Basic Information | |
---|---|
Family ID | F020930 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 221 |
Average Sequence Length | 41 residues |
Representative Sequence | GMVELDTGNARYLIRFTQTLERQAGWAWTLFNAVRKLSP |
Number of Associated Samples | 178 |
Number of Associated Scaffolds | 221 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.30 % |
% of genes near scaffold ends (potentially truncated) | 92.31 % |
% of genes from short scaffolds (< 2000 bps) | 92.31 % |
Associated GOLD sequencing projects | 163 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.63 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (60.633 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (5.882 % of family members) |
Environment Ontology (ENVO) | Unclassified (46.606 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.941 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 43.28% Coil/Unstructured: 56.72% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 221 Family Scaffolds |
---|---|---|
PF03480 | DctP | 70.14 |
PF06808 | DctM | 2.26 |
PF10518 | TAT_signal | 1.36 |
PF00464 | SHMT | 0.45 |
PF04290 | DctQ | 0.45 |
PF01872 | RibD_C | 0.45 |
COG ID | Name | Functional Category | % Frequency in 221 Family Scaffolds |
---|---|---|---|
COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.45 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.45 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.45 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.63 % |
Unclassified | root | N/A | 39.37 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459021|G14TP7Y01DC1ZW | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 592 | Open in IMG/M |
3300000956|JGI10216J12902_121027642 | Not Available | 815 | Open in IMG/M |
3300001213|JGIcombinedJ13530_104236414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 591 | Open in IMG/M |
3300004146|Ga0055495_10071172 | Not Available | 771 | Open in IMG/M |
3300005179|Ga0066684_11041771 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005184|Ga0066671_10926898 | Not Available | 551 | Open in IMG/M |
3300005333|Ga0070677_10033109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1988 | Open in IMG/M |
3300005333|Ga0070677_10171861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 1025 | Open in IMG/M |
3300005338|Ga0068868_100212888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1616 | Open in IMG/M |
3300005338|Ga0068868_100880060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
3300005338|Ga0068868_101273654 | Not Available | 682 | Open in IMG/M |
3300005341|Ga0070691_10230253 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300005344|Ga0070661_100050148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3054 | Open in IMG/M |
3300005347|Ga0070668_100067921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp. | 2770 | Open in IMG/M |
3300005347|Ga0070668_100361003 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300005355|Ga0070671_100533896 | Not Available | 1011 | Open in IMG/M |
3300005356|Ga0070674_100243679 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300005438|Ga0070701_10303749 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300005441|Ga0070700_101264333 | Not Available | 619 | Open in IMG/M |
3300005456|Ga0070678_100621834 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300005456|Ga0070678_100788428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 862 | Open in IMG/M |
3300005456|Ga0070678_101357498 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300005457|Ga0070662_100204957 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
3300005457|Ga0070662_101930618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
3300005459|Ga0068867_101664530 | Not Available | 598 | Open in IMG/M |
3300005459|Ga0068867_102094479 | Not Available | 536 | Open in IMG/M |
3300005535|Ga0070684_100612177 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300005535|Ga0070684_100717420 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300005535|Ga0070684_102295952 | Not Available | 509 | Open in IMG/M |
3300005539|Ga0068853_100521350 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300005539|Ga0068853_102204598 | Not Available | 534 | Open in IMG/M |
3300005545|Ga0070695_100564456 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300005546|Ga0070696_101993252 | Not Available | 504 | Open in IMG/M |
3300005553|Ga0066695_10270134 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300005556|Ga0066707_11004263 | Not Available | 509 | Open in IMG/M |
3300005563|Ga0068855_102153620 | Not Available | 561 | Open in IMG/M |
3300005564|Ga0070664_101647009 | Not Available | 608 | Open in IMG/M |
3300005569|Ga0066705_10179304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1317 | Open in IMG/M |
3300005569|Ga0066705_10599654 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300005615|Ga0070702_101593311 | Not Available | 540 | Open in IMG/M |
3300005618|Ga0068864_100426188 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300005718|Ga0068866_11120953 | Not Available | 564 | Open in IMG/M |
3300005841|Ga0068863_102334213 | Not Available | 545 | Open in IMG/M |
3300005842|Ga0068858_101063571 | Not Available | 794 | Open in IMG/M |
3300005844|Ga0068862_102410613 | Not Available | 538 | Open in IMG/M |
3300006046|Ga0066652_101188436 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300006050|Ga0075028_100347254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 837 | Open in IMG/M |
3300006196|Ga0075422_10616832 | Not Available | 504 | Open in IMG/M |
3300006358|Ga0068871_100298693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1413 | Open in IMG/M |
3300006606|Ga0074062_11858424 | Not Available | 950 | Open in IMG/M |
3300006797|Ga0066659_10813177 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300006804|Ga0079221_10797127 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300006806|Ga0079220_10832788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 704 | Open in IMG/M |
3300006852|Ga0075433_11375255 | Not Available | 611 | Open in IMG/M |
3300007004|Ga0079218_11540525 | Not Available | 723 | Open in IMG/M |
3300009012|Ga0066710_102548201 | Not Available | 738 | Open in IMG/M |
3300009092|Ga0105250_10619377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 503 | Open in IMG/M |
3300009137|Ga0066709_102962197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 624 | Open in IMG/M |
3300009143|Ga0099792_10201670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1132 | Open in IMG/M |
3300009148|Ga0105243_11867311 | Not Available | 633 | Open in IMG/M |
3300009148|Ga0105243_12997249 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300009177|Ga0105248_11694056 | Not Available | 717 | Open in IMG/M |
3300009177|Ga0105248_12530451 | Not Available | 585 | Open in IMG/M |
3300009654|Ga0116167_1296221 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300009704|Ga0116145_1219247 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300009800|Ga0105069_1059701 | Not Available | 503 | Open in IMG/M |
3300010373|Ga0134128_10227342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2096 | Open in IMG/M |
3300010375|Ga0105239_13160222 | Not Available | 536 | Open in IMG/M |
3300010398|Ga0126383_10226094 | Not Available | 1817 | Open in IMG/M |
3300010398|Ga0126383_12245271 | Not Available | 632 | Open in IMG/M |
3300010399|Ga0134127_10592421 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300010401|Ga0134121_10931985 | Not Available | 846 | Open in IMG/M |
3300010403|Ga0134123_12102608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 625 | Open in IMG/M |
3300011270|Ga0137391_10582144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
3300011432|Ga0137428_1265917 | Not Available | 506 | Open in IMG/M |
3300012199|Ga0137383_10625647 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300012201|Ga0137365_10374521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1051 | Open in IMG/M |
3300012285|Ga0137370_10178390 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
3300012362|Ga0137361_11079821 | Not Available | 723 | Open in IMG/M |
3300012469|Ga0150984_116470039 | Not Available | 559 | Open in IMG/M |
3300012909|Ga0157290_10293865 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300012917|Ga0137395_10929224 | Not Available | 627 | Open in IMG/M |
3300012923|Ga0137359_11714801 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300012924|Ga0137413_11665727 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300012944|Ga0137410_10156026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1742 | Open in IMG/M |
3300012958|Ga0164299_11408389 | Not Available | 539 | Open in IMG/M |
3300012961|Ga0164302_11225291 | Not Available | 601 | Open in IMG/M |
3300012984|Ga0164309_10969868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 698 | Open in IMG/M |
3300012989|Ga0164305_11246461 | Not Available | 647 | Open in IMG/M |
3300012989|Ga0164305_11355852 | Not Available | 624 | Open in IMG/M |
3300013104|Ga0157370_10854689 | Not Available | 827 | Open in IMG/M |
3300013296|Ga0157374_11717305 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300013297|Ga0157378_12799881 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300013306|Ga0163162_11514216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 764 | Open in IMG/M |
3300013306|Ga0163162_13262024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 520 | Open in IMG/M |
3300013307|Ga0157372_10697700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1181 | Open in IMG/M |
3300013308|Ga0157375_11969527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 694 | Open in IMG/M |
3300013308|Ga0157375_13256293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 541 | Open in IMG/M |
3300014055|Ga0119878_1015378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2123 | Open in IMG/M |
3300014326|Ga0157380_12038598 | Not Available | 636 | Open in IMG/M |
3300014968|Ga0157379_10541806 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300014969|Ga0157376_10348882 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
3300014969|Ga0157376_10697223 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300014969|Ga0157376_11262264 | Not Available | 768 | Open in IMG/M |
3300014969|Ga0157376_11649228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 676 | Open in IMG/M |
3300015053|Ga0137405_1390447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4544 | Open in IMG/M |
3300015082|Ga0167662_1012827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1043 | Open in IMG/M |
3300015195|Ga0167658_1081833 | Not Available | 730 | Open in IMG/M |
3300015371|Ga0132258_13348976 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300015372|Ga0132256_101421009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 805 | Open in IMG/M |
3300015372|Ga0132256_102662883 | Not Available | 600 | Open in IMG/M |
3300015372|Ga0132256_103739263 | Not Available | 512 | Open in IMG/M |
3300015373|Ga0132257_101497485 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300015374|Ga0132255_100377074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2060 | Open in IMG/M |
3300015374|Ga0132255_102418583 | Not Available | 802 | Open in IMG/M |
3300015374|Ga0132255_104061659 | Not Available | 621 | Open in IMG/M |
3300015374|Ga0132255_106218318 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300016357|Ga0182032_10031142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3257 | Open in IMG/M |
3300017654|Ga0134069_1300608 | Not Available | 569 | Open in IMG/M |
3300018027|Ga0184605_10401178 | Not Available | 612 | Open in IMG/M |
3300018468|Ga0066662_11586306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 683 | Open in IMG/M |
3300018469|Ga0190270_12392018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 590 | Open in IMG/M |
3300018481|Ga0190271_11243723 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300018481|Ga0190271_13432649 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300021081|Ga0210379_10068289 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1444 | Open in IMG/M |
3300021322|Ga0210330_1264003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 660 | Open in IMG/M |
3300021405|Ga0210387_11130844 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300024056|Ga0124853_1142879 | Not Available | 676 | Open in IMG/M |
3300025321|Ga0207656_10341031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
3300025899|Ga0207642_10102067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1442 | Open in IMG/M |
3300025905|Ga0207685_10194112 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300025907|Ga0207645_10502240 | Not Available | 821 | Open in IMG/M |
3300025908|Ga0207643_10667186 | Not Available | 671 | Open in IMG/M |
3300025911|Ga0207654_11294140 | Not Available | 531 | Open in IMG/M |
3300025917|Ga0207660_10231757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1452 | Open in IMG/M |
3300025922|Ga0207646_11635624 | Not Available | 555 | Open in IMG/M |
3300025926|Ga0207659_10326920 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
3300025927|Ga0207687_11925369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
3300025930|Ga0207701_10367476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1242 | Open in IMG/M |
3300025933|Ga0207706_11340191 | Not Available | 590 | Open in IMG/M |
3300025940|Ga0207691_10112493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2420 | Open in IMG/M |
3300025940|Ga0207691_10778790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 805 | Open in IMG/M |
3300025941|Ga0207711_11643108 | Not Available | 586 | Open in IMG/M |
3300025941|Ga0207711_11776397 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300025949|Ga0207667_11488526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 648 | Open in IMG/M |
3300025960|Ga0207651_11542882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 598 | Open in IMG/M |
3300025961|Ga0207712_11214989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 673 | Open in IMG/M |
3300025972|Ga0207668_10457592 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300025972|Ga0207668_10626439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
3300026035|Ga0207703_12086569 | Not Available | 543 | Open in IMG/M |
3300026041|Ga0207639_11164616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 723 | Open in IMG/M |
3300026041|Ga0207639_11366380 | Not Available | 665 | Open in IMG/M |
3300026075|Ga0207708_10839473 | Not Available | 793 | Open in IMG/M |
3300026088|Ga0207641_11127605 | Not Available | 783 | Open in IMG/M |
3300026089|Ga0207648_10150785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2051 | Open in IMG/M |
3300026095|Ga0207676_10019105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4994 | Open in IMG/M |
3300026095|Ga0207676_10578909 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300026118|Ga0207675_100831131 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300026118|Ga0207675_102451926 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300026335|Ga0209804_1274421 | Not Available | 593 | Open in IMG/M |
3300026530|Ga0209807_1085170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1392 | Open in IMG/M |
3300026530|Ga0209807_1109256 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300026532|Ga0209160_1287511 | Not Available | 558 | Open in IMG/M |
3300027645|Ga0209117_1025966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1857 | Open in IMG/M |
3300027717|Ga0209998_10064323 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300027765|Ga0209073_10435840 | Not Available | 543 | Open in IMG/M |
3300027775|Ga0209177_10492632 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300027787|Ga0209074_10556368 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300027899|Ga0209668_10031849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2711 | Open in IMG/M |
3300028380|Ga0268265_12138836 | Not Available | 567 | Open in IMG/M |
3300028381|Ga0268264_11280169 | Not Available | 743 | Open in IMG/M |
3300028712|Ga0307285_10231010 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300028889|Ga0247827_10153465 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300030010|Ga0302299_10587970 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300030052|Ga0302217_10066547 | Not Available | 800 | Open in IMG/M |
3300030114|Ga0311333_11074847 | Not Available | 684 | Open in IMG/M |
3300031170|Ga0307498_10184024 | Not Available | 718 | Open in IMG/M |
3300031720|Ga0307469_11083698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 752 | Open in IMG/M |
3300031722|Ga0311351_11094229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 611 | Open in IMG/M |
3300031726|Ga0302321_101708924 | Not Available | 728 | Open in IMG/M |
3300031744|Ga0306918_10516419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 935 | Open in IMG/M |
3300031796|Ga0318576_10125277 | Not Available | 1188 | Open in IMG/M |
3300031820|Ga0307473_10092244 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
3300031834|Ga0315290_10414948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1179 | Open in IMG/M |
3300031890|Ga0306925_10577094 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
3300031902|Ga0302322_102325647 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300031938|Ga0308175_100376929 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
3300031938|Ga0308175_102134143 | Not Available | 628 | Open in IMG/M |
3300031997|Ga0315278_10158466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2316 | Open in IMG/M |
3300032003|Ga0310897_10119933 | Not Available | 1070 | Open in IMG/M |
3300032018|Ga0315272_10735117 | Not Available | 504 | Open in IMG/M |
3300032043|Ga0318556_10357917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 763 | Open in IMG/M |
3300032122|Ga0310895_10073283 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
3300032163|Ga0315281_11334162 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300032164|Ga0315283_10248193 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
3300032164|Ga0315283_11858366 | Not Available | 604 | Open in IMG/M |
3300032180|Ga0307471_102601840 | Not Available | 641 | Open in IMG/M |
3300032261|Ga0306920_101178840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1107 | Open in IMG/M |
3300032397|Ga0315287_11714043 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300032516|Ga0315273_11355014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 28-67-8 | 885 | Open in IMG/M |
3300033290|Ga0318519_10092629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1611 | Open in IMG/M |
3300033408|Ga0316605_10322448 | Not Available | 1364 | Open in IMG/M |
3300033408|Ga0316605_10673714 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300033412|Ga0310810_10026867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6993 | Open in IMG/M |
3300033414|Ga0316619_10522479 | Not Available | 971 | Open in IMG/M |
3300033418|Ga0316625_100818287 | Not Available | 802 | Open in IMG/M |
3300033418|Ga0316625_101692328 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300033418|Ga0316625_102427660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 528 | Open in IMG/M |
3300033433|Ga0326726_10816570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 903 | Open in IMG/M |
3300033483|Ga0316629_10331784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1042 | Open in IMG/M |
3300033551|Ga0247830_10630293 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300033557|Ga0316617_101219981 | Not Available | 747 | Open in IMG/M |
3300033557|Ga0316617_102302488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
3300034195|Ga0370501_0266034 | Not Available | 614 | Open in IMG/M |
3300034281|Ga0370481_0355872 | Not Available | 536 | Open in IMG/M |
3300034354|Ga0364943_0212361 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300034358|Ga0370485_0188628 | Not Available | 642 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.43% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.98% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.98% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.07% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.07% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.07% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.17% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.17% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.71% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.26% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.36% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.36% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.36% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.81% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.81% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.45% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.45% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.45% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.45% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.45% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.45% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.45% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.45% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.45% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.45% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.45% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.45% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.45% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.45% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.45% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.45% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.45% |
Sewage Treatment Plant | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant | 0.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300004146 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009654 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaG | Engineered | Open in IMG/M |
3300009704 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG | Engineered | Open in IMG/M |
3300009800 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014055 | Sewage treatment plant microbial communities from Vermont, USA - ANOX_W | Engineered | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021322 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.298 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
3300030052 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3 | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
3300034358 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4NP_03287930 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MVELDTGNARYLIRFTQTLERQAGWSWSLFTAVRKLSA |
JGI10216J12902_1210276421 | 3300000956 | Soil | GPEDKFTTGGMVELDTGTARYLIRFTQTLEQQAGWSWAMFNAVRKLTP* |
JGIcombinedJ13530_1042364141 | 3300001213 | Wetland | DRFLPGGMVELDTGSARYLIRFSQTLEHQPGWAWSLFAAVRKLAG* |
Ga0055495_100711722 | 3300004146 | Natural And Restored Wetlands | PGAMIELDTGSARYLVRFTQMLERQAGWSWALFSAVRKLSG* |
Ga0066684_110417712 | 3300005179 | Soil | FPAGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA* |
Ga0066671_109268982 | 3300005184 | Soil | TGGMVELDTGNARYLIRFTQTLERQVGWAWSLFSAVRKLAG* |
Ga0070677_100331091 | 3300005333 | Miscanthus Rhizosphere | GPDDRFAPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP* |
Ga0070677_101718612 | 3300005333 | Miscanthus Rhizosphere | GGMIELDTGSARYLIRFTKILERQTGWTWTLFNAVRKLAP* |
Ga0068868_1002128882 | 3300005338 | Miscanthus Rhizosphere | DDRFPQGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSN* |
Ga0068868_1008800601 | 3300005338 | Miscanthus Rhizosphere | RFTPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP* |
Ga0068868_1012736541 | 3300005338 | Miscanthus Rhizosphere | PDDRFTPGSMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP* |
Ga0070691_102302531 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | DDRLMSGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG* |
Ga0070661_1000501483 | 3300005344 | Corn Rhizosphere | RLMSGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG* |
Ga0070668_1000679211 | 3300005347 | Switchgrass Rhizosphere | GGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRRLSG* |
Ga0070668_1003610031 | 3300005347 | Switchgrass Rhizosphere | FVTGGMVELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLGP* |
Ga0070671_1005338961 | 3300005355 | Switchgrass Rhizosphere | PDDRFTLGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP* |
Ga0070674_1002436791 | 3300005356 | Miscanthus Rhizosphere | GGMVELDTGNARYLIRFTQTLERQAGWSWALFNAVRKLT* |
Ga0070701_103037492 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | IGPDERFGTGGMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLSS* |
Ga0070700_1012643333 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | GMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSN* |
Ga0070678_1006218342 | 3300005456 | Miscanthus Rhizosphere | AGGMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLSS* |
Ga0070678_1007884281 | 3300005456 | Miscanthus Rhizosphere | DDRFTPGGMIELDTGSARYLIRFTKILERQTGWTWTLFNAVRKLAP* |
Ga0070678_1013574982 | 3300005456 | Miscanthus Rhizosphere | GGMVELDTGNARYLIRFTQALERQAGWSWALFSAVRKLSA* |
Ga0070662_1002049573 | 3300005457 | Corn Rhizosphere | GGMVELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLGP* |
Ga0070662_1019306182 | 3300005457 | Corn Rhizosphere | GGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLSG* |
Ga0068867_1016645302 | 3300005459 | Miscanthus Rhizosphere | EDKFAPGGMIELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLGP* |
Ga0068867_1020944791 | 3300005459 | Miscanthus Rhizosphere | FPQGGMVELDTGNGRYLIRFSQVLERQAGWTWALFNAVRKLAG* |
Ga0070684_1006121772 | 3300005535 | Corn Rhizosphere | DRLMSGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG* |
Ga0070684_1007174202 | 3300005535 | Corn Rhizosphere | PDDRLMSGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG* |
Ga0070684_1022959521 | 3300005535 | Corn Rhizosphere | FTPGGMIELDTGSARYLIRFTQTLERQTGWTWTIFNAVRKLST* |
Ga0068853_1005213501 | 3300005539 | Corn Rhizosphere | IGPDDRFAPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP* |
Ga0068853_1022045981 | 3300005539 | Corn Rhizosphere | GMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLSS* |
Ga0070695_1005644562 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LMSGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG* |
Ga0070696_1019932522 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GMVELDTGNARYLIRFNQTLERQAGWAWALFNAVRKLSP* |
Ga0066695_102701341 | 3300005553 | Soil | GPDDRFLPGGMVELDTGNARYLIRFTQTLERQAGWAWSLFNAVRKLSG* |
Ga0066707_110042632 | 3300005556 | Soil | DTGNARYLIRFTQTLERQAGWAWALFNAVRKLSP* |
Ga0068855_1021536201 | 3300005563 | Corn Rhizosphere | DDRFTPGSMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP* |
Ga0070664_1016470092 | 3300005564 | Corn Rhizosphere | FAAGGMVELDTGNGRYLIRFSQTLERQAGWTWSLFSAVRKLSA* |
Ga0066705_101793042 | 3300005569 | Soil | GMVELDTGNARYLVRFTQTLERQADWAWALFSAVRKLSP* |
Ga0066705_105996542 | 3300005569 | Soil | DTGNGRYLIRFSQTLERQAGWTWALFNAVRKLST* |
Ga0070702_1015933111 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | FVTGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP* |
Ga0068864_1004261882 | 3300005618 | Switchgrass Rhizosphere | GMVELDTGNARYLIRFTQTLERQAGWSWALFSAVRKLS* |
Ga0068864_1008151931 | 3300005618 | Switchgrass Rhizosphere | AGGMVELETGNARYLIRFTQALERQNGWTWALFNAVRRLTP* |
Ga0068866_111209531 | 3300005718 | Miscanthus Rhizosphere | GMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP* |
Ga0068863_1023342132 | 3300005841 | Switchgrass Rhizosphere | MIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP* |
Ga0068858_1010635711 | 3300005842 | Switchgrass Rhizosphere | LDTGNGRYLIRFSQVLERQAGWTWALFNAVRKLAG* |
Ga0068862_1024106132 | 3300005844 | Switchgrass Rhizosphere | FVAGGMVELETGNARFLVRFTQAIERQHGWVWALFNAVRKLS* |
Ga0066652_1011884362 | 3300006046 | Soil | EDKFAPGGMIELDTGNARYLIRFTQTLERQAGWAWAMFSAVRKLGP* |
Ga0075028_1003472542 | 3300006050 | Watersheds | FIPGGMVELDTGNARYLIRFTQTLERQSGWSWALFTAVRKLTT* |
Ga0075422_106168322 | 3300006196 | Populus Rhizosphere | IELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP* |
Ga0068871_1002986932 | 3300006358 | Miscanthus Rhizosphere | PGGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP* |
Ga0074062_118584241 | 3300006606 | Soil | GGMVELDTGNARYLIRFTQTLERQTGWAWALFTAVRKLTA* |
Ga0066659_108131772 | 3300006797 | Soil | RFMTGGMVELDTGNARYLVRFTETIERQAGWAWALFNAVRKLS* |
Ga0079221_107971271 | 3300006804 | Agricultural Soil | PDDRLMAGGMVELDTGNARYLIRFNQTIERQAGWSWGLFSAVRKLSS* |
Ga0079220_108327881 | 3300006806 | Agricultural Soil | LDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLST* |
Ga0075433_113752551 | 3300006852 | Populus Rhizosphere | GMVELDTGNARYLIRFTQTLERQAGWAWTLFNAVRKLSP* |
Ga0079218_115405252 | 3300007004 | Agricultural Soil | RFLTGGMVELDTGGARYLIRFTQMLERQAGWSWALFHAVRKLSG* |
Ga0066710_1025482011 | 3300009012 | Grasslands Soil | MVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSS |
Ga0105250_106193771 | 3300009092 | Switchgrass Rhizosphere | TGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLTS* |
Ga0066709_1029621972 | 3300009137 | Grasslands Soil | MVELDTGNARYLIRFTQTLERQAGWAWSLFNAVRKLSG* |
Ga0099792_102016702 | 3300009143 | Vadose Zone Soil | VELDTGNARYLVRFTETIERQAGWAWALFNAVRKLS* |
Ga0105243_118673111 | 3300009148 | Miscanthus Rhizosphere | GGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG* |
Ga0105243_129972492 | 3300009148 | Miscanthus Rhizosphere | VELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSN* |
Ga0105248_116940561 | 3300009177 | Switchgrass Rhizosphere | DDKFVTGGMVELDTGNARYLIRFTQALERQAGWSWALFSAVRKLSA* |
Ga0105248_125304512 | 3300009177 | Switchgrass Rhizosphere | DKFTTGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLTA* |
Ga0116167_12962212 | 3300009654 | Anaerobic Digestor Sludge | GMVELDTGNARYLIRFTQVLERQSGWGWAMFSAVRKLGA* |
Ga0116145_12192472 | 3300009704 | Anaerobic Digestor Sludge | ELDTGNARYLIRFTQTLERQSGWGWAMFSAVRKLGA* |
Ga0105069_10597012 | 3300009800 | Groundwater Sand | EDKFPPGGMVELDTGNGRYLIRFSQTLERQAGWSWALFNAVRKLAP* |
Ga0134128_102273421 | 3300010373 | Terrestrial Soil | TPGSMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP* |
Ga0105239_131602221 | 3300010375 | Corn Rhizosphere | DTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG* |
Ga0126383_102260943 | 3300010398 | Tropical Forest Soil | DDRFLPGGMVELDTGNARYLIRFTQTLERQAGWAWALFNAVRKLEG* |
Ga0126383_122452711 | 3300010398 | Tropical Forest Soil | DRFLPGGMVELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLSP* |
Ga0134127_105924212 | 3300010399 | Terrestrial Soil | TPGGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLST* |
Ga0134121_109319851 | 3300010401 | Terrestrial Soil | DTGNARYLIRFTQTLERQAGWAWAMFSAVRKLGP* |
Ga0134123_121026082 | 3300010403 | Terrestrial Soil | RFVTGGMVELDTGSARYLIRFTQTLERQPGWAWSLFSAVRKLTP* |
Ga0137391_105821442 | 3300011270 | Vadose Zone Soil | RFLPGGMVELDTGNARYLIRFTQTLERQVGWAWSLFNAVRRLSG* |
Ga0137428_12659172 | 3300011432 | Soil | FPQGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA* |
Ga0137383_106256471 | 3300012199 | Vadose Zone Soil | VELDTGNARYLIRFTQTLERQAGWAWALFNAVRKLSP* |
Ga0137365_103745211 | 3300012201 | Vadose Zone Soil | GPDDRFLPGGMVELDTGNARYLIRFTQTLERQVGWAWSLFNAVRRLSG* |
Ga0137370_101783902 | 3300012285 | Vadose Zone Soil | MVELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLSP* |
Ga0137361_110798212 | 3300012362 | Vadose Zone Soil | LPGGMVGLDTGNARYLIRFTQTIERQAGWAWSLFNAVRKLSA* |
Ga0150984_1164700392 | 3300012469 | Avena Fatua Rhizosphere | LDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLST* |
Ga0157290_102938651 | 3300012909 | Soil | HGAMVELDTGNARYLIRFTQTLERQAGWSWAMFNAVRKLSS* |
Ga0137395_109292241 | 3300012917 | Vadose Zone Soil | MVELDTGNARYLVRFTETIERQAGWAWALFNAVRKLS* |
Ga0137359_117148011 | 3300012923 | Vadose Zone Soil | MVELDTGNARYLIRFTQTIERQAGWAWSLFNAVRKLSA* |
Ga0137413_116657272 | 3300012924 | Vadose Zone Soil | TTGGMVELDTGTARYLIRFTQTLEQQAGWAWAMFNAVRKLTP* |
Ga0137410_101560261 | 3300012944 | Vadose Zone Soil | IELDTGSGRYLIRFTQTLERQTGWTWALFNAVRRLAS* |
Ga0164299_114083891 | 3300012958 | Soil | LVALDTGTARYRLRFNQTIERQAGWSWGLFSAVRKLSG* |
Ga0164302_112252911 | 3300012961 | Soil | VELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG* |
Ga0164309_109698682 | 3300012984 | Soil | LDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP* |
Ga0164305_112464611 | 3300012989 | Soil | DRFTPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP* |
Ga0164305_113558522 | 3300012989 | Soil | GGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP* |
Ga0157370_108546892 | 3300013104 | Corn Rhizosphere | FTPGGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLST* |
Ga0157374_117173051 | 3300013296 | Miscanthus Rhizosphere | ELGTGSARYLIRFAKTLERQTGWTWTLFNAVRKLAP* |
Ga0157378_127998811 | 3300013297 | Miscanthus Rhizosphere | DDRFVTGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP* |
Ga0163162_115142161 | 3300013306 | Switchgrass Rhizosphere | TGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP* |
Ga0163162_132620241 | 3300013306 | Switchgrass Rhizosphere | LDTGSARYLIRFTKILERQTGWTWTLFNAVRKLAP* |
Ga0157372_106977002 | 3300013307 | Corn Rhizosphere | FTPGGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLSTAS* |
Ga0157375_119695272 | 3300013308 | Miscanthus Rhizosphere | MIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRK |
Ga0157375_132562932 | 3300013308 | Miscanthus Rhizosphere | RSLIGPDDRFVTGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP* |
Ga0119878_10153783 | 3300014055 | Sewage Treatment Plant | EDKFGSGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRMLSG* |
Ga0157380_120385982 | 3300014326 | Switchgrass Rhizosphere | VELDTGTARYLIRFTQTLEQQAGWSWEMFNAVRKLTP* |
Ga0157379_105418062 | 3300014968 | Switchgrass Rhizosphere | LDTGSARYLIRFTQTLERQPGWAWSLFSAVRKLTP* |
Ga0157376_103488821 | 3300014969 | Miscanthus Rhizosphere | MVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLAG* |
Ga0157376_106972231 | 3300014969 | Miscanthus Rhizosphere | RFTPGSMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP* |
Ga0157376_112622641 | 3300014969 | Miscanthus Rhizosphere | TTGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLTA* |
Ga0157376_116492282 | 3300014969 | Miscanthus Rhizosphere | FPQGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSN* |
Ga0137405_13904478 | 3300015053 | Vadose Zone Soil | MVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSS* |
Ga0167662_10128272 | 3300015082 | Glacier Forefield Soil | MVELDTGNARYLVRFTETIERQAGWAWALFNAVRKLSA* |
Ga0167658_10818332 | 3300015195 | Glacier Forefield Soil | FVTGGMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLT* |
Ga0132258_133489761 | 3300015371 | Arabidopsis Rhizosphere | RFAPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP* |
Ga0132256_1014210092 | 3300015372 | Arabidopsis Rhizosphere | PDDRFVTGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP* |
Ga0132256_1026628832 | 3300015372 | Arabidopsis Rhizosphere | ELDTGNARYLIRFTQTLERQAGWAWGLFSAVRKL* |
Ga0132256_1037392631 | 3300015372 | Arabidopsis Rhizosphere | ELDTGNARYLIRFTQTLERQAGWAWGLFTAVRKL* |
Ga0132257_1014974852 | 3300015373 | Arabidopsis Rhizosphere | APGGMVEHDPGNARYLIRFTQTLERQAGWAWALFSAVRKLGP* |
Ga0132255_1003770743 | 3300015374 | Arabidopsis Rhizosphere | SGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA* |
Ga0132255_1024185831 | 3300015374 | Arabidopsis Rhizosphere | DTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP* |
Ga0132255_1040616591 | 3300015374 | Arabidopsis Rhizosphere | MVELDTGDARYLIRFTQTLERQPGWAWTLFSAVRKLSP* |
Ga0132255_1062183181 | 3300015374 | Arabidopsis Rhizosphere | LDTGNARYLIRFTQTLERQAGWAWAMFSAVRQLGP* |
Ga0182032_100311421 | 3300016357 | Soil | LDKGNARYLIRFTQTLERQPGWAWALFIAVRKLSP |
Ga0134069_13006081 | 3300017654 | Grasslands Soil | MVELDTGNARYLIRFTQTLERQAGWAWGLFNAVRKLSP |
Ga0184605_104011781 | 3300018027 | Groundwater Sediment | LIGPDDKFPSGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSS |
Ga0066662_115863062 | 3300018468 | Grasslands Soil | MVELDTGNARYLIRFSQTLERQAGWAWAMFNAVRKLTP |
Ga0190270_123920181 | 3300018469 | Soil | MVELDTGSARYLIRFTQMLERQAGWSWALFNAVRKLSG |
Ga0190271_112437231 | 3300018481 | Soil | IGPEDRFTHGAMVELDTGNARYLIRFTQTLERQAGWSWAMFSAVRKLSS |
Ga0190271_134326491 | 3300018481 | Soil | LTGGMVELDTGNARYLIRFSQMLERQAGWAWALFNAVRKLSP |
Ga0210379_100682891 | 3300021081 | Groundwater Sediment | FDTGKARYLIRFTQILEQQAGWSWVLFNAVRNLSS |
Ga0210330_12640032 | 3300021322 | Estuarine | ELDTGSARYLIRFTQTLERQPGWAWTLFSAVRKLTP |
Ga0210387_111308441 | 3300021405 | Soil | EKFTHGGLVELDTGTAHYLIRFTEILERQAGWAWATFNAVRKLTP |
Ga0124853_11428792 | 3300024056 | Freshwater Wetlands | KLAHGAMVELDTGSARYLVRFTQMLERQAGWSWALFSAVRKLSS |
Ga0207656_103410312 | 3300025321 | Corn Rhizosphere | LDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLSG |
Ga0207642_101020672 | 3300025899 | Miscanthus Rhizosphere | RFAPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP |
Ga0207685_101941121 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG |
Ga0207645_105022402 | 3300025907 | Miscanthus Rhizosphere | GGMIELDTGNARYLIRFTQTLERQAGWAWAMFSAVRKLGP |
Ga0207643_106671861 | 3300025908 | Miscanthus Rhizosphere | VTGGMVELDTGSARYLIRFTQTLERQPGWAWTLFSAVRKLSP |
Ga0207654_112941402 | 3300025911 | Corn Rhizosphere | RFTPGGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLST |
Ga0207660_102317571 | 3300025917 | Corn Rhizosphere | GGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG |
Ga0207646_116356241 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LPGGMVELDTGNARYLIRFTQTLERQAGWTWALFNAVRKLSA |
Ga0207659_103269201 | 3300025926 | Miscanthus Rhizosphere | IGPDDRFTPGSMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP |
Ga0207687_119253691 | 3300025927 | Miscanthus Rhizosphere | MIELDTGSARYLIRFTKILERQTGWTWTLFNAVRKLAP |
Ga0207701_103674761 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP |
Ga0207706_113401911 | 3300025933 | Corn Rhizosphere | ELDTGNARYLIRFTQTLERQAGWTWALFSAVRKLSP |
Ga0207691_101124931 | 3300025940 | Miscanthus Rhizosphere | ELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP |
Ga0207691_107787902 | 3300025940 | Miscanthus Rhizosphere | RFVTGGMVELDTGDARYLIRFTQTLERQPGWAWTLFSAVRKLTA |
Ga0207711_116431081 | 3300025941 | Switchgrass Rhizosphere | PDDRFTLGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP |
Ga0207711_117763972 | 3300025941 | Switchgrass Rhizosphere | VTGGMVELDTGDARYLIRFTQTLERQPGWAWTLFSAVRKLTA |
Ga0207667_114885262 | 3300025949 | Corn Rhizosphere | TLGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP |
Ga0207651_115428822 | 3300025960 | Switchgrass Rhizosphere | MVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA |
Ga0207712_112149891 | 3300025961 | Switchgrass Rhizosphere | SLIGPDDRFVTGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP |
Ga0207668_104575922 | 3300025972 | Switchgrass Rhizosphere | IGPEDKFSTGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLSA |
Ga0207668_106264391 | 3300025972 | Switchgrass Rhizosphere | RFVTGGMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLSS |
Ga0207703_120865691 | 3300026035 | Switchgrass Rhizosphere | GPDDRLMSGGMVELDTGNARYLVRFNQTIERQAGWSWGLFSAVRKLSG |
Ga0207639_111646161 | 3300026041 | Corn Rhizosphere | IGPEDKFTTGGMVELDTGTARYLIRFTQTLEQQAGWSWAMFNAVRKLTP |
Ga0207639_113663801 | 3300026041 | Corn Rhizosphere | GMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLSS |
Ga0207708_108394731 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | GMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSN |
Ga0207641_111276052 | 3300026088 | Switchgrass Rhizosphere | GMVELDTGSARYLIRFTQTLERQPGWAWSLFSAVRKLTP |
Ga0207648_101507851 | 3300026089 | Miscanthus Rhizosphere | SLIGPDDRFAPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP |
Ga0207676_100191051 | 3300026095 | Switchgrass Rhizosphere | FIAGGMVELDTGNARYLIRFTQTLERQAGWSWSLFTAVRKLSA |
Ga0207676_105789092 | 3300026095 | Switchgrass Rhizosphere | FPAGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA |
Ga0207675_1008311311 | 3300026118 | Switchgrass Rhizosphere | VELDTGNARYLIRFKQTLEQQAGWSWAMFNAVRKLAG |
Ga0207675_1024519262 | 3300026118 | Switchgrass Rhizosphere | GPDERFVTGGMVELDTGTARYLIRFTQTLERQPGWAWTLFSAVRKLSS |
Ga0209804_12744211 | 3300026335 | Soil | VELDTGNARYLVRFTETIERQAGWAWALFNAVRKLS |
Ga0209807_10851701 | 3300026530 | Soil | ELDTGNARYLVRFTQTLERQADWAWALFSAVRKLSP |
Ga0209807_11092562 | 3300026530 | Soil | ELDTGNARYLIRFTQTLERQVGWAWSLFNAVRRLSG |
Ga0209160_12875111 | 3300026532 | Soil | DRFLPGGMVELDTGNARYLIRFTQTLERQAGWAWALFNAVRKLSP |
Ga0209117_10259663 | 3300027645 | Forest Soil | DERFMTGGMVELDTGNARYLVRFTETIERQAGWAWALFNAVRKLSG |
Ga0209998_100643231 | 3300027717 | Arabidopsis Thaliana Rhizosphere | LDTGNARYLIRFTQTLERQAGWAWALFSAVRKLGP |
Ga0209073_104358402 | 3300027765 | Agricultural Soil | MVELDTGNARYLIRFTQTLERQVGWAWSLFSAVRKLAG |
Ga0209177_104926321 | 3300027775 | Agricultural Soil | PSGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA |
Ga0209074_105563682 | 3300027787 | Agricultural Soil | GGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSA |
Ga0209668_100318493 | 3300027899 | Freshwater Lake Sediment | PEDKFTSGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLSQ |
Ga0268265_121388361 | 3300028380 | Switchgrass Rhizosphere | RFVAGGMVELETGNARFLVRFTQAIERQHGWVWALFNAVRKLS |
Ga0268264_112801692 | 3300028381 | Switchgrass Rhizosphere | PGGMIELDTGSARYLIRVTKTLERQTGWTWTLFNAVRKLAP |
Ga0307285_102310102 | 3300028712 | Soil | GPDDRFPQGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSN |
Ga0247827_101534652 | 3300028889 | Soil | MIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP |
Ga0302299_105879701 | 3300030010 | Fen | IPGGMVELDTGNARYLIRFTQTLERQSGWTWSLFTAVRKLSA |
Ga0302217_100665471 | 3300030052 | Fen | ELDTGNARYLIRFTQTLERQSGWTWSLFTAVRKLSP |
Ga0311333_110748471 | 3300030114 | Fen | LDTGNARYLIRFTQTLERQAGWAWALFSAVRKLTP |
Ga0307498_101840242 | 3300031170 | Soil | GGMVELDTGNARYLIRFTQTLERQSGWAWALFSAVRKLN |
Ga0307469_110836982 | 3300031720 | Hardwood Forest Soil | DRFVTGGMVELDTGGARYLIRFTQTLERQPGWAWSLFSAVRKLTP |
Ga0311351_110942292 | 3300031722 | Fen | GGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLTA |
Ga0302321_1017089242 | 3300031726 | Fen | LIGPDDRFIPGGMVELDTGGARYLIRFTQTLERQAGWTWTLFSAVRKLTA |
Ga0306918_105164192 | 3300031744 | Soil | GGMVELDTGNARYLVRFTQTLERQAGWAWAMFNAVRKLTP |
Ga0318576_101252772 | 3300031796 | Soil | DDKFLPGGMVELDTGNARYLVRFTQTLERQAGWAWAMFNAVRKLTP |
Ga0307473_100922442 | 3300031820 | Hardwood Forest Soil | SGGMVELDTGNARYLIRFTQTLERQAGWAWALFNAVRKLSG |
Ga0315290_104149481 | 3300031834 | Sediment | ELETGKSRYLIRFTQTLEHQAGWSWALFSAVRNLGS |
Ga0306925_105770942 | 3300031890 | Soil | RSLIGPDDRFPQGGMVELDTGNGRYLIRFSQTLERQAGWTWALFNAVRKLSS |
Ga0302322_1023256471 | 3300031902 | Fen | GPDDKFVPGGMVELDTGTARYLIRFTHTFERQPGWAWAAFSAVRKLG |
Ga0308175_1003769292 | 3300031938 | Soil | GPDDRFAPGGMIELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLST |
Ga0308175_1021341432 | 3300031938 | Soil | ELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLST |
Ga0315278_101584663 | 3300031997 | Sediment | ERFVTGGMVELDTGSARYLIRFTQTLERQPGWAWTLFSAVRKLTP |
Ga0315278_108474261 | 3300031997 | Sediment | ELDTGNARYLIRFTQALERQPGWAWTLFSAVRKLTP |
Ga0310897_101199332 | 3300032003 | Soil | IGPDDRFAPGGMIELDTGSARYLIRFTKTLERQTGWTWTLFNAVRKLAP |
Ga0315272_107351171 | 3300032018 | Sediment | ELETGKARYLIRFTQTLEHQAGWSWALFSAVRNLGS |
Ga0318556_103579172 | 3300032043 | Soil | MVELDTGNARYLVRFTQTLERQAGWAWAMFNAVRKLTP |
Ga0310895_100732832 | 3300032122 | Soil | IGPDDKFLAGGMVELDTGNARYLIRFTQTLERQAGWSWALFNAVRKLT |
Ga0315281_113341622 | 3300032163 | Sediment | DDRFTTGGMLELDTGSARYLIRFTQTLERQAGWAWTLFSAVRKLTP |
Ga0315283_102481932 | 3300032164 | Sediment | IGPDERFVTGGMVELDTGSARYLIRFTQTLERQPGWAWTLFSAVRKLTP |
Ga0315283_118583661 | 3300032164 | Sediment | VELDTGSARYLIRFTQTLERQSEWAWTLFSAVRKLTP |
Ga0315276_109708051 | 3300032177 | Sediment | GGMVELDTGSARYLIRFTQALERQPGWAWTLFSAVRKLTP |
Ga0307471_1026018402 | 3300032180 | Hardwood Forest Soil | PDDRFLPGGMVELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLSP |
Ga0306920_1011788402 | 3300032261 | Soil | LIGPDDRFLPGGMVELDTGNARYLIRFTQTLERQAGWAWALFSAVRKLSP |
Ga0315287_107982641 | 3300032397 | Sediment | MVELDTGNARYLIRFTQALERQPGWAWTLFSAVRKLTP |
Ga0315287_117140431 | 3300032397 | Sediment | RSLIGPDERFVTGGMVELDTGGARYLVRFTQTLERQPGWAWTLFSAVRKLTP |
Ga0315273_113550142 | 3300032516 | Sediment | RFIPGGMVELDTGNARYLIRFTQTLERQSGWTWSLFSAVRKLSG |
Ga0318519_100926292 | 3300033290 | Soil | MVELDTGNARYLIRFTQTLERQPGWAWALFNAVRKLSP |
Ga0316605_103224482 | 3300033408 | Soil | AMVELDTGSARYLVRFTQMLERQAGWSWALFSAVRKLSS |
Ga0316605_106737141 | 3300033408 | Soil | SGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLPQ |
Ga0310810_100268671 | 3300033412 | Soil | ELDTGSARYLIRFTQTLERQTGWTWTLFNAVRKLAP |
Ga0316619_105224791 | 3300033414 | Soil | DKLAHGAMVELDTGSARYLVRFTQMLERQAGWSWALFSAVRKLSS |
Ga0316625_1008182871 | 3300033418 | Soil | ELDTGEGRYLIRFTQTLERQPGWAWAQFGAVRKLSAS |
Ga0316625_1016923281 | 3300033418 | Soil | GGMAELATGKSRYLIRFTQTLEHQPGWAWALFSAVRNLTS |
Ga0316625_1024276601 | 3300033418 | Soil | ELDTGNARYLIRFTQTLERQSGWTWSLFTAVRKLSA |
Ga0326726_108165701 | 3300033433 | Peat Soil | GTGGMVELDTGSARYLIRFTQTLERQAGWSWALFSAVRKLAG |
Ga0316629_103317841 | 3300033483 | Soil | FLPGGMVELDTGSARYLIRFSQTLEHQPGWAWSLFAAVRKLAG |
Ga0247830_106302932 | 3300033551 | Soil | LDTGNARYLVRFTQTLERQAGWAWALFSAVRKLGP |
Ga0316617_1012199811 | 3300033557 | Soil | GMVELDTGSARYLIRFTQTLEHQPGWAWSLFAAVRKLAG |
Ga0316617_1023024881 | 3300033557 | Soil | PEQLAPGGMAEFDTGKARYLIRFAQVVERQPGWSWALFSAVRSLSA |
Ga0370501_0266034_9_125 | 3300034195 | Untreated Peat Soil | MVELDTGNARYLIRFTQTLERQPGWAWALFTAVRKLTA |
Ga0370481_0355872_8_124 | 3300034281 | Untreated Peat Soil | MVELDTGNARYLIRFTQTLERQAGWSWALFNAVRKLTP |
Ga0364943_0212361_87_203 | 3300034354 | Sediment | MVELDTGNARYLIRFNQTLERQAGWAWALFNAVRKLSA |
Ga0370485_0188628_533_640 | 3300034358 | Untreated Peat Soil | LDTGNARYLIRFTQTLERQSGWTWSLFTAVRKLSA |
⦗Top⦘ |