NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F020512

Metagenome / Metatranscriptome Family F020512

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020512
Family Type Metagenome / Metatranscriptome
Number of Sequences 223
Average Sequence Length 42 residues
Representative Sequence APGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ
Number of Associated Samples 165
Number of Associated Scaffolds 223

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.10 %
% of genes from short scaffolds (< 2000 bps) 91.03 %
Associated GOLD sequencing projects 154
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (56.502 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(17.937 % of family members)
Environment Ontology (ENVO) Unclassified
(54.260 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(50.224 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.09%    β-sheet: 0.00%    Coil/Unstructured: 73.91%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 223 Family Scaffolds
PF01844HNH 0.45
PF01391Collagen 0.45



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.03 %
UnclassifiedrootN/A21.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001850|RCM37_1032983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4145Open in IMG/M
3300002199|metazooDRAFT_1227040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300002387|B570J29608_1005231Not Available841Open in IMG/M
3300002408|B570J29032_108933816Not Available544Open in IMG/M
3300003394|JGI25907J50239_1121721All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii506Open in IMG/M
3300003653|SLW02_105284Not Available902Open in IMG/M
3300004282|Ga0066599_100861300Not Available644Open in IMG/M
3300005527|Ga0068876_10649739All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii567Open in IMG/M
3300005528|Ga0068872_10701997All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300005581|Ga0049081_10062298All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1404Open in IMG/M
3300005582|Ga0049080_10089855All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1048Open in IMG/M
3300005584|Ga0049082_10072366Not Available1210Open in IMG/M
3300005584|Ga0049082_10173299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage744Open in IMG/M
3300005662|Ga0078894_11097015All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage679Open in IMG/M
3300005805|Ga0079957_1171410All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1078Open in IMG/M
3300005805|Ga0079957_1295118Not Available732Open in IMG/M
3300005955|Ga0073922_1010083All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1095Open in IMG/M
3300006029|Ga0075466_1163130All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage568Open in IMG/M
3300006030|Ga0075470_10180363All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii610Open in IMG/M
3300006037|Ga0075465_10101156Not Available639Open in IMG/M
3300006802|Ga0070749_10175632All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1235Open in IMG/M
3300006802|Ga0070749_10239181All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1031Open in IMG/M
3300006802|Ga0070749_10516826Not Available649Open in IMG/M
3300006805|Ga0075464_10114289All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1562Open in IMG/M
3300006805|Ga0075464_10443001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage792Open in IMG/M
3300006805|Ga0075464_10817891All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii580Open in IMG/M
3300006805|Ga0075464_10904923All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300006805|Ga0075464_10947460All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii539Open in IMG/M
3300006805|Ga0075464_11019251All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300006805|Ga0075464_11046985All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii513Open in IMG/M
3300006805|Ga0075464_11070288All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii508Open in IMG/M
3300006917|Ga0075472_10608668All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii547Open in IMG/M
3300006920|Ga0070748_1173838Not Available794Open in IMG/M
3300006920|Ga0070748_1221309All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage687Open in IMG/M
3300006920|Ga0070748_1322117Not Available548Open in IMG/M
3300007234|Ga0075460_10263251All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii572Open in IMG/M
3300007234|Ga0075460_10311525All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii515Open in IMG/M
3300007538|Ga0099851_1133712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage931Open in IMG/M
3300007538|Ga0099851_1285548All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii584Open in IMG/M
3300007540|Ga0099847_1115263All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage812Open in IMG/M
3300007542|Ga0099846_1071463All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1297Open in IMG/M
3300007708|Ga0102859_1067019All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1010Open in IMG/M
3300008110|Ga0114343_1038168All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1943Open in IMG/M
3300008116|Ga0114350_1019586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2828Open in IMG/M
3300008117|Ga0114351_1455254Not Available515Open in IMG/M
3300008266|Ga0114363_1019153All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3044Open in IMG/M
3300008266|Ga0114363_1076398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1260Open in IMG/M
3300008266|Ga0114363_1225944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300008339|Ga0114878_1114585All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1019Open in IMG/M
3300008448|Ga0114876_1091695All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1233Open in IMG/M
3300008448|Ga0114876_1214295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300008450|Ga0114880_1038508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2091Open in IMG/M
3300008450|Ga0114880_1122435All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage975Open in IMG/M
3300008450|Ga0114880_1195575All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii683Open in IMG/M
3300008450|Ga0114880_1234492All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii586Open in IMG/M
3300008450|Ga0114880_1240228All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii573Open in IMG/M
3300008450|Ga0114880_1268784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300008510|Ga0110928_1060060All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage578Open in IMG/M
3300009009|Ga0105105_10063447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1702Open in IMG/M
3300009026|Ga0102829_1288405All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii545Open in IMG/M
3300009037|Ga0105093_10269906All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage897Open in IMG/M
3300009056|Ga0102860_1202083Not Available569Open in IMG/M
3300009081|Ga0105098_10538344All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage600Open in IMG/M
3300009082|Ga0105099_10102026All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1575Open in IMG/M
3300009082|Ga0105099_11077329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300009085|Ga0105103_10512501All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage674Open in IMG/M
3300009085|Ga0105103_10799421All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii547Open in IMG/M
3300009152|Ga0114980_10585183All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300009155|Ga0114968_10636854Not Available562Open in IMG/M
3300009158|Ga0114977_10757237All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii514Open in IMG/M
3300009159|Ga0114978_10220719All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1190Open in IMG/M
3300009159|Ga0114978_10688852All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii584Open in IMG/M
3300009161|Ga0114966_10093690All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2031Open in IMG/M
3300009161|Ga0114966_10498816Not Available694Open in IMG/M
3300009165|Ga0105102_10200809Not Available996Open in IMG/M
3300009165|Ga0105102_10480087All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii672Open in IMG/M
3300009168|Ga0105104_10629257All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii612Open in IMG/M
3300009179|Ga0115028_10655371All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage794Open in IMG/M
3300009180|Ga0114979_10383615All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage824Open in IMG/M
3300009180|Ga0114979_10715996All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii565Open in IMG/M
3300009181|Ga0114969_10045225All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2967Open in IMG/M
3300009181|Ga0114969_10736036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300009183|Ga0114974_10730793Not Available536Open in IMG/M
3300009184|Ga0114976_10633825All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii540Open in IMG/M
3300009185|Ga0114971_10088904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1896Open in IMG/M
3300009194|Ga0114983_1091746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage675Open in IMG/M
3300009194|Ga0114983_1095973Not Available656Open in IMG/M
3300009419|Ga0114982_1149870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage720Open in IMG/M
3300009450|Ga0127391_1079665Not Available627Open in IMG/M
3300009469|Ga0127401_1166231Not Available551Open in IMG/M
3300010316|Ga0136655_1184424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage621Open in IMG/M
3300010370|Ga0129336_10537774All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii627Open in IMG/M
3300010965|Ga0138308_181055Not Available1167Open in IMG/M
3300012017|Ga0153801_1034491All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage894Open in IMG/M
3300012667|Ga0157208_10010447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1310Open in IMG/M
3300012708|Ga0157595_1002573Not Available578Open in IMG/M
3300012709|Ga0157608_1015108All Organisms → Viruses → Predicted Viral1999Open in IMG/M
3300012726|Ga0157597_1077338Not Available1315Open in IMG/M
3300012733|Ga0157606_1073636All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1442Open in IMG/M
3300012759|Ga0157626_1066136Not Available1506Open in IMG/M
3300013004|Ga0164293_10299657Not Available1115Open in IMG/M
3300013372|Ga0177922_10088178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300014811|Ga0119960_1056547All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
3300014811|Ga0119960_1074639All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300014811|Ga0119960_1079939All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300015360|Ga0163144_11256815All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage673Open in IMG/M
3300017723|Ga0181362_1067250All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage730Open in IMG/M
3300017736|Ga0181365_1041955All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1149Open in IMG/M
3300017736|Ga0181365_1159347All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii532Open in IMG/M
3300017766|Ga0181343_1196865All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300017766|Ga0181343_1226836All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii508Open in IMG/M
3300017774|Ga0181358_1240193All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii574Open in IMG/M
3300017774|Ga0181358_1271691All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii526Open in IMG/M
3300017780|Ga0181346_1128738All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage964Open in IMG/M
3300017780|Ga0181346_1303758Not Available541Open in IMG/M
3300017784|Ga0181348_1136550All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage929Open in IMG/M
3300017785|Ga0181355_1201577All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage782Open in IMG/M
3300017987|Ga0180431_11165369Not Available501Open in IMG/M
3300019784|Ga0181359_1018340All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2622Open in IMG/M
3300019784|Ga0181359_1110056All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage999Open in IMG/M
3300020160|Ga0211733_10651002All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage755Open in IMG/M
3300020205|Ga0211731_10730554All Organisms → Viruses → Predicted Viral1489Open in IMG/M
3300020506|Ga0208091_1007033All Organisms → Viruses → Predicted Viral1467Open in IMG/M
3300020549|Ga0207942_1026612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage731Open in IMG/M
3300020550|Ga0208600_1047735Not Available645Open in IMG/M
3300020554|Ga0208599_1012392Not Available1436Open in IMG/M
3300020554|Ga0208599_1033448All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage786Open in IMG/M
3300020566|Ga0208222_1049546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage743Open in IMG/M
3300020596|Ga0163149_10472447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage635Open in IMG/M
3300021093|Ga0194123_10240229All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage899Open in IMG/M
3300021438|Ga0213920_1074064Not Available670Open in IMG/M
3300021963|Ga0222712_10790555All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii524Open in IMG/M
3300022190|Ga0181354_1126270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage818Open in IMG/M
3300022190|Ga0181354_1249443All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii506Open in IMG/M
3300022407|Ga0181351_1076525Not Available1343Open in IMG/M
3300022748|Ga0228702_1036863All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1418Open in IMG/M
3300023174|Ga0214921_10012420All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10182Open in IMG/M
3300024239|Ga0247724_1076616All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii514Open in IMG/M
3300024496|Ga0255151_1074209All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300025635|Ga0208147_1035663All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1303Open in IMG/M
3300025646|Ga0208161_1016063All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2926Open in IMG/M
3300025848|Ga0208005_1200812All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage619Open in IMG/M
3300025872|Ga0208783_10064673All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1649Open in IMG/M
3300025889|Ga0208644_1183794All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi924Open in IMG/M
3300025896|Ga0208916_10082379All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1349Open in IMG/M
3300026455|Ga0255155_1039707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage812Open in IMG/M
3300026473|Ga0255166_1040491Not Available942Open in IMG/M
3300026931|Ga0209850_1009715All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage802Open in IMG/M
3300027133|Ga0255070_1008324All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1875Open in IMG/M
3300027320|Ga0208923_1051948All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage728Open in IMG/M
3300027487|Ga0255091_1052268Not Available632Open in IMG/M
3300027621|Ga0208951_1115322Not Available723Open in IMG/M
3300027644|Ga0209356_1161651All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii621Open in IMG/M
3300027659|Ga0208975_1158525All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii628Open in IMG/M
3300027679|Ga0209769_1103089All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage922Open in IMG/M
3300027710|Ga0209599_10158999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300027736|Ga0209190_1377724Not Available516Open in IMG/M
3300027744|Ga0209355_1367333All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage523Open in IMG/M
3300027759|Ga0209296_1219966All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage800Open in IMG/M
3300027759|Ga0209296_1414456All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii501Open in IMG/M
3300027764|Ga0209134_10203670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage681Open in IMG/M
3300027764|Ga0209134_10341547All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii506Open in IMG/M
3300027782|Ga0209500_10049636All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2247Open in IMG/M
3300027782|Ga0209500_10118470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1286Open in IMG/M
3300027785|Ga0209246_10355524All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii556Open in IMG/M
3300027793|Ga0209972_10488973Not Available507Open in IMG/M
3300027808|Ga0209354_10427261Not Available512Open in IMG/M
(restricted) 3300027970|Ga0247837_1285846All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii629Open in IMG/M
3300028025|Ga0247723_1159657All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300028103|Ga0255172_1045989All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage805Open in IMG/M
(restricted) 3300028553|Ga0247839_1352983All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii534Open in IMG/M
(restricted) 3300028571|Ga0247844_1132764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1053Open in IMG/M
3300031565|Ga0307379_10323165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1512Open in IMG/M
3300031707|Ga0315291_11066463Not Available673Open in IMG/M
3300031786|Ga0315908_11435921All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage539Open in IMG/M
3300031787|Ga0315900_11028149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300031834|Ga0315290_11379716Not Available577Open in IMG/M
3300031857|Ga0315909_10498515All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage842Open in IMG/M
3300031857|Ga0315909_10506343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage832Open in IMG/M
3300031951|Ga0315904_10384267Not Available1278Open in IMG/M
3300031951|Ga0315904_10507705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1061Open in IMG/M
3300031951|Ga0315904_11217573All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300031952|Ga0315294_10853376All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
3300031963|Ga0315901_10029692All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5606Open in IMG/M
3300032053|Ga0315284_11522532All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300032053|Ga0315284_12495945Not Available504Open in IMG/M
3300032093|Ga0315902_10505284All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1050Open in IMG/M
3300032116|Ga0315903_10040409All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4861Open in IMG/M
3300032116|Ga0315903_10344852All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1236Open in IMG/M
3300032173|Ga0315268_10402785All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1339Open in IMG/M
3300032516|Ga0315273_12796416All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii553Open in IMG/M
3300032516|Ga0315273_12826128Not Available549Open in IMG/M
3300033981|Ga0334982_0083605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1706Open in IMG/M
3300033992|Ga0334992_0118976All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1391Open in IMG/M
3300033995|Ga0335003_0410052Not Available578Open in IMG/M
3300034061|Ga0334987_0038973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4063Open in IMG/M
3300034061|Ga0334987_0527730All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage713Open in IMG/M
3300034062|Ga0334995_0021425All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5743Open in IMG/M
3300034066|Ga0335019_0194178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1317Open in IMG/M
3300034092|Ga0335010_0268260All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage997Open in IMG/M
3300034092|Ga0335010_0408456Not Available740Open in IMG/M
3300034093|Ga0335012_0055569All Organisms → Viruses → Predicted Viral2281Open in IMG/M
3300034101|Ga0335027_0330752All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1015Open in IMG/M
3300034101|Ga0335027_0577638All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii689Open in IMG/M
3300034102|Ga0335029_0604569All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300034102|Ga0335029_0632620Not Available593Open in IMG/M
3300034102|Ga0335029_0731917Not Available531Open in IMG/M
3300034104|Ga0335031_0714315All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300034106|Ga0335036_0141863All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1719Open in IMG/M
3300034106|Ga0335036_0310812All Organisms → Viruses → Predicted Viral1043Open in IMG/M
3300034106|Ga0335036_0655474All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii628Open in IMG/M
3300034106|Ga0335036_0866687All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii516Open in IMG/M
3300034108|Ga0335050_0359667All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage669Open in IMG/M
3300034112|Ga0335066_0589259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage576Open in IMG/M
3300034119|Ga0335054_0005547All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7542Open in IMG/M
3300034121|Ga0335058_0049832All Organisms → Viruses → Predicted Viral2450Open in IMG/M
3300034122|Ga0335060_0017603All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4732Open in IMG/M
3300034167|Ga0335017_0552819Not Available602Open in IMG/M
3300034200|Ga0335065_0284232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1050Open in IMG/M
3300034283|Ga0335007_0002492All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14568Open in IMG/M
3300034356|Ga0335048_0154127Not Available1313Open in IMG/M
3300034356|Ga0335048_0588579Not Available517Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater17.94%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous13.45%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake12.56%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake8.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.38%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.48%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.48%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.69%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.69%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.69%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater2.69%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.79%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.79%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.79%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic1.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.90%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.90%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.90%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.90%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.90%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.90%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.90%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.45%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.45%
Lake ChemoclineEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline0.45%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.45%
Water BodiesEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies0.45%
Subglacial FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater0.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.45%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.45%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.45%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.45%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001850Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2aEnvironmentalOpen in IMG/M
3300002199Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUN 2013EnvironmentalOpen in IMG/M
3300002387Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003653Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 0.2 micron filterEnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005955Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008339Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigsEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300008510Microbial Communities in Water bodies, Singapore - Site RAEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009194Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RTEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300009450Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009469Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010965Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621EnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012667Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15EnvironmentalOpen in IMG/M
3300012708Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012709Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012726Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012733Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012759Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017987Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaGEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020506Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020550Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020554Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020566Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020596Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1EnvironmentalOpen in IMG/M
3300021093Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surfaceEnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022748Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MGEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300024239Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-EEnvironmentalOpen in IMG/M
3300024496Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8hEnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026455Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8hEnvironmentalOpen in IMG/M
3300026473Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300026931Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027133Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027487Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8dEnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027710Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027744Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028103Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300028553 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16mEnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
RCM37_103298313300001850Marine PlanktonIAPGGTIESVDFAPASPFRLGRSLMNRVTGLLGPYLDVEAMIG*
metazooDRAFT_122704023300002199LakeFQSRTAAGGQIEGVDFAVTPFRLGRSLFNRISGILGPYIDVETMVG*
B570J29608_100523113300002387FreshwaterQSRTAAGGQIEGVDFAPTPYRMGRSLVNRVQALLAPFIDVESLCQ*
B570J29032_10893381623300002408FreshwaterSVVAPGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM*
JGI25907J50239_112172123300003394Freshwater LakeARLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ*
SLW02_10528413300003653Subglacial FreshwaterGGQIEGVDFSPQPFQMGRSLLNRVIGLLGSYVDVSTMAQ*
Ga0066599_10086130023300004282FreshwaterEQAVMSVAVEIFSSKTSPGGSMEGVDYTVVSPFRLGRSLFNRVSGLLGSYIDTESIAQ*
Ga0068876_1064973923300005527Freshwater LakeRSAVGGQIEGVDFQVTPFRLGRSLFNRVSGLLGRHIDQESIAL*
Ga0068872_1070199713300005528Freshwater LakeAVSVEVFQSRIAPGGQIEGIDFTNVSPYRLGRSLFNRVSGLLGPFIDTDSMVQ*
Ga0049081_1006229813300005581Freshwater LenticGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDTESMAQ*
Ga0049080_1008985513300005582Freshwater LenticGQIEGVDFTATPFRMGRSLFNKCVGILGSYIDTESMCQ*
Ga0049082_1007236613300005584Freshwater LenticGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYVDVSTMAM*
Ga0049082_1017329933300005584Freshwater LenticVSVEVFQSITAAGGQIEGVDFQVTPYRMGRSLLNRVIGILGKSLDTGAMLA*
Ga0078894_1109701533300005662Freshwater LakeGGQIEGVDFTATPFRMGRSLFNKCVGLLGAYMDTETMAQ*
Ga0079957_117141023300005805LakeLVEVFQSITAAGGQIEGVDFQVTPYRMGRSLLNRVIGILGKSLDTGAMLA*
Ga0079957_129511813300005805LakeAPGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM*
Ga0073922_101008343300005955SandEGVDFTATPFKMGRSLYNTCVGLLGSYIDPEGMCQ*
Ga0075466_116313013300006029AqueousGQIEGLDFASSPYRMGRSLQNRVIGLLGNYIDVEVMVG*
Ga0075470_1018036333300006030AqueousSRVAPGGQIEGVDFTASPFRMGRSLFNRCVGLLGPYLDTETLAQ*
Ga0075465_1010115633300006037AqueousTAPGGQIEGVDFQPSPFRMGRSLQNRVIGLLGNFVDVEIMAQ*
Ga0070749_1017563213300006802AqueousTEIFQSRTAAGGQIEGVDFAVTPFRLGRSLFNRISGILGPYLDVETMVG*
Ga0070749_1023918133300006802AqueousAAGGQIEGVDFTPTPYRMGRSLASRVYSLIAKYVEVGSIAQ*
Ga0070749_1051682633300006802AqueousAPGGQIEGVDFQPTPFRMGRSLWNKCSGLLGALVDVDTIAQ*
Ga0075464_1011428953300006805AqueousGQIEGVDFSPTPYRMGRSLFNRVSGLLGSVIDVESIAQ*
Ga0075464_1044300113300006805AqueousITAPGGQIEGVDFAPTPFRMGRSLYNRVSGLLGAYVDVESIAQ*
Ga0075464_1081789113300006805AqueousQIEGVDFSPTPFRMGRSLFNKCVGLLGSYMDTEGLAQ*
Ga0075464_1090492323300006805AqueousPGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ*
Ga0075464_1094746013300006805AqueousQSRIAPGGQIEGIDFTNVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ*
Ga0075464_1101925123300006805AqueousEGVDFTATPYRMGRSLTNRVSTLLMPYLDVETVVQ*
Ga0075464_1104698523300006805AqueousSVEVFQSRIAPGGQIEGIDFTQVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ*
Ga0075464_1107028823300006805AqueousQSRTAAGGQIEGVDFAVTPFRLGRSLFNRVVGLLGPYIDTESMIG*
Ga0075472_1060866813300006917AqueousARLAGGGQIEGVDFSPTPFRMGRSLFNKCVGLLGSYMDTESLAQ*
Ga0070748_117383833300006920AqueousFQSVVAPGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM*
Ga0070748_122130913300006920AqueousEIFQSITAAGGQIEGVDFQPTPYRMGRGLLNRVIGILGKSLDQDAMLA*
Ga0070748_132211713300006920AqueousSVTAPGGQIEGVDFAPTPFRMGRSLQNRVIGLISAFYDVDSICQ*
Ga0075460_1026325123300007234AqueousGVDFAVTPFRLGRSLFNRVSGLLGSYLDVESMVG*
Ga0075460_1031152513300007234AqueousEVFQSRIAPGGQIEGIDFTSVSPYRLGRSLFNRVSGLLGAYIDTGSMVQ*
Ga0099851_113371233300007538AqueousQSRTAPGGQIEGLDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ*
Ga0099851_128554813300007538AqueousNIEGVDFAVTPFRLGRSLFNRISGILGSYIDVESMVG*
Ga0099847_111526313300007540AqueousSVEVFQSRIAPGGQIEGIDFTQVSPYRLGRSLFNRVSGILGAFIDTDSMVQ*
Ga0099846_107146313300007542AqueousTAAGGQIEGVDFAPTPYRMGKSLTSRVTGLLAPFIDTGTICQ*
Ga0102859_106701933300007708EstuarineVVAPGGQIEGVDFTPSPFRMGRSLQNRVIGLLGNYIDVSTMAM*
Ga0114343_103816813300008110Freshwater, PlanktonEVFQSRIAPGGQIEGIDFTNVSPYRLGRSLFNRVSGLLGPYIDTDSMVQ*
Ga0114350_101958613300008116Freshwater, PlanktonRVAPGGQMEGIDFTNVSPYRLGRSLFNRVSGLLGAYLDVETMAQ*
Ga0114351_145525413300008117Freshwater, PlanktonAVGGQIEGADFQVTPFRLRRSLFNRISGLLGKHIDSESIAL*
Ga0114363_101915363300008266Freshwater, PlanktonQSRTAPGGQIEGVDFAPSPYRMGRSLFNRVVGLLGSYIDVETMAQ*
Ga0114363_107639813300008266Freshwater, PlanktonGVDFTTVSPYRLGRSLFNRVSGLLGAFIDTDSMVQ*
Ga0114363_122594423300008266Freshwater, PlanktonEGVDFAPTPYRMGRSLVNRVQALLAPFIDVESLCQ*
Ga0114878_111458513300008339Freshwater LakeGQIEGVDFASSPYRMGRSLTNRVSTLLMPYLDAETVVQ*
Ga0114876_109169513300008448Freshwater LakeAPGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ*
Ga0114876_121429513300008448Freshwater LakeLAVSVEVFQSRIAPGGQIEGVDFTQVSPYRLGRSLFNRVSGLLGPYIDTDSMVQ*
Ga0114880_103850863300008450Freshwater LakeTAAGGQIEGVDFAVTPFRLGRSLFNRVVGLLGPYIDTESMIG*
Ga0114880_112243533300008450Freshwater LakeGQIEGIDFTSVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ*
Ga0114880_119557513300008450Freshwater LakeQSRIAPGGQIEGVDFTTVSPYRLGRSLFNRVSGLLGAFIDTDSMVQ*
Ga0114880_123449213300008450Freshwater LakeEGVDFSPTPFRMGRSLFNKCVGLLGSYMDTEGMAQ*
Ga0114880_124022813300008450Freshwater LakeEGVDFTVSPFRLGRSLFNRISGILGPYIDTETMIG*
Ga0114880_126878423300008450Freshwater LakeTAAGGQIEGVDFTVSPFRLGRSLFNRISGILGPYIDTETMIG*
Ga0110928_106006013300008510Water BodiesAAGGQIEGIDFTVSPYRLGRSLFNRISGLLGPYIDTETMVG*
Ga0105105_1006344753300009009Freshwater SedimentGGQIEGIDFASSPYRMGRSLLNRVVGLLGNYIDVDTMVG*
Ga0102829_128840513300009026EstuarineVAGGGQIEGIDFTATPFRMGRSLFNRCVGLLGPYMDVESICQ*
Ga0105093_1026990633300009037Freshwater SedimentAAGGQIEGIDFASSPYRMGRSLLNRVVGLLGNYIDVDTMVG*
Ga0102860_120208323300009056EstuarineIEGVDFQPSPYRMGRSLQNRVIGLLGNYIDVSTMAM*
Ga0105098_1053834413300009081Freshwater SedimentVDFTTVSPYRLGRSLFNRVSGLLGAFIDTDSMVQ*
Ga0105099_1010202613300009082Freshwater SedimentGQIEGIDFASSPYRMGRSLLNRVVGLLGNYIDVDTMVG*
Ga0105099_1107732913300009082Freshwater SedimentEVFQSRTAAGGQIEGLDFASSSYRMGRSLLNRVVGLLGNYIDVDTMVQ*
Ga0105103_1051250133300009085Freshwater SedimentQIEGIDFTNVSPYRLGRSLFNRVSGLLGPYIDTDSMVQ*
Ga0105103_1079942113300009085Freshwater SedimentVAVEVFQSRIAPGGQIEGIDFTTVSPYRLGRSLFNRVSGLLGQYLDVETMAQ*
Ga0114980_1058518313300009152Freshwater LakeIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ*
Ga0114968_1063685413300009155Freshwater LakeFQSVVAAGGQIEGVDFTPSPFRMGRSLNNRVIGLLGSYIDVETMAM*
Ga0114977_1075723713300009158Freshwater LakeQARLAGGGQIEGVDFTATPFRMGRSLFNKCVGILGSYIDTESMCQ*
Ga0114978_1022071913300009159Freshwater LakeTAAGGQIEGVDFSPSPFRMGRSLYNRCVGLLGSLVDVGTIAQ*
Ga0114978_1068885213300009159Freshwater LakeGGQIEGVDFSPSPYRMGRSLFNRCVGLLGPYVDVETMAQ*
Ga0114966_1009369063300009161Freshwater LakeSLEVFQSRVAGGGQIEGIDFTATPFRMGRSLFNRCVGLLGPYMDVESICQ*
Ga0114966_1049881613300009161Freshwater LakeIFQSVVAPGGQIEGVDFQPSPYKMGRSLMNRVIGLISPYIDVETMAM*
Ga0105102_1020080933300009165Freshwater SedimentSVYVFQARLAGSGQIEGVDFTSTPFRMGRSLFNKTVGLLGSYMDTEGICQ*
Ga0105102_1048008713300009165Freshwater SedimentEVFQSRVAPGGQIEGVDFTPTPYRMGRSLFNRCVGLLGPYIDVESIVQ*
Ga0105104_1062925713300009168Freshwater SedimentIEGVDFTSTPFRMGRSLFNKCVGLLGSYMDTGSMAQ*
Ga0115028_1065537133300009179WetlandQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ*
Ga0114979_1038361513300009180Freshwater LakeEIFQSVVAPGGQIEGVDFQPSPYRMGRSLQNRVIGLLGNYIDVSTMAM*
Ga0114979_1071599613300009180Freshwater LakeGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPEGMCQ*
Ga0114969_1004522563300009181Freshwater LakeEIFQSITAAGGQIEGVDFQPSPFRMGRSLQNRVVGLLSPFLDVETICQ*
Ga0114969_1073603613300009181Freshwater LakeTAPGGQIEGVDFSPSPFRMGRSLYNRVSGLLGSLVDVGSIAQ*
Ga0114974_1073079313300009183Freshwater LakeVEVFTSRNQAGGQMEGVDFSNVSPYRLGRSLFNRVSGLLGSYIDVESIAQ*
Ga0114976_1063382523300009184Freshwater LakeVEVFQSRVAAGGQIEGVDFSPSPYRMGRSLFNRCVGLLGSYIDTESMAQ*
Ga0114971_1008890413300009185Freshwater LakeIFQSVTAAGGQIEGVDFTPSPYRMGRSLQNRVIGLIGNYVDVETMAQ*
Ga0114983_109174613300009194Deep SubsurfacePGGQIEGIDFTNVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ*
Ga0114983_109597313300009194Deep SubsurfaceIFQSVVAPGGQIEGVDFTPSPFRMGRSLQNRVIGLLGNYIDVSTMAM*
Ga0114982_114987013300009419Deep SubsurfaceEGVDFTNVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ*
Ga0127391_107966513300009450Meromictic PondGQIEGVDFTPTPYRMGRSLFNRCVGLLGPYIDVESIVQ*
Ga0127401_116623113300009469Meromictic PondQSRVAPGGQIEGVDFTPTPYRMGRSLFNRCVGLLGPYIDVESIVQ*
Ga0136655_118442413300010316Freshwater To Marine Saline GradientGVDFTATPFKMGRSLFNRCVGLLGAYLDVESMAQ*
Ga0129336_1053777413300010370Freshwater To Marine Saline GradientQSRTAAGGQIEGVDFAVTPFRLGRSLFNRVVGLLGPYIDTETMIG*
Ga0138308_18105513300010965Lake ChemoclineGQIEGVDFQPSPFRMGRSLQNRVIGLLGNYIDVSTMAM*
Ga0153801_103449133300012017FreshwaterQIEGVDFTPSPYRMGRSLMNRVIGLLSPYIDVETMAM*
Ga0157208_1001044713300012667FreshwaterVAPGGQMEGIDFTNVSPYRLGRSLFNRVSGLLGAYLDVETMAQ*
Ga0157595_100257323300012708FreshwaterGGQIEGVDFAPTPYRMGRSLQNRVIGLISAFYDVDSICQ*
Ga0157608_101510813300012709FreshwaterQIEGVDFASSPYRMGRSLLNRVIGLLGNYIDVDTMVG*
Ga0157597_107733813300012726FreshwaterEGVDFTATPFRMGRSLFNRCVGLLGPFIDVESMAQ*
Ga0157606_107363613300012733FreshwaterQIEGIDMAVSPYRMGRSLTNRVSTLLMPYLDAETVVQ*
Ga0157626_106613613300012759FreshwaterQIEGVDFTASPYRMGRSLFNRCVGLLGAYLDVESMAQ*
Ga0164293_1029965743300013004FreshwaterGVDFQISPYALGRSLFNRVSGMLGGLLDVETMIG*
Ga0177922_1008817813300013372FreshwaterIEGVDFASSPYRMGRSLTNRVSTLLMPYLDAETVVQ*
Ga0119960_105654733300014811AquaticFPVTITRGGQIEGVDFAPSPYRMGRSLYNRVAGLLGAYVDVESIAQ*
Ga0119960_107463913300014811AquaticFPSHDQSTAAGGQIEGVDFTGTPYRMGRSLLNRVSSLLQPYIDVETIVQ*
Ga0119960_107993913300014811AquaticFPSHDLEDVDFAPTPFRMGRSLYNRVSGLLGAYVDVESIAQ*
Ga0163144_1125681513300015360Freshwater Microbial MatAGGQIEGVDFASSPYRMGRSLTNRVSTLLMPFLDVETMVQ*
Ga0181362_106725013300017723Freshwater LakeSGGQIEGVDFAVTPFKMGRSLFNTCVGLLGSYMDTESMCQ
Ga0181365_104195543300017736Freshwater LakeGQIEGVDFAVTPFKMGRSLFNTCVGLLGSYMDTESMCQ
Ga0181365_115934713300017736Freshwater LakeVFQARLAGGGQIEGIDFTATPFRMGRSLFNRCVGLLGPYMDVESICQ
Ga0181343_119686513300017766Freshwater LakeEVFQSRTAPGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ
Ga0181343_122683613300017766Freshwater LakeEGVDFTASPFRMGRSLFNRCVGLLGPYLDVESMCQ
Ga0181358_124019313300017774Freshwater LakeAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ
Ga0181358_127169123300017774Freshwater LakeARLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ
Ga0181346_112873813300017780Freshwater LakeSVVAPGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM
Ga0181346_130375813300017780Freshwater LakeQSVVAPGGQIEGVDFTPSPYRMGRSLMNRVMGLLSPYIDVSTMAM
Ga0181348_113655013300017784Freshwater LakePGGQIEGVDFTPSPFRMGRSLQNRVIGLLGNYVDVSTMAM
Ga0181355_120157733300017785Freshwater LakeEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM
Ga0180431_1116536923300017987Hypersaline Lake SedimentVDVFQSRVAPGGQTEAIDFTPGPYRMGRSLMTRVSGLLGRYLDTSMLAR
Ga0181359_101834063300019784Freshwater LakeSGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ
Ga0181359_111005633300019784Freshwater LakeVFQSRTAAGGQIEGVDFQPTPFKMGRSLLNRCIGLLGELLDVEALAQ
Ga0211733_1065100233300020160FreshwaterSRTAAGGQIEGVDFGATPYRMGRSLLNRVIGLLGNYIDVETMVG
Ga0211731_1073055413300020205FreshwaterGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDTESMAQ
Ga0208091_100703313300020506FreshwaterEVFQSRTAAGGQIEGLDFASTPFRMGRSLLNRVVGLLGNYIDVETMVG
Ga0207942_102661213300020549FreshwaterSRIAPGGQIEGVDFTNVSPYRLGRSLFNRVSGLLGPYIDTDSMVQ
Ga0208600_104773533300020550FreshwaterQIEGVDFAPSPFRMGRSLQNRVIGLLGNYIDVSTMAM
Ga0208599_101239213300020554FreshwaterAGGGQIEGVDFSPTPFRMGRSLFNKCVGLLGSYMDTEGMAQ
Ga0208599_103344833300020554FreshwaterLAGGGQIEGVDFTATPFRMGRSLFNKCVGILGSYIDTESMCQ
Ga0208222_104954613300020566FreshwaterIEGVDFQPTPFRMGRSLFNKCVGLLGSYMDTESMAQ
Ga0163149_1047244733300020596Freshwater Microbial MatQIEGVDFASSPYRMGRSLTNRVSTLLMPFLDVETMVQ
Ga0194123_1024022913300021093Freshwater LakeRVAAGGQIEGVDFTATPFRMGRSLFNRCVGILGAYLDVESMCQ
Ga0213920_107406413300021438FreshwaterAGGQIEGVDFAPTPFRMGRSLLNRVIGLISPFIDVETIAQ
Ga0222712_1079055513300021963Estuarine WaterAAGGQIEGVDFTATPFRMGRSLFNRCVGLLGPYLDVESMAQ
Ga0181354_112627013300022190Freshwater LakeRLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ
Ga0181354_124944323300022190Freshwater LakeQARLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ
Ga0181351_107652513300022407Freshwater LakeVEGVDFTPSPFRMGRSLQNRVIGLLGNYVDVSTMAM
Ga0228702_103686353300022748FreshwaterTSAGGQLEGVDFNTVSPYRLGRGLFNRVVGLLGKYLDVESLAQ
Ga0214921_10012420223300023174FreshwaterIEGVDFAPTPFRMGRSLYNRVSGLLGSLVDVGSIAQ
Ga0247724_107661623300024239Deep Subsurface SedimentEGVDFAVTPFRLGRSLFNRVAGLLGPYIDTETMIG
Ga0255151_107420913300024496FreshwaterVSVEIFQSITAAGGQIEGVDFQPTPYRIGRSLLNRVVGILGKSLDTGAMLA
Ga0208147_103566343300025635AqueousAPGGQIEGVDFTASPFRMGRSLFNRCVGLLGPYLDTETLAQ
Ga0208161_101606313300025646AqueousRTSVGGQIEGIDFTVSPFRLGRSLFNKVSGILGKHIDQESIAL
Ga0208005_120081213300025848AqueousAPGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ
Ga0208783_1006467313300025872AqueousAPGGQIEGVDFTPSPYRMGRSLMNRVVGLLSPYLDTSTMAI
Ga0208644_118379433300025889AqueousGQIEGVDFAPSPFRLGRSLFNRVSGLLGPYLDVETMVQ
Ga0208916_1008237943300025896AqueousVSVEIFQSITAAGGQIEGVDFQPTPYRMGRGLLNRVIGILGKSLDQDAMLA
Ga0255155_103970713300026455FreshwaterEGIDFTNVSPYRLGRSLFNRVSGLLGPYIDTDSMVQ
Ga0255166_104049133300026473FreshwaterVEVFQSITAAGGQIEGVDFQVTPYRMGRSLLNRVVGILGKSLDVDAMVG
Ga0209850_100971513300026931SandEGVDFTATPFKMGRSLYNTCVGLLGSYIDPEGMCQ
Ga0255070_100832413300027133FreshwaterQIEGVDFTPSPYRMGRSLMNRVVGLLSPYLDTSTMAI
Ga0208923_105194833300027320EstuarineRLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPEGMCQ
Ga0255091_105226813300027487FreshwaterQSVVAPGGQIEGVDFQPSPYRMGRSLMNRVVGLLSPYLETGTMAI
Ga0208951_111532213300027621Freshwater LenticGGQIEGVDFTPSPFRMGRSLQNRVIGLLGNYVDVSTMAM
Ga0209356_116165133300027644Freshwater LakeRLAGGGQIEGVDFTSTPFRMGRSLFNKCVGILGSYIDTESMCQ
Ga0208975_115852513300027659Freshwater LenticVSVEVFQSRIAPGGQIEGVDFTQVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ
Ga0209769_110308933300027679Freshwater LakeVLAVSVEVFQSRIAPGGQIEGIDFTNVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ
Ga0209599_1015899913300027710Deep SubsurfaceIEGVDFTNVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ
Ga0209190_137772423300027736Freshwater LakeQSVTAPGGQIEGVDFAPTPFRMGRSLQNRVIGLISAFYDVDSICQ
Ga0209355_136733323300027744Freshwater LakeVSVEVFQSITAAGGQIEGVDFQVTPYRMGRSLLNRVIGILGKSLDTGAMLA
Ga0209296_121996633300027759Freshwater LakeGGQIEGVDFAPSPFRMGRSLFNRVSGLLGAYIDVKTMVG
Ga0209296_141445613300027759Freshwater LakeRLAGGGQIEGVDFTSTPFRMGRSLFNKCVGLLGSYIDIESMAQ
Ga0209134_1020367013300027764Freshwater LakeIAPGGQIEGVDFTTVSPYRLGRSLFNRVSGLLGPFIDTDSMVQ
Ga0209134_1034154713300027764Freshwater LakeLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDTESMAQ
Ga0209500_1004963663300027782Freshwater LakeIEGVDFSPSPFRMGRSLYNRCAGLLGSLIDVGTIAQ
Ga0209500_1011847013300027782Freshwater LakeIVVSVEVFQSINAAGGQIEGVDFQPTPYRMGRSLLNRVIGILGKSLDTGSMLA
Ga0209246_1035552423300027785Freshwater LakeLSSGGQIEGVDFTATPFKMGRSLYNTCVGLLGSYIDPEGMCQ
Ga0209972_1048897313300027793Freshwater LakeSRIAPGGQIEGIDFTNVSPYRLGRSLFNRVSGLLGPFIDTDSMVQ
Ga0209354_1042726113300027808Freshwater LakeEIFQSVVAPGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM
(restricted) Ga0247837_128584623300027970FreshwaterSAVLAVSVEVFQSRIAPGGQIEGVDFTQVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ
Ga0247723_115965713300028025Deep Subsurface SedimentEVFQSRIAPGGQIEGVDFTSVSPYRLGRSLFNRVSGLLGPFIDTDSMVQ
Ga0255172_104598913300028103FreshwaterQIEGVDFQVTPYRMGRSLLNRVVGILGKSLDVDAMVG
(restricted) Ga0247839_135298323300028553FreshwaterAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYMDVESMAQ
(restricted) Ga0247844_113276443300028571FreshwaterIEGIDFASTPFRMGRSLFNKCVGLLGSYMDTESMCQ
Ga0307379_1032316513300031565SoilGQIEGVDFASTPYRMGRSLTNRVSTLLMPYLDVETVCQ
Ga0315291_1106646313300031707SedimentAPGGQIEGVDFTPSPFRMGRSLQNRVIGLLGNYIDVSTMAM
Ga0315908_1143592113300031786FreshwaterEGVDFAPSPYRMGRSLFNRVVGLLGSYIDVETMAQ
Ga0315900_1102814913300031787FreshwaterQIEGIDFTPSPFRLGRSLFNRVSGLLGPYIDVETMVQ
Ga0315290_1137971633300031834SedimentIEGVDFQPSPYKMGRSLMNRVIGLISPYIDVETMAM
Ga0315909_1049851513300031857FreshwaterRTAAGGQIEGVDFSGTPYRMGRSLMNRVSSLLQPYLDVETIVQ
Ga0315909_1050634333300031857FreshwaterQSRIAPGGQIEGVDFTQVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ
Ga0315904_1038426743300031951FreshwaterSRIAAGGQIEGVDFTASPFRMGRSLFNRCVGLLGPYLDVESMAQ
Ga0315904_1050770543300031951FreshwaterGGQIEGVDFAPTPYRMGRSLVNRVQALLAPFIDVESLCQ
Ga0315904_1121757313300031951FreshwaterPGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ
Ga0315294_1085337633300031952SedimentGQIEGVDFTPSPYRMGRSLMNRVIGLISPYVDVETMAM
Ga0315901_1002969213300031963FreshwaterITAAGGQIEGIDFQPTPYRMGRSLLNRVIGILGKSLDTGAMLA
Ga0315284_1152253213300032053SedimentLSSGGQIEGVDFTSTPFKMGRSLYNTCVGLLGSYIDPESMCQ
Ga0315284_1249594523300032053SedimentSRVAPGGQIEGVDFSPSPFRMGRSLYNRISGLLGNLVDVDSIVG
Ga0315905_10022606123300032092FreshwaterFQSRTAAGGQIEGVDFTVTPFRLGRSLFNRVSGILGPYLDIETMIG
Ga0315902_1050528443300032093FreshwaterGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ
Ga0315903_1004040983300032116FreshwaterVEVFQSRIAPGGQIEGVDFTQVSPYRLGRSLFNRVSGLLGAFIDTDSMVQ
Ga0315903_1034485243300032116FreshwaterTAAGGQIEGVDFAPTPYRMGRSLVNRVQALLAPFIDVESLCQ
Ga0315268_1040278543300032173SedimentPGGQIEGVDFAPSPFRMGRSLYNRISGLLGNQVDVDSIVG
Ga0315273_1279641623300032516SedimentVFQSRVAGGGQIEGIDFTATPFRMGRSLFNRCVGLLGPYMDVESICQ
Ga0315273_1282612823300032516SedimentQSVVAAGGQIEGVDFTPSPYRMGRSLMNRVIGLISPYINVETMAM
Ga0334982_0083605_1580_17053300033981FreshwaterAGGGQIEGVDFSPTPFRMGRSLFNKCVGLLGSYMDTESMAL
Ga0334992_0118976_1265_13903300033992FreshwaterAAGGQIEGLDFASSPYRMGRSLQNRVIGLLGNYIDVEVMVG
Ga0335003_0410052_468_5783300033995FreshwaterIEGVDFQPSPFRMGRSLQNRVIGLLGNYVDVSTMAM
Ga0334987_0038973_3952_40623300034061FreshwaterIEGVDFTPSPFRMGRSLQNRVIGLLGNYIDVSTMAM
Ga0334987_0527730_605_7123300034061FreshwaterGVDFTQVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ
Ga0334995_0021425_2_1273300034062FreshwaterAPGGQIEGVDFSPSPYRMGRSLFNRVVGLLGPYIDVETMAQ
Ga0335019_0194178_1185_13163300034066FreshwaterTAAGGQIEGLDFQSSPYRMGRSLQNRVIGLLGNYIDVDVMIGG
Ga0335010_0268260_856_9963300034092FreshwaterFQSRVAAGGQIEGVDFASSPYRMGRSLTNRVSTLLMPYLDAETVVQ
Ga0335010_0408456_2_1693300034092FreshwaterVLAVSVEVFQSRIAPGGQIEGIDFTQVSPYRLGRSLFNRVSGLLGPFIDTDSMVQ
Ga0335012_0055569_1_1353300034093FreshwaterARLAGGGQIEGVDFTATPFRMGRSLYNKCVGLLGSYIDPEGMCQ
Ga0335027_0330752_1_1323300034101FreshwaterRLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYMDTESMAQ
Ga0335027_0577638_530_6883300034101FreshwaterVAVEVFQSRIAPGGQIEGVDFTSVSPYRLGRSLFNRVSGLLGQYLDVETMAQ
Ga0335029_0604569_468_6143300034102FreshwaterVFQSRIAPGGQIEGIDFTQVSPYRLGRSLFNRVSGLLGPFIDTDSMVQ
Ga0335029_0632620_442_5913300034102FreshwaterVEIFQSVVAPGGQIEGVDFTPSPFRMGRSLQNRVIGLIGNYVDVSTMAM
Ga0335029_0731917_2_1363300034102FreshwaterSVVAPGGQIEGVDFTPSPFRMGRSLQNRVIGLIGNYVDVSTMAM
Ga0335031_0714315_3_1553300034104FreshwaterSVEVFQSRTAPGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ
Ga0335036_0141863_1589_17173300034106FreshwaterTAAGGQIEGVDFTGTPYRMGRSLMNRVSSLLQPYLDVETIVQ
Ga0335036_0310812_2_1153300034106FreshwaterIEGVDFQSSPYRMGRSLQNRVIGLLGNYIDVDVMIGG
Ga0335036_0655474_2_1123300034106FreshwaterIEGVDFTATPFRMGRSLFNKCVGLLGSYMDTESMAQ
Ga0335036_0866687_388_5163300034106FreshwaterLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDTDSMAQ
Ga0335050_0359667_560_6673300034108FreshwaterEGVDFTPSPYRMGRSLFNRVVGLLGPYIDVETMAQ
Ga0335066_0589259_1_1323300034112FreshwaterRTAAGGQIEGVDFAPTPYRMGRSLVNRVQALLAPFIDVESLCQ
Ga0335054_0005547_7412_75403300034119FreshwaterTAPGGQIEGIDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ
Ga0335058_0049832_2328_24503300034121FreshwaterGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ
Ga0335060_0017603_4602_47303300034122FreshwaterTAAGGQIEGLDFQSSPYRMGRSLQNRVIGLLGNYIDVEVMVG
Ga0335017_0552819_483_6023300034167FreshwaterGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM
Ga0335065_0284232_929_10483300034200FreshwaterGQIEGIDFTNVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ
Ga0335007_0002492_14458_145683300034283FreshwaterIEGVDFAPSPFRMGRSLYNRISGLLGNQVDVDSIVG
Ga0335048_0154127_2_1273300034356FreshwaterAPGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM
Ga0335048_0588579_385_5163300034356FreshwaterVVAPGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.