NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F020930

Metagenome / Metatranscriptome Family F020930

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020930
Family Type Metagenome / Metatranscriptome
Number of Sequences 221
Average Sequence Length 41 residues
Representative Sequence GMVELDTGNARYLIRFTQTLERQAGWAWTLFNAVRKLSP
Number of Associated Samples 178
Number of Associated Scaffolds 221

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.30 %
% of genes near scaffold ends (potentially truncated) 92.31 %
% of genes from short scaffolds (< 2000 bps) 92.31 %
Associated GOLD sequencing projects 163
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.633 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(5.882 % of family members)
Environment Ontology (ENVO) Unclassified
(46.606 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.941 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 43.28%    Coil/Unstructured: 56.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 221 Family Scaffolds
PF03480DctP 70.14
PF06808DctM 2.26
PF10518TAT_signal 1.36
PF00464SHMT 0.45
PF04290DctQ 0.45
PF01872RibD_C 0.45

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 221 Family Scaffolds
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.45
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.45
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.45
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.45


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.63 %
UnclassifiedrootN/A39.37 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459021|G14TP7Y01DC1ZWAll Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria592Open in IMG/M
3300000956|JGI10216J12902_121027642Not Available815Open in IMG/M
3300001213|JGIcombinedJ13530_104236414All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria591Open in IMG/M
3300004146|Ga0055495_10071172Not Available771Open in IMG/M
3300005179|Ga0066684_11041771All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005184|Ga0066671_10926898Not Available551Open in IMG/M
3300005333|Ga0070677_10033109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1988Open in IMG/M
3300005333|Ga0070677_10171861All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-81025Open in IMG/M
3300005338|Ga0068868_100212888All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1616Open in IMG/M
3300005338|Ga0068868_100880060All Organisms → cellular organisms → Bacteria → Proteobacteria813Open in IMG/M
3300005338|Ga0068868_101273654Not Available682Open in IMG/M
3300005341|Ga0070691_10230253All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300005344|Ga0070661_100050148All Organisms → cellular organisms → Bacteria → Proteobacteria3054Open in IMG/M
3300005347|Ga0070668_100067921All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.2770Open in IMG/M
3300005347|Ga0070668_100361003All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300005355|Ga0070671_100533896Not Available1011Open in IMG/M
3300005356|Ga0070674_100243679All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300005438|Ga0070701_10303749All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300005441|Ga0070700_101264333Not Available619Open in IMG/M
3300005456|Ga0070678_100621834All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300005456|Ga0070678_100788428All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8862Open in IMG/M
3300005456|Ga0070678_101357498All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300005457|Ga0070662_100204957All Organisms → cellular organisms → Bacteria1567Open in IMG/M
3300005457|Ga0070662_101930618All Organisms → cellular organisms → Bacteria → Proteobacteria510Open in IMG/M
3300005459|Ga0068867_101664530Not Available598Open in IMG/M
3300005459|Ga0068867_102094479Not Available536Open in IMG/M
3300005535|Ga0070684_100612177All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300005535|Ga0070684_100717420All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300005535|Ga0070684_102295952Not Available509Open in IMG/M
3300005539|Ga0068853_100521350All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300005539|Ga0068853_102204598Not Available534Open in IMG/M
3300005545|Ga0070695_100564456All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300005546|Ga0070696_101993252Not Available504Open in IMG/M
3300005553|Ga0066695_10270134All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300005556|Ga0066707_11004263Not Available509Open in IMG/M
3300005563|Ga0068855_102153620Not Available561Open in IMG/M
3300005564|Ga0070664_101647009Not Available608Open in IMG/M
3300005569|Ga0066705_10179304All Organisms → cellular organisms → Bacteria → Proteobacteria1317Open in IMG/M
3300005569|Ga0066705_10599654All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300005615|Ga0070702_101593311Not Available540Open in IMG/M
3300005618|Ga0068864_100426188All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300005718|Ga0068866_11120953Not Available564Open in IMG/M
3300005841|Ga0068863_102334213Not Available545Open in IMG/M
3300005842|Ga0068858_101063571Not Available794Open in IMG/M
3300005844|Ga0068862_102410613Not Available538Open in IMG/M
3300006046|Ga0066652_101188436All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300006050|Ga0075028_100347254All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8837Open in IMG/M
3300006196|Ga0075422_10616832Not Available504Open in IMG/M
3300006358|Ga0068871_100298693All Organisms → cellular organisms → Bacteria → Proteobacteria1413Open in IMG/M
3300006606|Ga0074062_11858424Not Available950Open in IMG/M
3300006797|Ga0066659_10813177All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300006804|Ga0079221_10797127All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300006806|Ga0079220_10832788All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8704Open in IMG/M
3300006852|Ga0075433_11375255Not Available611Open in IMG/M
3300007004|Ga0079218_11540525Not Available723Open in IMG/M
3300009012|Ga0066710_102548201Not Available738Open in IMG/M
3300009092|Ga0105250_10619377All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria503Open in IMG/M
3300009137|Ga0066709_102962197All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria624Open in IMG/M
3300009143|Ga0099792_10201670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1132Open in IMG/M
3300009148|Ga0105243_11867311Not Available633Open in IMG/M
3300009148|Ga0105243_12997249All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300009177|Ga0105248_11694056Not Available717Open in IMG/M
3300009177|Ga0105248_12530451Not Available585Open in IMG/M
3300009654|Ga0116167_1296221All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300009704|Ga0116145_1219247All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300009800|Ga0105069_1059701Not Available503Open in IMG/M
3300010373|Ga0134128_10227342All Organisms → cellular organisms → Bacteria → Proteobacteria2096Open in IMG/M
3300010375|Ga0105239_13160222Not Available536Open in IMG/M
3300010398|Ga0126383_10226094Not Available1817Open in IMG/M
3300010398|Ga0126383_12245271Not Available632Open in IMG/M
3300010399|Ga0134127_10592421All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300010401|Ga0134121_10931985Not Available846Open in IMG/M
3300010403|Ga0134123_12102608All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria625Open in IMG/M
3300011270|Ga0137391_10582144All Organisms → cellular organisms → Bacteria → Proteobacteria940Open in IMG/M
3300011432|Ga0137428_1265917Not Available506Open in IMG/M
3300012199|Ga0137383_10625647All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300012201|Ga0137365_10374521All Organisms → cellular organisms → Bacteria → Proteobacteria1051Open in IMG/M
3300012285|Ga0137370_10178390All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300012362|Ga0137361_11079821Not Available723Open in IMG/M
3300012469|Ga0150984_116470039Not Available559Open in IMG/M
3300012909|Ga0157290_10293865All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300012917|Ga0137395_10929224Not Available627Open in IMG/M
3300012923|Ga0137359_11714801All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300012924|Ga0137413_11665727All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300012944|Ga0137410_10156026All Organisms → cellular organisms → Bacteria → Proteobacteria1742Open in IMG/M
3300012958|Ga0164299_11408389Not Available539Open in IMG/M
3300012961|Ga0164302_11225291Not Available601Open in IMG/M
3300012984|Ga0164309_10969868All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8698Open in IMG/M
3300012989|Ga0164305_11246461Not Available647Open in IMG/M
3300012989|Ga0164305_11355852Not Available624Open in IMG/M
3300013104|Ga0157370_10854689Not Available827Open in IMG/M
3300013296|Ga0157374_11717305All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300013297|Ga0157378_12799881All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300013306|Ga0163162_11514216All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8764Open in IMG/M
3300013306|Ga0163162_13262024All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria520Open in IMG/M
3300013307|Ga0157372_10697700All Organisms → cellular organisms → Bacteria → Proteobacteria1181Open in IMG/M
3300013308|Ga0157375_11969527All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria694Open in IMG/M
3300013308|Ga0157375_13256293All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria541Open in IMG/M
3300014055|Ga0119878_1015378All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2123Open in IMG/M
3300014326|Ga0157380_12038598Not Available636Open in IMG/M
3300014968|Ga0157379_10541806All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300014969|Ga0157376_10348882All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300014969|Ga0157376_10697223All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300014969|Ga0157376_11262264Not Available768Open in IMG/M
3300014969|Ga0157376_11649228All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8676Open in IMG/M
3300015053|Ga0137405_1390447All Organisms → cellular organisms → Bacteria → Proteobacteria4544Open in IMG/M
3300015082|Ga0167662_1012827All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1043Open in IMG/M
3300015195|Ga0167658_1081833Not Available730Open in IMG/M
3300015371|Ga0132258_13348976All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300015372|Ga0132256_101421009All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8805Open in IMG/M
3300015372|Ga0132256_102662883Not Available600Open in IMG/M
3300015372|Ga0132256_103739263Not Available512Open in IMG/M
3300015373|Ga0132257_101497485All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300015374|Ga0132255_100377074All Organisms → cellular organisms → Bacteria → Proteobacteria2060Open in IMG/M
3300015374|Ga0132255_102418583Not Available802Open in IMG/M
3300015374|Ga0132255_104061659Not Available621Open in IMG/M
3300015374|Ga0132255_106218318All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300016357|Ga0182032_10031142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3257Open in IMG/M
3300017654|Ga0134069_1300608Not Available569Open in IMG/M
3300018027|Ga0184605_10401178Not Available612Open in IMG/M
3300018468|Ga0066662_11586306All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8683Open in IMG/M
3300018469|Ga0190270_12392018All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria590Open in IMG/M
3300018481|Ga0190271_11243723All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300018481|Ga0190271_13432649All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300021081|Ga0210379_10068289All Organisms → cellular organisms → Bacteria → Proteobacteria1444Open in IMG/M
3300021322|Ga0210330_1264003All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria660Open in IMG/M
3300021405|Ga0210387_11130844All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300024056|Ga0124853_1142879Not Available676Open in IMG/M
3300025321|Ga0207656_10341031All Organisms → cellular organisms → Bacteria → Proteobacteria747Open in IMG/M
3300025899|Ga0207642_10102067All Organisms → cellular organisms → Bacteria → Proteobacteria1442Open in IMG/M
3300025905|Ga0207685_10194112All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300025907|Ga0207645_10502240Not Available821Open in IMG/M
3300025908|Ga0207643_10667186Not Available671Open in IMG/M
3300025911|Ga0207654_11294140Not Available531Open in IMG/M
3300025917|Ga0207660_10231757All Organisms → cellular organisms → Bacteria → Proteobacteria1452Open in IMG/M
3300025922|Ga0207646_11635624Not Available555Open in IMG/M
3300025926|Ga0207659_10326920All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300025927|Ga0207687_11925369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300025930|Ga0207701_10367476All Organisms → cellular organisms → Bacteria → Proteobacteria1242Open in IMG/M
3300025933|Ga0207706_11340191Not Available590Open in IMG/M
3300025940|Ga0207691_10112493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2420Open in IMG/M
3300025940|Ga0207691_10778790All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8805Open in IMG/M
3300025941|Ga0207711_11643108Not Available586Open in IMG/M
3300025941|Ga0207711_11776397All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300025949|Ga0207667_11488526All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria648Open in IMG/M
3300025960|Ga0207651_11542882All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium598Open in IMG/M
3300025961|Ga0207712_11214989All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria673Open in IMG/M
3300025972|Ga0207668_10457592All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300025972|Ga0207668_10626439All Organisms → cellular organisms → Bacteria → Proteobacteria939Open in IMG/M
3300026035|Ga0207703_12086569Not Available543Open in IMG/M
3300026041|Ga0207639_11164616All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8723Open in IMG/M
3300026041|Ga0207639_11366380Not Available665Open in IMG/M
3300026075|Ga0207708_10839473Not Available793Open in IMG/M
3300026088|Ga0207641_11127605Not Available783Open in IMG/M
3300026089|Ga0207648_10150785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2051Open in IMG/M
3300026095|Ga0207676_10019105All Organisms → cellular organisms → Bacteria → Proteobacteria4994Open in IMG/M
3300026095|Ga0207676_10578909All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300026118|Ga0207675_100831131All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300026118|Ga0207675_102451926All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300026335|Ga0209804_1274421Not Available593Open in IMG/M
3300026530|Ga0209807_1085170All Organisms → cellular organisms → Bacteria → Proteobacteria1392Open in IMG/M
3300026530|Ga0209807_1109256All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300026532|Ga0209160_1287511Not Available558Open in IMG/M
3300027645|Ga0209117_1025966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1857Open in IMG/M
3300027717|Ga0209998_10064323All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300027765|Ga0209073_10435840Not Available543Open in IMG/M
3300027775|Ga0209177_10492632All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300027787|Ga0209074_10556368All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300027899|Ga0209668_10031849All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2711Open in IMG/M
3300028380|Ga0268265_12138836Not Available567Open in IMG/M
3300028381|Ga0268264_11280169Not Available743Open in IMG/M
3300028712|Ga0307285_10231010All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300028889|Ga0247827_10153465All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300030010|Ga0302299_10587970All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300030052|Ga0302217_10066547Not Available800Open in IMG/M
3300030114|Ga0311333_11074847Not Available684Open in IMG/M
3300031170|Ga0307498_10184024Not Available718Open in IMG/M
3300031720|Ga0307469_11083698All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8752Open in IMG/M
3300031722|Ga0311351_11094229All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria611Open in IMG/M
3300031726|Ga0302321_101708924Not Available728Open in IMG/M
3300031744|Ga0306918_10516419All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8935Open in IMG/M
3300031796|Ga0318576_10125277Not Available1188Open in IMG/M
3300031820|Ga0307473_10092244All Organisms → cellular organisms → Bacteria1587Open in IMG/M
3300031834|Ga0315290_10414948All Organisms → cellular organisms → Bacteria → Proteobacteria1179Open in IMG/M
3300031890|Ga0306925_10577094All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300031902|Ga0302322_102325647All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300031938|Ga0308175_100376929All Organisms → cellular organisms → Bacteria1474Open in IMG/M
3300031938|Ga0308175_102134143Not Available628Open in IMG/M
3300031997|Ga0315278_10158466All Organisms → cellular organisms → Bacteria → Proteobacteria2316Open in IMG/M
3300032003|Ga0310897_10119933Not Available1070Open in IMG/M
3300032018|Ga0315272_10735117Not Available504Open in IMG/M
3300032043|Ga0318556_10357917All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8763Open in IMG/M
3300032122|Ga0310895_10073283All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300032163|Ga0315281_11334162All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300032164|Ga0315283_10248193All Organisms → cellular organisms → Bacteria1924Open in IMG/M
3300032164|Ga0315283_11858366Not Available604Open in IMG/M
3300032180|Ga0307471_102601840Not Available641Open in IMG/M
3300032261|Ga0306920_101178840All Organisms → cellular organisms → Bacteria → Proteobacteria1107Open in IMG/M
3300032397|Ga0315287_11714043All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300032516|Ga0315273_11355014All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8885Open in IMG/M
3300033290|Ga0318519_10092629All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1611Open in IMG/M
3300033408|Ga0316605_10322448Not Available1364Open in IMG/M
3300033408|Ga0316605_10673714All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300033412|Ga0310810_10026867All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria6993Open in IMG/M
3300033414|Ga0316619_10522479Not Available971Open in IMG/M
3300033418|Ga0316625_100818287Not Available802Open in IMG/M
3300033418|Ga0316625_101692328All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300033418|Ga0316625_102427660All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria528Open in IMG/M
3300033433|Ga0326726_10816570All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria903Open in IMG/M
3300033483|Ga0316629_10331784All Organisms → cellular organisms → Bacteria → Proteobacteria1042Open in IMG/M
3300033551|Ga0247830_10630293All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300033557|Ga0316617_101219981Not Available747Open in IMG/M
3300033557|Ga0316617_102302488All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria557Open in IMG/M
3300034195|Ga0370501_0266034Not Available614Open in IMG/M
3300034281|Ga0370481_0355872Not Available536Open in IMG/M
3300034354|Ga0364943_0212361All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300034358|Ga0370485_0188628Not Available642Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.43%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.07%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.07%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.07%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.62%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.17%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.71%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.36%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.36%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.36%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.36%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.81%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.45%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.45%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.45%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.45%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.45%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.45%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.45%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.45%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.45%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.45%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.45%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.45%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.45%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.45%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.45%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.45%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.45%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.45%
Sewage Treatment PlantEngineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant0.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.91%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459021Litter degradation NP4EngineeredOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004146Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009654Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaGEngineeredOpen in IMG/M
3300009704Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaGEngineeredOpen in IMG/M
3300009800Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014055Sewage treatment plant microbial communities from Vermont, USA - ANOX_WEngineeredOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015082Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300015195Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021322Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.298 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030010Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4EnvironmentalOpen in IMG/M
3300030052Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M
3300034281Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034358Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4NP_032879302170459021Switchgrass, Maize And Mischanthus LitterMVELDTGNARYLIRFTQTLERQAGWSWSLFTAVRKLSA
JGI10216J12902_12102764213300000956SoilGPEDKFTTGGMVELDTGTARYLIRFTQTLEQQAGWSWAMFNAVRKLTP*
JGIcombinedJ13530_10423641413300001213WetlandDRFLPGGMVELDTGSARYLIRFSQTLEHQPGWAWSLFAAVRKLAG*
Ga0055495_1007117223300004146Natural And Restored WetlandsPGAMIELDTGSARYLVRFTQMLERQAGWSWALFSAVRKLSG*
Ga0066684_1104177123300005179SoilFPAGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA*
Ga0066671_1092689823300005184SoilTGGMVELDTGNARYLIRFTQTLERQVGWAWSLFSAVRKLAG*
Ga0070677_1003310913300005333Miscanthus RhizosphereGPDDRFAPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP*
Ga0070677_1017186123300005333Miscanthus RhizosphereGGMIELDTGSARYLIRFTKILERQTGWTWTLFNAVRKLAP*
Ga0068868_10021288823300005338Miscanthus RhizosphereDDRFPQGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSN*
Ga0068868_10088006013300005338Miscanthus RhizosphereRFTPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP*
Ga0068868_10127365413300005338Miscanthus RhizospherePDDRFTPGSMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP*
Ga0070691_1023025313300005341Corn, Switchgrass And Miscanthus RhizosphereDDRLMSGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG*
Ga0070661_10005014833300005344Corn RhizosphereRLMSGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG*
Ga0070668_10006792113300005347Switchgrass RhizosphereGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRRLSG*
Ga0070668_10036100313300005347Switchgrass RhizosphereFVTGGMVELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLGP*
Ga0070671_10053389613300005355Switchgrass RhizospherePDDRFTLGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP*
Ga0070674_10024367913300005356Miscanthus RhizosphereGGMVELDTGNARYLIRFTQTLERQAGWSWALFNAVRKLT*
Ga0070701_1030374923300005438Corn, Switchgrass And Miscanthus RhizosphereIGPDERFGTGGMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLSS*
Ga0070700_10126433333300005441Corn, Switchgrass And Miscanthus RhizosphereGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSN*
Ga0070678_10062183423300005456Miscanthus RhizosphereAGGMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLSS*
Ga0070678_10078842813300005456Miscanthus RhizosphereDDRFTPGGMIELDTGSARYLIRFTKILERQTGWTWTLFNAVRKLAP*
Ga0070678_10135749823300005456Miscanthus RhizosphereGGMVELDTGNARYLIRFTQALERQAGWSWALFSAVRKLSA*
Ga0070662_10020495733300005457Corn RhizosphereGGMVELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLGP*
Ga0070662_10193061823300005457Corn RhizosphereGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLSG*
Ga0068867_10166453023300005459Miscanthus RhizosphereEDKFAPGGMIELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLGP*
Ga0068867_10209447913300005459Miscanthus RhizosphereFPQGGMVELDTGNGRYLIRFSQVLERQAGWTWALFNAVRKLAG*
Ga0070684_10061217723300005535Corn RhizosphereDRLMSGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG*
Ga0070684_10071742023300005535Corn RhizospherePDDRLMSGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG*
Ga0070684_10229595213300005535Corn RhizosphereFTPGGMIELDTGSARYLIRFTQTLERQTGWTWTIFNAVRKLST*
Ga0068853_10052135013300005539Corn RhizosphereIGPDDRFAPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP*
Ga0068853_10220459813300005539Corn RhizosphereGMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLSS*
Ga0070695_10056445623300005545Corn, Switchgrass And Miscanthus RhizosphereLMSGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG*
Ga0070696_10199325223300005546Corn, Switchgrass And Miscanthus RhizosphereGMVELDTGNARYLIRFNQTLERQAGWAWALFNAVRKLSP*
Ga0066695_1027013413300005553SoilGPDDRFLPGGMVELDTGNARYLIRFTQTLERQAGWAWSLFNAVRKLSG*
Ga0066707_1100426323300005556SoilDTGNARYLIRFTQTLERQAGWAWALFNAVRKLSP*
Ga0068855_10215362013300005563Corn RhizosphereDDRFTPGSMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP*
Ga0070664_10164700923300005564Corn RhizosphereFAAGGMVELDTGNGRYLIRFSQTLERQAGWTWSLFSAVRKLSA*
Ga0066705_1017930423300005569SoilGMVELDTGNARYLVRFTQTLERQADWAWALFSAVRKLSP*
Ga0066705_1059965423300005569SoilDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLST*
Ga0070702_10159331113300005615Corn, Switchgrass And Miscanthus RhizosphereFVTGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP*
Ga0068864_10042618823300005618Switchgrass RhizosphereGMVELDTGNARYLIRFTQTLERQAGWSWALFSAVRKLS*
Ga0068864_10081519313300005618Switchgrass RhizosphereAGGMVELETGNARYLIRFTQALERQNGWTWALFNAVRRLTP*
Ga0068866_1112095313300005718Miscanthus RhizosphereGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP*
Ga0068863_10233421323300005841Switchgrass RhizosphereMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP*
Ga0068858_10106357113300005842Switchgrass RhizosphereLDTGNGRYLIRFSQVLERQAGWTWALFNAVRKLAG*
Ga0068862_10241061323300005844Switchgrass RhizosphereFVAGGMVELETGNARFLVRFTQAIERQHGWVWALFNAVRKLS*
Ga0066652_10118843623300006046SoilEDKFAPGGMIELDTGNARYLIRFTQTLERQAGWAWAMFSAVRKLGP*
Ga0075028_10034725423300006050WatershedsFIPGGMVELDTGNARYLIRFTQTLERQSGWSWALFTAVRKLTT*
Ga0075422_1061683223300006196Populus RhizosphereIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP*
Ga0068871_10029869323300006358Miscanthus RhizospherePGGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP*
Ga0074062_1185842413300006606SoilGGMVELDTGNARYLIRFTQTLERQTGWAWALFTAVRKLTA*
Ga0066659_1081317723300006797SoilRFMTGGMVELDTGNARYLVRFTETIERQAGWAWALFNAVRKLS*
Ga0079221_1079712713300006804Agricultural SoilPDDRLMAGGMVELDTGNARYLIRFNQTIERQAGWSWGLFSAVRKLSS*
Ga0079220_1083278813300006806Agricultural SoilLDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLST*
Ga0075433_1137525513300006852Populus RhizosphereGMVELDTGNARYLIRFTQTLERQAGWAWTLFNAVRKLSP*
Ga0079218_1154052523300007004Agricultural SoilRFLTGGMVELDTGGARYLIRFTQMLERQAGWSWALFHAVRKLSG*
Ga0066710_10254820113300009012Grasslands SoilMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSS
Ga0105250_1061937713300009092Switchgrass RhizosphereTGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLTS*
Ga0066709_10296219723300009137Grasslands SoilMVELDTGNARYLIRFTQTLERQAGWAWSLFNAVRKLSG*
Ga0099792_1020167023300009143Vadose Zone SoilVELDTGNARYLVRFTETIERQAGWAWALFNAVRKLS*
Ga0105243_1186731113300009148Miscanthus RhizosphereGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG*
Ga0105243_1299724923300009148Miscanthus RhizosphereVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSN*
Ga0105248_1169405613300009177Switchgrass RhizosphereDDKFVTGGMVELDTGNARYLIRFTQALERQAGWSWALFSAVRKLSA*
Ga0105248_1253045123300009177Switchgrass RhizosphereDKFTTGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLTA*
Ga0116167_129622123300009654Anaerobic Digestor SludgeGMVELDTGNARYLIRFTQVLERQSGWGWAMFSAVRKLGA*
Ga0116145_121924723300009704Anaerobic Digestor SludgeELDTGNARYLIRFTQTLERQSGWGWAMFSAVRKLGA*
Ga0105069_105970123300009800Groundwater SandEDKFPPGGMVELDTGNGRYLIRFSQTLERQAGWSWALFNAVRKLAP*
Ga0134128_1022734213300010373Terrestrial SoilTPGSMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP*
Ga0105239_1316022213300010375Corn RhizosphereDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG*
Ga0126383_1022609433300010398Tropical Forest SoilDDRFLPGGMVELDTGNARYLIRFTQTLERQAGWAWALFNAVRKLEG*
Ga0126383_1224527113300010398Tropical Forest SoilDRFLPGGMVELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLSP*
Ga0134127_1059242123300010399Terrestrial SoilTPGGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLST*
Ga0134121_1093198513300010401Terrestrial SoilDTGNARYLIRFTQTLERQAGWAWAMFSAVRKLGP*
Ga0134123_1210260823300010403Terrestrial SoilRFVTGGMVELDTGSARYLIRFTQTLERQPGWAWSLFSAVRKLTP*
Ga0137391_1058214423300011270Vadose Zone SoilRFLPGGMVELDTGNARYLIRFTQTLERQVGWAWSLFNAVRRLSG*
Ga0137428_126591723300011432SoilFPQGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA*
Ga0137383_1062564713300012199Vadose Zone SoilVELDTGNARYLIRFTQTLERQAGWAWALFNAVRKLSP*
Ga0137365_1037452113300012201Vadose Zone SoilGPDDRFLPGGMVELDTGNARYLIRFTQTLERQVGWAWSLFNAVRRLSG*
Ga0137370_1017839023300012285Vadose Zone SoilMVELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLSP*
Ga0137361_1107982123300012362Vadose Zone SoilLPGGMVGLDTGNARYLIRFTQTIERQAGWAWSLFNAVRKLSA*
Ga0150984_11647003923300012469Avena Fatua RhizosphereLDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLST*
Ga0157290_1029386513300012909SoilHGAMVELDTGNARYLIRFTQTLERQAGWSWAMFNAVRKLSS*
Ga0137395_1092922413300012917Vadose Zone SoilMVELDTGNARYLVRFTETIERQAGWAWALFNAVRKLS*
Ga0137359_1171480113300012923Vadose Zone SoilMVELDTGNARYLIRFTQTIERQAGWAWSLFNAVRKLSA*
Ga0137413_1166572723300012924Vadose Zone SoilTTGGMVELDTGTARYLIRFTQTLEQQAGWAWAMFNAVRKLTP*
Ga0137410_1015602613300012944Vadose Zone SoilIELDTGSGRYLIRFTQTLERQTGWTWALFNAVRRLAS*
Ga0164299_1140838913300012958SoilLVALDTGTARYRLRFNQTIERQAGWSWGLFSAVRKLSG*
Ga0164302_1122529113300012961SoilVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG*
Ga0164309_1096986823300012984SoilLDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP*
Ga0164305_1124646113300012989SoilDRFTPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP*
Ga0164305_1135585223300012989SoilGGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP*
Ga0157370_1085468923300013104Corn RhizosphereFTPGGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLST*
Ga0157374_1171730513300013296Miscanthus RhizosphereELGTGSARYLIRFAKTLERQTGWTWTLFNAVRKLAP*
Ga0157378_1279988113300013297Miscanthus RhizosphereDDRFVTGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP*
Ga0163162_1151421613300013306Switchgrass RhizosphereTGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP*
Ga0163162_1326202413300013306Switchgrass RhizosphereLDTGSARYLIRFTKILERQTGWTWTLFNAVRKLAP*
Ga0157372_1069770023300013307Corn RhizosphereFTPGGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLSTAS*
Ga0157375_1196952723300013308Miscanthus RhizosphereMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRK
Ga0157375_1325629323300013308Miscanthus RhizosphereRSLIGPDDRFVTGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP*
Ga0119878_101537833300014055Sewage Treatment PlantEDKFGSGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRMLSG*
Ga0157380_1203859823300014326Switchgrass RhizosphereVELDTGTARYLIRFTQTLEQQAGWSWEMFNAVRKLTP*
Ga0157379_1054180623300014968Switchgrass RhizosphereLDTGSARYLIRFTQTLERQPGWAWSLFSAVRKLTP*
Ga0157376_1034888213300014969Miscanthus RhizosphereMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLAG*
Ga0157376_1069722313300014969Miscanthus RhizosphereRFTPGSMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP*
Ga0157376_1126226413300014969Miscanthus RhizosphereTTGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLTA*
Ga0157376_1164922823300014969Miscanthus RhizosphereFPQGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSN*
Ga0137405_139044783300015053Vadose Zone SoilMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSS*
Ga0167662_101282723300015082Glacier Forefield SoilMVELDTGNARYLVRFTETIERQAGWAWALFNAVRKLSA*
Ga0167658_108183323300015195Glacier Forefield SoilFVTGGMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLT*
Ga0132258_1334897613300015371Arabidopsis RhizosphereRFAPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP*
Ga0132256_10142100923300015372Arabidopsis RhizospherePDDRFVTGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP*
Ga0132256_10266288323300015372Arabidopsis RhizosphereELDTGNARYLIRFTQTLERQAGWAWGLFSAVRKL*
Ga0132256_10373926313300015372Arabidopsis RhizosphereELDTGNARYLIRFTQTLERQAGWAWGLFTAVRKL*
Ga0132257_10149748523300015373Arabidopsis RhizosphereAPGGMVEHDPGNARYLIRFTQTLERQAGWAWALFSAVRKLGP*
Ga0132255_10037707433300015374Arabidopsis RhizosphereSGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA*
Ga0132255_10241858313300015374Arabidopsis RhizosphereDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP*
Ga0132255_10406165913300015374Arabidopsis RhizosphereMVELDTGDARYLIRFTQTLERQPGWAWTLFSAVRKLSP*
Ga0132255_10621831813300015374Arabidopsis RhizosphereLDTGNARYLIRFTQTLERQAGWAWAMFSAVRQLGP*
Ga0182032_1003114213300016357SoilLDKGNARYLIRFTQTLERQPGWAWALFIAVRKLSP
Ga0134069_130060813300017654Grasslands SoilMVELDTGNARYLIRFTQTLERQAGWAWGLFNAVRKLSP
Ga0184605_1040117813300018027Groundwater SedimentLIGPDDKFPSGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSS
Ga0066662_1158630623300018468Grasslands SoilMVELDTGNARYLIRFSQTLERQAGWAWAMFNAVRKLTP
Ga0190270_1239201813300018469SoilMVELDTGSARYLIRFTQMLERQAGWSWALFNAVRKLSG
Ga0190271_1124372313300018481SoilIGPEDRFTHGAMVELDTGNARYLIRFTQTLERQAGWSWAMFSAVRKLSS
Ga0190271_1343264913300018481SoilLTGGMVELDTGNARYLIRFSQMLERQAGWAWALFNAVRKLSP
Ga0210379_1006828913300021081Groundwater SedimentFDTGKARYLIRFTQILEQQAGWSWVLFNAVRNLSS
Ga0210330_126400323300021322EstuarineELDTGSARYLIRFTQTLERQPGWAWTLFSAVRKLTP
Ga0210387_1113084413300021405SoilEKFTHGGLVELDTGTAHYLIRFTEILERQAGWAWATFNAVRKLTP
Ga0124853_114287923300024056Freshwater WetlandsKLAHGAMVELDTGSARYLVRFTQMLERQAGWSWALFSAVRKLSS
Ga0207656_1034103123300025321Corn RhizosphereLDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLSG
Ga0207642_1010206723300025899Miscanthus RhizosphereRFAPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP
Ga0207685_1019411213300025905Corn, Switchgrass And Miscanthus RhizosphereMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG
Ga0207645_1050224023300025907Miscanthus RhizosphereGGMIELDTGNARYLIRFTQTLERQAGWAWAMFSAVRKLGP
Ga0207643_1066718613300025908Miscanthus RhizosphereVTGGMVELDTGSARYLIRFTQTLERQPGWAWTLFSAVRKLSP
Ga0207654_1129414023300025911Corn RhizosphereRFTPGGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLST
Ga0207660_1023175713300025917Corn RhizosphereGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG
Ga0207646_1163562413300025922Corn, Switchgrass And Miscanthus RhizosphereLPGGMVELDTGNARYLIRFTQTLERQAGWTWALFNAVRKLSA
Ga0207659_1032692013300025926Miscanthus RhizosphereIGPDDRFTPGSMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP
Ga0207687_1192536913300025927Miscanthus RhizosphereMIELDTGSARYLIRFTKILERQTGWTWTLFNAVRKLAP
Ga0207701_1036747613300025930Corn, Switchgrass And Miscanthus RhizosphereGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP
Ga0207706_1134019113300025933Corn RhizosphereELDTGNARYLIRFTQTLERQAGWTWALFSAVRKLSP
Ga0207691_1011249313300025940Miscanthus RhizosphereELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP
Ga0207691_1077879023300025940Miscanthus RhizosphereRFVTGGMVELDTGDARYLIRFTQTLERQPGWAWTLFSAVRKLTA
Ga0207711_1164310813300025941Switchgrass RhizospherePDDRFTLGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP
Ga0207711_1177639723300025941Switchgrass RhizosphereVTGGMVELDTGDARYLIRFTQTLERQPGWAWTLFSAVRKLTA
Ga0207667_1148852623300025949Corn RhizosphereTLGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP
Ga0207651_1154288223300025960Switchgrass RhizosphereMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA
Ga0207712_1121498913300025961Switchgrass RhizosphereSLIGPDDRFVTGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP
Ga0207668_1045759223300025972Switchgrass RhizosphereIGPEDKFSTGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLSA
Ga0207668_1062643913300025972Switchgrass RhizosphereRFVTGGMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLSS
Ga0207703_1208656913300026035Switchgrass RhizosphereGPDDRLMSGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG
Ga0207639_1116461613300026041Corn RhizosphereIGPEDKFTTGGMVELDTGTARYLIRFTQTLEQQAGWSWAMFNAVRKLTP
Ga0207639_1136638013300026041Corn RhizosphereGMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLSS
Ga0207708_1083947313300026075Corn, Switchgrass And Miscanthus RhizosphereGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSN
Ga0207641_1112760523300026088Switchgrass RhizosphereGMVELDTGSARYLIRFTQTLERQPGWAWSLFSAVRKLTP
Ga0207648_1015078513300026089Miscanthus RhizosphereSLIGPDDRFAPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP
Ga0207676_1001910513300026095Switchgrass RhizosphereFIAGGMVELDTGNARYLIRFTQTLERQAGWSWSLFTAVRKLSA
Ga0207676_1057890923300026095Switchgrass RhizosphereFPAGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA
Ga0207675_10083113113300026118Switchgrass RhizosphereVELDTGNARYLIRFKQTLEQQAGWSWAMFNAVRKLAG
Ga0207675_10245192623300026118Switchgrass RhizosphereGPDERFVTGGMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLSS
Ga0209804_127442113300026335SoilVELDTGNARYLVRFTETIERQAGWAWALFNAVRKLS
Ga0209807_108517013300026530SoilELDTGNARYLVRFTQTLERQADWAWALFSAVRKLSP
Ga0209807_110925623300026530SoilELDTGNARYLIRFTQTLERQVGWAWSLFNAVRRLSG
Ga0209160_128751113300026532SoilDRFLPGGMVELDTGNARYLIRFTQTLERQAGWAWALFNAVRKLSP
Ga0209117_102596633300027645Forest SoilDERFMTGGMVELDTGNARYLVRFTETIERQAGWAWALFNAVRKLSG
Ga0209998_1006432313300027717Arabidopsis Thaliana RhizosphereLDTGNARYLIRFTQTLERQAGWAWALFSAVRKLGP
Ga0209073_1043584023300027765Agricultural SoilMVELDTGNARYLIRFTQTLERQVGWAWSLFSAVRKLAG
Ga0209177_1049263213300027775Agricultural SoilPSGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA
Ga0209074_1055636823300027787Agricultural SoilGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA
Ga0209668_1003184933300027899Freshwater Lake SedimentPEDKFTSGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLSQ
Ga0268265_1213883613300028380Switchgrass RhizosphereRFVAGGMVELETGNARFLVRFTQAIERQHGWVWALFNAVRKLS
Ga0268264_1128016923300028381Switchgrass RhizospherePGGMIELDTGSARYLIRVTKTLERQTGWTWTLFNAVRKLAP
Ga0307285_1023101023300028712SoilGPDDRFPQGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSN
Ga0247827_1015346523300028889SoilMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP
Ga0302299_1058797013300030010FenIPGGMVELDTGNARYLIRFTQTLERQSGWTWSLFTAVRKLSA
Ga0302217_1006654713300030052FenELDTGNARYLIRFTQTLERQSGWTWSLFTAVRKLSP
Ga0311333_1107484713300030114FenLDTGNARYLIRFTQTLERQAGWAWALFSAVRKLTP
Ga0307498_1018402423300031170SoilGGMVELDTGNARYLIRFTQTLERQSGWAWALFSAVRKLN
Ga0307469_1108369823300031720Hardwood Forest SoilDRFVTGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP
Ga0311351_1109422923300031722FenGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLTA
Ga0302321_10170892423300031726FenLIGPDDRFIPGGMVELDTGGARYLIRFTQTLERQAGWTWTLFSAVRKLTA
Ga0306918_1051641923300031744SoilGGMVELDTGNARYLVRFTQTLERQAGWAWAMFNAVRKLTP
Ga0318576_1012527723300031796SoilDDKFLPGGMVELDTGNARYLVRFTQTLERQAGWAWAMFNAVRKLTP
Ga0307473_1009224423300031820Hardwood Forest SoilSGGMVELDTGNARYLIRFTQTLERQAGWAWALFNAVRKLSG
Ga0315290_1041494813300031834SedimentELETGKSRYLIRFTQTLEHQAGWSWALFSAVRNLGS
Ga0306925_1057709423300031890SoilRSLIGPDDRFPQGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSS
Ga0302322_10232564713300031902FenGPDDKFVPGGMVELDTGTARYLIRFTHTFERQPGWAWAAFSAVRKLG
Ga0308175_10037692923300031938SoilGPDDRFAPGGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLST
Ga0308175_10213414323300031938SoilELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLST
Ga0315278_1015846633300031997SedimentERFVTGGMVELDTGSARYLIRFTQTLERQPGWAWTLFSAVRKLTP
Ga0315278_1084742613300031997SedimentELDTGNARYLIRFTQALERQPGWAWTLFSAVRKLTP
Ga0310897_1011993323300032003SoilIGPDDRFAPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP
Ga0315272_1073511713300032018SedimentELETGKARYLIRFTQTLEHQAGWSWALFSAVRNLGS
Ga0318556_1035791723300032043SoilMVELDTGNARYLVRFTQTLERQAGWAWAMFNAVRKLTP
Ga0310895_1007328323300032122SoilIGPDDKFLAGGMVELDTGNARYLIRFTQTLERQAGWSWALFNAVRKLT
Ga0315281_1133416223300032163SedimentDDRFTTGGMLELDTGSARYLIRFTQTLERQAGWAWTLFSAVRKLTP
Ga0315283_1024819323300032164SedimentIGPDERFVTGGMVELDTGSARYLIRFTQTLERQPGWAWTLFSAVRKLTP
Ga0315283_1185836613300032164SedimentVELDTGSARYLIRFTQTLERQSEWAWTLFSAVRKLTP
Ga0315276_1097080513300032177SedimentGGMVELDTGSARYLIRFTQALERQPGWAWTLFSAVRKLTP
Ga0307471_10260184023300032180Hardwood Forest SoilPDDRFLPGGMVELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLSP
Ga0306920_10117884023300032261SoilLIGPDDRFLPGGMVELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLSP
Ga0315287_1079826413300032397SedimentMVELDTGNARYLIRFTQALERQPGWAWTLFSAVRKLTP
Ga0315287_1171404313300032397SedimentRSLIGPDERFVTGGMVELDTGGARYLVRFTQTLERQPGWAWTLFSAVRKLTP
Ga0315273_1135501423300032516SedimentRFIPGGMVELDTGNARYLIRFTQTLERQSGWTWSLFSAVRKLSG
Ga0318519_1009262923300033290SoilMVELDTGNARYLIRFTQTLERQPGWAWALFNAVRKLSP
Ga0316605_1032244823300033408SoilAMVELDTGSARYLVRFTQMLERQAGWSWALFSAVRKLSS
Ga0316605_1067371413300033408SoilSGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLPQ
Ga0310810_1002686713300033412SoilELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP
Ga0316619_1052247913300033414SoilDKLAHGAMVELDTGSARYLVRFTQMLERQAGWSWALFSAVRKLSS
Ga0316625_10081828713300033418SoilELDTGEGRYLIRFTQTLERQPGWAWAQFGAVRKLSAS
Ga0316625_10169232813300033418SoilGGMAELATGKSRYLIRFTQTLEHQPGWAWALFSAVRNLTS
Ga0316625_10242766013300033418SoilELDTGNARYLIRFTQTLERQSGWTWSLFTAVRKLSA
Ga0326726_1081657013300033433Peat SoilGTGGMVELDTGSARYLIRFTQTLERQAGWSWALFSAVRKLAG
Ga0316629_1033178413300033483SoilFLPGGMVELDTGSARYLIRFSQTLEHQPGWAWSLFAAVRKLAG
Ga0247830_1063029323300033551SoilLDTGNARYLVRFTQTLERQAGWAWALFSAVRKLGP
Ga0316617_10121998113300033557SoilGMVELDTGSARYLIRFTQTLEHQPGWAWSLFAAVRKLAG
Ga0316617_10230248813300033557SoilPEQLAPGGMAEFDTGKARYLIRFAQVVERQPGWSWALFSAVRSLSA
Ga0370501_0266034_9_1253300034195Untreated Peat SoilMVELDTGNARYLIRFTQTLERQPGWAWALFTAVRKLTA
Ga0370481_0355872_8_1243300034281Untreated Peat SoilMVELDTGNARYLIRFTQTLERQAGWSWALFNAVRKLTP
Ga0364943_0212361_87_2033300034354SedimentMVELDTGNARYLIRFNQTLERQAGWAWALFNAVRKLSA
Ga0370485_0188628_533_6403300034358Untreated Peat SoilLDTGNARYLIRFTQTLERQSGWTWSLFTAVRKLSA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.