEASFSAKRLILVEQMQKNGIN |
| Ga0187887_101719172 | 3300018043 | Peatland | MKQAFARTGARLRHAFQSEASFSAKRLILVEQLEKNGINKEISSLAGCPGRP |
| Ga0184616_102732562 | 3300018055 | Groundwater Sediment | MKPAFERTGARHRRAFRSLASFYAKRLILVEQMEKNGLNKEIRRLR |
| Ga0184611_10728102 | 3300018067 | Groundwater Sediment | MKQAFERIGARFRHASRNVASFNAKRLILVEQLEKNEINKEIRRLR |
| Ga0184631_101110892 | 3300018070 | Groundwater Sediment | MKPAFERTGARHRRAFRSLASFYAKRLILVEQLEKNELNKEIRRPH |
| Ga0184635_100223492 | 3300018072 | Groundwater Sediment | MKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0190265_106521592 | 3300018422 | Soil | MKLAFVRTGTRHRRTLRNEASFYAKRLILVAQMEKNGINKEIRRQKSILPPVLTAG |
| Ga0190265_112101822 | 3300018422 | Soil | MKQAFERIGARFRHASQNVASFYAKRLIMVEQLEKNGLNKEIRRLR |
| Ga0190265_136548412 | 3300018422 | Soil | MKQAFERIGARFRHAFWNVASFYAKRLILVEQMEKNGLNKEIRRVRRSRGHA |
| Ga0190275_124858711 | 3300018432 | Soil | MKQAFERIGARFRHASQNVASFYAKRLIVVEQLEKNGLNKEIRPPR |
| Ga0190275_130635422 | 3300018432 | Soil | MKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQKSILPPVLTAG |
| Ga0066667_100457092 | 3300018433 | Grasslands Soil | MKLAFERTGARHRRAFWSSASFYRKRLILVEQMEKNGLNKEIRRPQ |
| Ga0190269_105446862 | 3300018465 | Soil | MKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQKSILPPVLIAG |
| Ga0190269_110034962 | 3300018465 | Soil | MKLAFVRTGTRHRRALRNEASFYAKRLILVEQVEKNGINKEIRRQK |
| Ga0190274_111160262 | 3300018476 | Soil | MKLAFAPTGARHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRLQ |
| Ga0190274_113924631 | 3300018476 | Soil | MKLAFARSGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0190271_111563802 | 3300018481 | Soil | MKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR |
| Ga0190273_112720812 | 3300018920 | Soil | MKLAFVRTGTRHRRTLRNEASFYAKRLILVAQMEKNGINKEI |
| Ga0173479_103313141 | 3300019362 | Soil | MKLAFARTGTRHRRALRNEVSFYAKRLILVAQMEKNG |
| Ga0190264_110804642 | 3300019377 | Soil | MKQAFERIGARFRNAFQNVASFYAKGLILVEQMEKNGLNKEIRRIR |
| Ga0193729_11087251 | 3300019887 | Soil | SLVSVRNSRNKSSMKLAFARTGTRHRRALRNLASFYANRLILVEQLEKNGINKEIRRLH |
| Ga0193743_10321844 | 3300019889 | Soil | MKQAFERIGARFRHAFRNVASFYAKRLILVEQSEKNGLNKEIRRLR |
| Ga0210400_103235643 | 3300021170 | Soil | FERTGARPRHAFRSLASFYAKRLILVEQLQKNGLNKEIRRPD |
| Ga0210400_105425912 | 3300021170 | Soil | RTGARLRHAFQNEASFTAKRLILVEQMKKNGLNKEIRRPEESSGALSTVG |
| Ga0210394_103374602 | 3300021420 | Soil | MKQAFRRTGARFRHAFQNEASFSAKRLILVEQMKKNGLNKEIRRPEESSGAQ |
| Ga0210390_103294651 | 3300021474 | Soil | VSVRNSRNKSSMKQAFEPTGARLRHAFRGLASFHAKRLILVEQSPNNALNKGIRCPTELWRRLQTTG |
| Ga0210402_102694482 | 3300021478 | Soil | MKLAFARSGARHRRALPNEASFYAKRLILVEQLEKNGINKEIRADH |
| Ga0193742_10219275 | 3300021976 | Soil | MKLAFARTGTRHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRLQ |
| Ga0222622_103162092 | 3300022756 | Groundwater Sediment | MKLAFERTGARHRRALPGSASFSAKRLILVEHSEKNGLNKEIIASQAIATQP |
| Ga0222622_108289071 | 3300022756 | Groundwater Sediment | PVSVKNSRNKSSMKLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0247770_10871011 | 3300022891 | Plant Litter | MKLAFARTGTRHRRALRNEVSFHAKRLILVAQMEKNGINKEIRRQK |
| Ga0247766_10009762 | 3300022906 | Plant Litter | MKLAFARTGTRHRRALRNEASFHAKRLILVAQMEKNGINKEIRRQK |
| Ga0247790_100226712 | 3300022915 | Soil | MKLAFARTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0224557_12596501 | 3300023101 | Soil | MKQAFEPTGVRLRDAFRSLASFYAKRLILVEQLEKNAIN |
| Ga0247800_11325691 | 3300023263 | Soil | VSVKNSRNKSSMKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0209758_10316492 | 3300025297 | Arabidopsis Rhizosphere | MKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0207928_10441612 | 3300025494 | Arctic Peat Soil | MKQAFERTGARFRHAFQNEASFSAKRLILVEQMQKNGINKEIRRPWESPGAL |
| Ga0207926_10754451 | 3300025619 | Arctic Peat Soil | MKQALGRTGARLRHAFQSVASFSAKRLILVEQLEKNGLNKEIRRTHGI |
| Ga0209483_10159176 | 3300025862 | Arctic Peat Soil | MKQAFERKGARFRHAFQSLASFYAKRLILIEQLEKNAINKQIMWNSEP |
| Ga0207682_101398382 | 3300025893 | Miscanthus Rhizosphere | MKLAFARTGTRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRRQ |
| Ga0207647_105022362 | 3300025904 | Corn Rhizosphere | MKLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0207645_109399702 | 3300025907 | Miscanthus Rhizosphere | MKLAFAPTGTRHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRLQ |
| Ga0207643_102910372 | 3300025908 | Miscanthus Rhizosphere | MKLAFARTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQKRILP |
| Ga0207695_104388563 | 3300025913 | Corn Rhizosphere | KNSRNKSSMKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0207693_104074242 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPAFARSGTRHRRALRNQASFYANRLILVEQMEKNGINKE |
| Ga0207663_110156352 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVKNSRKRSSMKLAFARNGTRHRRALRNLASFYAKRLILVEQLEKNGLNKEIRPLQ |
| Ga0207660_107901102 | 3300025917 | Corn Rhizosphere | LVSVKNSRNKSSMKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0207681_101227873 | 3300025923 | Switchgrass Rhizosphere | LVSVRNSRNKSSMKLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0207681_113004861 | 3300025923 | Switchgrass Rhizosphere | KNSRNRSSMKLAFAPIGPRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRRQ |
| Ga0207659_105132291 | 3300025926 | Miscanthus Rhizosphere | KNSRNKSSMKLAFARSGTRHRRALRNEPSFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0207644_100960014 | 3300025931 | Switchgrass Rhizosphere | LAFAPIGPRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRRQ |
| Ga0207709_102310673 | 3300025935 | Miscanthus Rhizosphere | MKLAFAPIGPRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRRQ |
| Ga0207709_109558452 | 3300025935 | Miscanthus Rhizosphere | KLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0207704_105788212 | 3300025938 | Miscanthus Rhizosphere | KLAFAPTGTRHRRALRNEVSLYANRLILVEQMEKNGLNKEIRRRH |
| Ga0207704_111758072 | 3300025938 | Miscanthus Rhizosphere | RNKSSMKLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0207711_113065502 | 3300025941 | Switchgrass Rhizosphere | MKLAFARTGTRHRRALRNEVSFYAKRLILVAQMEKNGI |
| Ga0207689_106866771 | 3300025942 | Miscanthus Rhizosphere | MKLAFVRTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0207651_107793572 | 3300025960 | Switchgrass Rhizosphere | MKLAFARSGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQKWILPPVFNYWLTMFAC |
| Ga0207668_104951291 | 3300025972 | Switchgrass Rhizosphere | MKLAFARSGTRHRRALRNEISFYAKRLILVAQMEKNGINKEI |
| Ga0207658_110506572 | 3300025986 | Switchgrass Rhizosphere | KLAFVRSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0207677_100750042 | 3300026023 | Miscanthus Rhizosphere | MKLAFAPTGTRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRRQ |
| Ga0207675_1019939361 | 3300026118 | Switchgrass Rhizosphere | RIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR |
| Ga0207698_119514261 | 3300026142 | Corn Rhizosphere | SVKNSRNRSSMKLAFAPIGTRHRRALRNEASFYAKRLILVEQMEKNGLNKEIRRRQ |
| Ga0209881_10269812 | 3300026273 | Soil | MKQAFERTGARLRHAFQNMASFSAKRLILVEQLEKNGLNKEIRPPH |
| Ga0209847_10145362 | 3300026276 | Permafrost Soil | MNQAFERTGAQLRRAFSSLPSICAKRLILVEQSEKNGLNKEITRFTALRGRAVNR |
| Ga0209027_11334322 | 3300026300 | Grasslands Soil | MKLAFERTGARHRRAFWSSASFYRKRLILVEQMEKN |
| Ga0209471_11750221 | 3300026318 | Soil | MKLAFVRTGTRHRRALRNEVSFYAKRLILVAQMEKNGINK |
| Ga0209474_103379772 | 3300026550 | Soil | SVKNSRNKSSMKPAFVRTGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0209008_10363861 | 3300027545 | Forest Soil | MKQAFEPTGARLRDAFRSLASFYAKRLILVEQLEKNSLNKEI |
| Ga0209574_101856592 | 3300027809 | Agave | KLAFARSGTPHRRALRNKASFYANRLILVAQMEKNGINKEIRRQN |
| Ga0209693_101168251 | 3300027855 | Soil | AFERTGARFRHAFQSSASICANRLILVEQLEKNGINK |
| Ga0209624_108380362 | 3300027895 | Forest Soil | MKQAFEPTGVRLRDAFRSLASFYAKRLILVEQLEKNALNKEI |
| Ga0209048_102534801 | 3300027902 | Freshwater Lake Sediment | MKQAFGRTGARLRHAFQNEASFFAKRLILVEQMKKNGLNKEIRRPAESADLL |
| Ga0209006_104806082 | 3300027908 | Forest Soil | MKQAFEPTGARLRDAFRSLASFYAKRLILVEQLEKNSLN |
| Ga0209006_115034402 | 3300027908 | Forest Soil | MKHAFERTGARFRHAFQSWASICANRLILVEQLEKNGINK |
| Ga0209477_10547192 | 3300027959 | Activated Sludge | MKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNGLNKEIRRLR |
| Ga0268266_103012142 | 3300028379 | Switchgrass Rhizosphere | MKLAFARSGTPHRRALRNEASFYANRLILVAQMEKNGINKEIRRQK |
| Ga0268266_122548962 | 3300028379 | Switchgrass Rhizosphere | AFARTGTRHRRALRNSASFYAKRLILVEQMEKNGLNKEIRRPQ |
| Ga0307293_102347802 | 3300028711 | Soil | SLVSVKNSRNKSSMKLAFVRTGTRHRRALRNLASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0307285_100998641 | 3300028712 | Soil | LAFAPTGTRHRRALRNLASFYAKGLILVEQMEKNGLNK |
| Ga0307285_101493432 | 3300028712 | Soil | SLLSLVSVRNSRNKSSMKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR |
| Ga0307288_102238862 | 3300028778 | Soil | IGARFRHASRNVASFYAKRLILVEQLEKNEINKEIRRLR |
| Ga0307282_106452011 | 3300028784 | Soil | MKLAFARTGTRHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRP |
| Ga0307294_100387681 | 3300028810 | Soil | KNSRNKSSMKLAFERTGARHRRALPGSASFSAKRLILVEHSEKNGLNKEIIASQAIATQP |
| Ga0247827_113401152 | 3300028889 | Soil | MKQAFERIGARFRHASRNVASFYAKRLILVEQLEKNEINKEISGFVESGSGCK |
| Ga0311332_110397192 | 3300029984 | Fen | MKQAFERKGARHRRAFRSLASISAKRLILVEQLEKNGINKEIRRLHRIRAR |
| Ga0311365_106509502 | 3300029989 | Fen | SRNKSSMKLAFARSGTRHRRALRNKPSFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0311336_100759334 | 3300029990 | Fen | MKLAFARSGTRHRRALRNKPSFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0302323_1010022412 | 3300031232 | Fen | MKQAFGRTGARFRHAFQNEASFSAKRLILVEQMKKNGLNK |
| Ga0265330_100235515 | 3300031235 | Rhizosphere | MKQAFGRTGARFRHALQNEASFSANRLILVEQMKKNGLNKEISRPEPSSGAL |
| Ga0265330_105212361 | 3300031235 | Rhizosphere | MKQAFRRTGARLRHAFQNEASFSAKRLILVEQMKK |
| Ga0265340_100779922 | 3300031247 | Rhizosphere | MKQAFRRTGARFRHAFQNEASFSAKRLILVEQMKKNGLNKEIRRPEESSGTLSTGG |
| Ga0265331_100905262 | 3300031250 | Rhizosphere | MKPAFERTGARHRRAFQCQASFSAKRLILVEQLEKNGINKEIR |
| Ga0170818_1094143242 | 3300031474 | Forest Soil | MKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKN |
| Ga0302320_114769412 | 3300031524 | Bog | MKPAFEPVGRAQFRRAFRSLASFNAKRLILIEQLEKNALNKKIMTAQCSG |
| Ga0307408_1006192522 | 3300031548 | Rhizosphere | MKLAFVRTGTRHRRALRNEASFYAKRLILVEQMEKNGINKEIRRQK |
| Ga0307508_104223611 | 3300031616 | Ectomycorrhiza | RNKSSMKLAFARTGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0307514_103787591 | 3300031649 | Ectomycorrhiza | SLVSVKNSRNKSSMKLAFARSGTRHRRALRNEVSFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0310686_1056940702 | 3300031708 | Soil | MKQAFEPTGARLRAAFRSLASFYAKRLILVEQLEKNSLN |
| Ga0265314_100928424 | 3300031711 | Rhizosphere | TGARFRHALQNEASFSANRLILVEQMKKNGLNKEISRPEPSSGAL |
| Ga0307474_111732811 | 3300031718 | Hardwood Forest Soil | MKQAFEPTGERLRDAFRSLASFYAKRLILVEQLEKNALNKE |
| Ga0307413_103200071 | 3300031824 | Rhizosphere | NSRNRSSMKLAFARTGTRHRRALRNEVSFHAKRLILVAQMEKNGINKEIRRQK |
| Ga0307412_110233612 | 3300031911 | Rhizosphere | KNSRNKSSMKLAFVRTGTRHRRALRNEASFYAKRLILVEQMEKNGINKEIRRQK |
| Ga0307412_115336942 | 3300031911 | Rhizosphere | LVSVRNSRNKSSMNQAFERIGARFRHASRNGASFYAKRLILVEQLEKNGLNKEIRRLR |
| Ga0311367_106850731 | 3300031918 | Fen | SRNKSSMKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRQK |
| Ga0308175_1000781584 | 3300031938 | Soil | MKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGINKEIRRLN |
| Ga0308175_1009117131 | 3300031938 | Soil | MKLAFARSGTRHRRALRNEASFYAKRLILVAQMEKNGI |
| Ga0310884_108597681 | 3300031944 | Soil | RNKSSMKLAFVRTGTRHRRALRNQASFYAKRLILVEQMEKNGLNKEIRPRQ |
| Ga0214473_105686942 | 3300031949 | Soil | MKPAFERTGARHRRAFRSLASFYAKRLILVEQMEKNGLNKEIRRLHGIRGAL |
| Ga0310903_107708132 | 3300032000 | Soil | MKLAFAPTGTRHRRALRNEASFYANRLILVEQMEKNGLNKEIR |
| Ga0307416_1016777451 | 3300032002 | Rhizosphere | MKQAFERIGARFRRAFRNEASFYAKRLILVEQLEKNGLNKEIRRLQ |
| Ga0310902_107026832 | 3300032012 | Soil | LSLVSVKNSRNRSSMKLAFAPTGTRHRRALRNEASFYANRLILVEQMEKNGLNKEIRPRQ |
| Ga0307415_1006654152 | 3300032126 | Rhizosphere | LSLVSVRNSRNKSSMKLAFARTGTRHRRALRNLASFYAKRLILVEQMEKNGLNKEIRRLQ |
| Ga0307415_1007997511 | 3300032126 | Rhizosphere | KLAFVRTGTRHRRALRNEASFYAKRLILVEQMEKNGINKEIRRQK |
| Ga0311301_122987612 | 3300032160 | Peatlands Soil | MKQAFERTGARLRHAFQNVASICGKRLILVEQLEKNGLNKEIRRPQ |
| Ga0315283_122973222 | 3300032164 | Sediment | MKQAFERIGARLRHASRNVASFYAKRLILVEQLEKNGLNKEIRRLQ |
| Ga0307471_1034170911 | 3300032180 | Hardwood Forest Soil | RNKSSMKLAFVRTGTRHRRALRNEASFYANRLILVEQMEKNGLNKEIRPRQ |
| Ga0316605_116474232 | 3300033408 | Soil | MKLAFERIGARLRHAFRNVASFYAKRLILVEQLEKNGLNKEIRRLR |
| Ga0316613_106185221 | 3300033434 | Soil | FERIGARFRHASRNVASFYAKRLILVEQLEKNGLNKEIRRLH |
| Ga0316600_100973312 | 3300033481 | Soil | MKQAFERIGARLRHAFRNGASFYAKRLILVEQLEKNGLNKEIRRLQ |
| ⦗Top⦘ |