Basic Information | |
---|---|
Family ID | F020512 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 223 |
Average Sequence Length | 42 residues |
Representative Sequence | APGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ |
Number of Associated Samples | 165 |
Number of Associated Scaffolds | 223 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.10 % |
% of genes from short scaffolds (< 2000 bps) | 91.03 % |
Associated GOLD sequencing projects | 154 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (56.502 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (17.937 % of family members) |
Environment Ontology (ENVO) | Unclassified (54.260 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.224 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.09% β-sheet: 0.00% Coil/Unstructured: 73.91% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 223 Family Scaffolds |
---|---|---|
PF01844 | HNH | 0.45 |
PF01391 | Collagen | 0.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.03 % |
Unclassified | root | N/A | 21.97 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001850|RCM37_1032983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4145 | Open in IMG/M |
3300002199|metazooDRAFT_1227040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300002387|B570J29608_1005231 | Not Available | 841 | Open in IMG/M |
3300002408|B570J29032_108933816 | Not Available | 544 | Open in IMG/M |
3300003394|JGI25907J50239_1121721 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 506 | Open in IMG/M |
3300003653|SLW02_105284 | Not Available | 902 | Open in IMG/M |
3300004282|Ga0066599_100861300 | Not Available | 644 | Open in IMG/M |
3300005527|Ga0068876_10649739 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 567 | Open in IMG/M |
3300005528|Ga0068872_10701997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300005581|Ga0049081_10062298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1404 | Open in IMG/M |
3300005582|Ga0049080_10089855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1048 | Open in IMG/M |
3300005584|Ga0049082_10072366 | Not Available | 1210 | Open in IMG/M |
3300005584|Ga0049082_10173299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300005662|Ga0078894_11097015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300005805|Ga0079957_1171410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
3300005805|Ga0079957_1295118 | Not Available | 732 | Open in IMG/M |
3300005955|Ga0073922_1010083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1095 | Open in IMG/M |
3300006029|Ga0075466_1163130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300006030|Ga0075470_10180363 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 610 | Open in IMG/M |
3300006037|Ga0075465_10101156 | Not Available | 639 | Open in IMG/M |
3300006802|Ga0070749_10175632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1235 | Open in IMG/M |
3300006802|Ga0070749_10239181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1031 | Open in IMG/M |
3300006802|Ga0070749_10516826 | Not Available | 649 | Open in IMG/M |
3300006805|Ga0075464_10114289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1562 | Open in IMG/M |
3300006805|Ga0075464_10443001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300006805|Ga0075464_10817891 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 580 | Open in IMG/M |
3300006805|Ga0075464_10904923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300006805|Ga0075464_10947460 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 539 | Open in IMG/M |
3300006805|Ga0075464_11019251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300006805|Ga0075464_11046985 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 513 | Open in IMG/M |
3300006805|Ga0075464_11070288 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 508 | Open in IMG/M |
3300006917|Ga0075472_10608668 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 547 | Open in IMG/M |
3300006920|Ga0070748_1173838 | Not Available | 794 | Open in IMG/M |
3300006920|Ga0070748_1221309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
3300006920|Ga0070748_1322117 | Not Available | 548 | Open in IMG/M |
3300007234|Ga0075460_10263251 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 572 | Open in IMG/M |
3300007234|Ga0075460_10311525 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 515 | Open in IMG/M |
3300007538|Ga0099851_1133712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
3300007538|Ga0099851_1285548 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 584 | Open in IMG/M |
3300007540|Ga0099847_1115263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300007542|Ga0099846_1071463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1297 | Open in IMG/M |
3300007708|Ga0102859_1067019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
3300008110|Ga0114343_1038168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1943 | Open in IMG/M |
3300008116|Ga0114350_1019586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2828 | Open in IMG/M |
3300008117|Ga0114351_1455254 | Not Available | 515 | Open in IMG/M |
3300008266|Ga0114363_1019153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3044 | Open in IMG/M |
3300008266|Ga0114363_1076398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1260 | Open in IMG/M |
3300008266|Ga0114363_1225944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
3300008339|Ga0114878_1114585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1019 | Open in IMG/M |
3300008448|Ga0114876_1091695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1233 | Open in IMG/M |
3300008448|Ga0114876_1214295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300008450|Ga0114880_1038508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2091 | Open in IMG/M |
3300008450|Ga0114880_1122435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
3300008450|Ga0114880_1195575 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 683 | Open in IMG/M |
3300008450|Ga0114880_1234492 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 586 | Open in IMG/M |
3300008450|Ga0114880_1240228 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 573 | Open in IMG/M |
3300008450|Ga0114880_1268784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300008510|Ga0110928_1060060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300009009|Ga0105105_10063447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1702 | Open in IMG/M |
3300009026|Ga0102829_1288405 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 545 | Open in IMG/M |
3300009037|Ga0105093_10269906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
3300009056|Ga0102860_1202083 | Not Available | 569 | Open in IMG/M |
3300009081|Ga0105098_10538344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300009082|Ga0105099_10102026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1575 | Open in IMG/M |
3300009082|Ga0105099_11077329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300009085|Ga0105103_10512501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300009085|Ga0105103_10799421 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 547 | Open in IMG/M |
3300009152|Ga0114980_10585183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300009155|Ga0114968_10636854 | Not Available | 562 | Open in IMG/M |
3300009158|Ga0114977_10757237 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 514 | Open in IMG/M |
3300009159|Ga0114978_10220719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1190 | Open in IMG/M |
3300009159|Ga0114978_10688852 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 584 | Open in IMG/M |
3300009161|Ga0114966_10093690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2031 | Open in IMG/M |
3300009161|Ga0114966_10498816 | Not Available | 694 | Open in IMG/M |
3300009165|Ga0105102_10200809 | Not Available | 996 | Open in IMG/M |
3300009165|Ga0105102_10480087 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 672 | Open in IMG/M |
3300009168|Ga0105104_10629257 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 612 | Open in IMG/M |
3300009179|Ga0115028_10655371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300009180|Ga0114979_10383615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
3300009180|Ga0114979_10715996 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 565 | Open in IMG/M |
3300009181|Ga0114969_10045225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2967 | Open in IMG/M |
3300009181|Ga0114969_10736036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300009183|Ga0114974_10730793 | Not Available | 536 | Open in IMG/M |
3300009184|Ga0114976_10633825 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 540 | Open in IMG/M |
3300009185|Ga0114971_10088904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1896 | Open in IMG/M |
3300009194|Ga0114983_1091746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300009194|Ga0114983_1095973 | Not Available | 656 | Open in IMG/M |
3300009419|Ga0114982_1149870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
3300009450|Ga0127391_1079665 | Not Available | 627 | Open in IMG/M |
3300009469|Ga0127401_1166231 | Not Available | 551 | Open in IMG/M |
3300010316|Ga0136655_1184424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300010370|Ga0129336_10537774 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 627 | Open in IMG/M |
3300010965|Ga0138308_181055 | Not Available | 1167 | Open in IMG/M |
3300012017|Ga0153801_1034491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
3300012667|Ga0157208_10010447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1310 | Open in IMG/M |
3300012708|Ga0157595_1002573 | Not Available | 578 | Open in IMG/M |
3300012709|Ga0157608_1015108 | All Organisms → Viruses → Predicted Viral | 1999 | Open in IMG/M |
3300012726|Ga0157597_1077338 | Not Available | 1315 | Open in IMG/M |
3300012733|Ga0157606_1073636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1442 | Open in IMG/M |
3300012759|Ga0157626_1066136 | Not Available | 1506 | Open in IMG/M |
3300013004|Ga0164293_10299657 | Not Available | 1115 | Open in IMG/M |
3300013372|Ga0177922_10088178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300014811|Ga0119960_1056547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300014811|Ga0119960_1074639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300014811|Ga0119960_1079939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300015360|Ga0163144_11256815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
3300017723|Ga0181362_1067250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300017736|Ga0181365_1041955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1149 | Open in IMG/M |
3300017736|Ga0181365_1159347 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 532 | Open in IMG/M |
3300017766|Ga0181343_1196865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300017766|Ga0181343_1226836 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 508 | Open in IMG/M |
3300017774|Ga0181358_1240193 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 574 | Open in IMG/M |
3300017774|Ga0181358_1271691 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 526 | Open in IMG/M |
3300017780|Ga0181346_1128738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
3300017780|Ga0181346_1303758 | Not Available | 541 | Open in IMG/M |
3300017784|Ga0181348_1136550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
3300017785|Ga0181355_1201577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
3300017987|Ga0180431_11165369 | Not Available | 501 | Open in IMG/M |
3300019784|Ga0181359_1018340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2622 | Open in IMG/M |
3300019784|Ga0181359_1110056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
3300020160|Ga0211733_10651002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300020205|Ga0211731_10730554 | All Organisms → Viruses → Predicted Viral | 1489 | Open in IMG/M |
3300020506|Ga0208091_1007033 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
3300020549|Ga0207942_1026612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300020550|Ga0208600_1047735 | Not Available | 645 | Open in IMG/M |
3300020554|Ga0208599_1012392 | Not Available | 1436 | Open in IMG/M |
3300020554|Ga0208599_1033448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
3300020566|Ga0208222_1049546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
3300020596|Ga0163149_10472447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300021093|Ga0194123_10240229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
3300021438|Ga0213920_1074064 | Not Available | 670 | Open in IMG/M |
3300021963|Ga0222712_10790555 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 524 | Open in IMG/M |
3300022190|Ga0181354_1126270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300022190|Ga0181354_1249443 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 506 | Open in IMG/M |
3300022407|Ga0181351_1076525 | Not Available | 1343 | Open in IMG/M |
3300022748|Ga0228702_1036863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1418 | Open in IMG/M |
3300023174|Ga0214921_10012420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10182 | Open in IMG/M |
3300024239|Ga0247724_1076616 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 514 | Open in IMG/M |
3300024496|Ga0255151_1074209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300025635|Ga0208147_1035663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1303 | Open in IMG/M |
3300025646|Ga0208161_1016063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2926 | Open in IMG/M |
3300025848|Ga0208005_1200812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300025872|Ga0208783_10064673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1649 | Open in IMG/M |
3300025889|Ga0208644_1183794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 924 | Open in IMG/M |
3300025896|Ga0208916_10082379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1349 | Open in IMG/M |
3300026455|Ga0255155_1039707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300026473|Ga0255166_1040491 | Not Available | 942 | Open in IMG/M |
3300026931|Ga0209850_1009715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
3300027133|Ga0255070_1008324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1875 | Open in IMG/M |
3300027320|Ga0208923_1051948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300027487|Ga0255091_1052268 | Not Available | 632 | Open in IMG/M |
3300027621|Ga0208951_1115322 | Not Available | 723 | Open in IMG/M |
3300027644|Ga0209356_1161651 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 621 | Open in IMG/M |
3300027659|Ga0208975_1158525 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 628 | Open in IMG/M |
3300027679|Ga0209769_1103089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
3300027710|Ga0209599_10158999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300027736|Ga0209190_1377724 | Not Available | 516 | Open in IMG/M |
3300027744|Ga0209355_1367333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300027759|Ga0209296_1219966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
3300027759|Ga0209296_1414456 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 501 | Open in IMG/M |
3300027764|Ga0209134_10203670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300027764|Ga0209134_10341547 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 506 | Open in IMG/M |
3300027782|Ga0209500_10049636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2247 | Open in IMG/M |
3300027782|Ga0209500_10118470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1286 | Open in IMG/M |
3300027785|Ga0209246_10355524 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 556 | Open in IMG/M |
3300027793|Ga0209972_10488973 | Not Available | 507 | Open in IMG/M |
3300027808|Ga0209354_10427261 | Not Available | 512 | Open in IMG/M |
(restricted) 3300027970|Ga0247837_1285846 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 629 | Open in IMG/M |
3300028025|Ga0247723_1159657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300028103|Ga0255172_1045989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
(restricted) 3300028553|Ga0247839_1352983 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 534 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1132764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1053 | Open in IMG/M |
3300031565|Ga0307379_10323165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1512 | Open in IMG/M |
3300031707|Ga0315291_11066463 | Not Available | 673 | Open in IMG/M |
3300031786|Ga0315908_11435921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300031787|Ga0315900_11028149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300031834|Ga0315290_11379716 | Not Available | 577 | Open in IMG/M |
3300031857|Ga0315909_10498515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
3300031857|Ga0315909_10506343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
3300031951|Ga0315904_10384267 | Not Available | 1278 | Open in IMG/M |
3300031951|Ga0315904_10507705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
3300031951|Ga0315904_11217573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300031952|Ga0315294_10853376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
3300031963|Ga0315901_10029692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5606 | Open in IMG/M |
3300032053|Ga0315284_11522532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300032053|Ga0315284_12495945 | Not Available | 504 | Open in IMG/M |
3300032093|Ga0315902_10505284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
3300032116|Ga0315903_10040409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4861 | Open in IMG/M |
3300032116|Ga0315903_10344852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1236 | Open in IMG/M |
3300032173|Ga0315268_10402785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1339 | Open in IMG/M |
3300032516|Ga0315273_12796416 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 553 | Open in IMG/M |
3300032516|Ga0315273_12826128 | Not Available | 549 | Open in IMG/M |
3300033981|Ga0334982_0083605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1706 | Open in IMG/M |
3300033992|Ga0334992_0118976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1391 | Open in IMG/M |
3300033995|Ga0335003_0410052 | Not Available | 578 | Open in IMG/M |
3300034061|Ga0334987_0038973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4063 | Open in IMG/M |
3300034061|Ga0334987_0527730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300034062|Ga0334995_0021425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5743 | Open in IMG/M |
3300034066|Ga0335019_0194178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1317 | Open in IMG/M |
3300034092|Ga0335010_0268260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
3300034092|Ga0335010_0408456 | Not Available | 740 | Open in IMG/M |
3300034093|Ga0335012_0055569 | All Organisms → Viruses → Predicted Viral | 2281 | Open in IMG/M |
3300034101|Ga0335027_0330752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1015 | Open in IMG/M |
3300034101|Ga0335027_0577638 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 689 | Open in IMG/M |
3300034102|Ga0335029_0604569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300034102|Ga0335029_0632620 | Not Available | 593 | Open in IMG/M |
3300034102|Ga0335029_0731917 | Not Available | 531 | Open in IMG/M |
3300034104|Ga0335031_0714315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300034106|Ga0335036_0141863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1719 | Open in IMG/M |
3300034106|Ga0335036_0310812 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
3300034106|Ga0335036_0655474 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 628 | Open in IMG/M |
3300034106|Ga0335036_0866687 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 516 | Open in IMG/M |
3300034108|Ga0335050_0359667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300034112|Ga0335066_0589259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300034119|Ga0335054_0005547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7542 | Open in IMG/M |
3300034121|Ga0335058_0049832 | All Organisms → Viruses → Predicted Viral | 2450 | Open in IMG/M |
3300034122|Ga0335060_0017603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4732 | Open in IMG/M |
3300034167|Ga0335017_0552819 | Not Available | 602 | Open in IMG/M |
3300034200|Ga0335065_0284232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
3300034283|Ga0335007_0002492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14568 | Open in IMG/M |
3300034356|Ga0335048_0154127 | Not Available | 1313 | Open in IMG/M |
3300034356|Ga0335048_0588579 | Not Available | 517 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.94% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.45% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.56% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.52% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.38% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.48% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.48% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.59% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.69% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.69% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.69% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.69% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.79% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.79% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.79% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 1.35% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.90% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.90% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.90% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.90% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.90% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.90% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.90% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.90% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.45% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.45% |
Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.45% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.45% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.45% |
Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.45% |
Subglacial Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater | 0.45% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.45% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.45% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.45% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.45% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300002199 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUN 2013 | Environmental | Open in IMG/M |
3300002387 | Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003653 | Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 0.2 micron filter | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008510 | Microbial Communities in Water bodies, Singapore - Site RA | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300012708 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012709 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012759 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020596 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1 | Environmental | Open in IMG/M |
3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
3300026931 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027487 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
RCM37_10329831 | 3300001850 | Marine Plankton | IAPGGTIESVDFAPASPFRLGRSLMNRVTGLLGPYLDVEAMIG* |
metazooDRAFT_12270402 | 3300002199 | Lake | FQSRTAAGGQIEGVDFAVTPFRLGRSLFNRISGILGPYIDVETMVG* |
B570J29608_10052311 | 3300002387 | Freshwater | QSRTAAGGQIEGVDFAPTPYRMGRSLVNRVQALLAPFIDVESLCQ* |
B570J29032_1089338162 | 3300002408 | Freshwater | SVVAPGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM* |
JGI25907J50239_11217212 | 3300003394 | Freshwater Lake | ARLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ* |
SLW02_1052841 | 3300003653 | Subglacial Freshwater | GGQIEGVDFSPQPFQMGRSLLNRVIGLLGSYVDVSTMAQ* |
Ga0066599_1008613002 | 3300004282 | Freshwater | EQAVMSVAVEIFSSKTSPGGSMEGVDYTVVSPFRLGRSLFNRVSGLLGSYIDTESIAQ* |
Ga0068876_106497392 | 3300005527 | Freshwater Lake | RSAVGGQIEGVDFQVTPFRLGRSLFNRVSGLLGRHIDQESIAL* |
Ga0068872_107019971 | 3300005528 | Freshwater Lake | AVSVEVFQSRIAPGGQIEGIDFTNVSPYRLGRSLFNRVSGLLGPFIDTDSMVQ* |
Ga0049081_100622981 | 3300005581 | Freshwater Lentic | GQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDTESMAQ* |
Ga0049080_100898551 | 3300005582 | Freshwater Lentic | GQIEGVDFTATPFRMGRSLFNKCVGILGSYIDTESMCQ* |
Ga0049082_100723661 | 3300005584 | Freshwater Lentic | GQIEGVDFTPSPYRMGRSLQNRVIGLLGNYVDVSTMAM* |
Ga0049082_101732993 | 3300005584 | Freshwater Lentic | VSVEVFQSITAAGGQIEGVDFQVTPYRMGRSLLNRVIGILGKSLDTGAMLA* |
Ga0078894_110970153 | 3300005662 | Freshwater Lake | GGQIEGVDFTATPFRMGRSLFNKCVGLLGAYMDTETMAQ* |
Ga0079957_11714102 | 3300005805 | Lake | LVEVFQSITAAGGQIEGVDFQVTPYRMGRSLLNRVIGILGKSLDTGAMLA* |
Ga0079957_12951181 | 3300005805 | Lake | APGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM* |
Ga0073922_10100834 | 3300005955 | Sand | EGVDFTATPFKMGRSLYNTCVGLLGSYIDPEGMCQ* |
Ga0075466_11631301 | 3300006029 | Aqueous | GQIEGLDFASSPYRMGRSLQNRVIGLLGNYIDVEVMVG* |
Ga0075470_101803633 | 3300006030 | Aqueous | SRVAPGGQIEGVDFTASPFRMGRSLFNRCVGLLGPYLDTETLAQ* |
Ga0075465_101011563 | 3300006037 | Aqueous | TAPGGQIEGVDFQPSPFRMGRSLQNRVIGLLGNFVDVEIMAQ* |
Ga0070749_101756321 | 3300006802 | Aqueous | TEIFQSRTAAGGQIEGVDFAVTPFRLGRSLFNRISGILGPYLDVETMVG* |
Ga0070749_102391813 | 3300006802 | Aqueous | AAGGQIEGVDFTPTPYRMGRSLASRVYSLIAKYVEVGSIAQ* |
Ga0070749_105168263 | 3300006802 | Aqueous | APGGQIEGVDFQPTPFRMGRSLWNKCSGLLGALVDVDTIAQ* |
Ga0075464_101142895 | 3300006805 | Aqueous | GQIEGVDFSPTPYRMGRSLFNRVSGLLGSVIDVESIAQ* |
Ga0075464_104430011 | 3300006805 | Aqueous | ITAPGGQIEGVDFAPTPFRMGRSLYNRVSGLLGAYVDVESIAQ* |
Ga0075464_108178911 | 3300006805 | Aqueous | QIEGVDFSPTPFRMGRSLFNKCVGLLGSYMDTEGLAQ* |
Ga0075464_109049232 | 3300006805 | Aqueous | PGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ* |
Ga0075464_109474601 | 3300006805 | Aqueous | QSRIAPGGQIEGIDFTNVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ* |
Ga0075464_110192512 | 3300006805 | Aqueous | EGVDFTATPYRMGRSLTNRVSTLLMPYLDVETVVQ* |
Ga0075464_110469852 | 3300006805 | Aqueous | SVEVFQSRIAPGGQIEGIDFTQVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ* |
Ga0075464_110702882 | 3300006805 | Aqueous | QSRTAAGGQIEGVDFAVTPFRLGRSLFNRVVGLLGPYIDTESMIG* |
Ga0075472_106086681 | 3300006917 | Aqueous | ARLAGGGQIEGVDFSPTPFRMGRSLFNKCVGLLGSYMDTESLAQ* |
Ga0070748_11738383 | 3300006920 | Aqueous | FQSVVAPGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM* |
Ga0070748_12213091 | 3300006920 | Aqueous | EIFQSITAAGGQIEGVDFQPTPYRMGRGLLNRVIGILGKSLDQDAMLA* |
Ga0070748_13221171 | 3300006920 | Aqueous | SVTAPGGQIEGVDFAPTPFRMGRSLQNRVIGLISAFYDVDSICQ* |
Ga0075460_102632512 | 3300007234 | Aqueous | GVDFAVTPFRLGRSLFNRVSGLLGSYLDVESMVG* |
Ga0075460_103115251 | 3300007234 | Aqueous | EVFQSRIAPGGQIEGIDFTSVSPYRLGRSLFNRVSGLLGAYIDTGSMVQ* |
Ga0099851_11337123 | 3300007538 | Aqueous | QSRTAPGGQIEGLDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ* |
Ga0099851_12855481 | 3300007538 | Aqueous | NIEGVDFAVTPFRLGRSLFNRISGILGSYIDVESMVG* |
Ga0099847_11152631 | 3300007540 | Aqueous | SVEVFQSRIAPGGQIEGIDFTQVSPYRLGRSLFNRVSGILGAFIDTDSMVQ* |
Ga0099846_10714631 | 3300007542 | Aqueous | TAAGGQIEGVDFAPTPYRMGKSLTSRVTGLLAPFIDTGTICQ* |
Ga0102859_10670193 | 3300007708 | Estuarine | VVAPGGQIEGVDFTPSPFRMGRSLQNRVIGLLGNYIDVSTMAM* |
Ga0114343_10381681 | 3300008110 | Freshwater, Plankton | EVFQSRIAPGGQIEGIDFTNVSPYRLGRSLFNRVSGLLGPYIDTDSMVQ* |
Ga0114350_10195861 | 3300008116 | Freshwater, Plankton | RVAPGGQMEGIDFTNVSPYRLGRSLFNRVSGLLGAYLDVETMAQ* |
Ga0114351_14552541 | 3300008117 | Freshwater, Plankton | AVGGQIEGADFQVTPFRLRRSLFNRISGLLGKHIDSESIAL* |
Ga0114363_10191536 | 3300008266 | Freshwater, Plankton | QSRTAPGGQIEGVDFAPSPYRMGRSLFNRVVGLLGSYIDVETMAQ* |
Ga0114363_10763981 | 3300008266 | Freshwater, Plankton | GVDFTTVSPYRLGRSLFNRVSGLLGAFIDTDSMVQ* |
Ga0114363_12259442 | 3300008266 | Freshwater, Plankton | EGVDFAPTPYRMGRSLVNRVQALLAPFIDVESLCQ* |
Ga0114878_11145851 | 3300008339 | Freshwater Lake | GQIEGVDFASSPYRMGRSLTNRVSTLLMPYLDAETVVQ* |
Ga0114876_10916951 | 3300008448 | Freshwater Lake | APGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ* |
Ga0114876_12142951 | 3300008448 | Freshwater Lake | LAVSVEVFQSRIAPGGQIEGVDFTQVSPYRLGRSLFNRVSGLLGPYIDTDSMVQ* |
Ga0114880_10385086 | 3300008450 | Freshwater Lake | TAAGGQIEGVDFAVTPFRLGRSLFNRVVGLLGPYIDTESMIG* |
Ga0114880_11224353 | 3300008450 | Freshwater Lake | GQIEGIDFTSVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ* |
Ga0114880_11955751 | 3300008450 | Freshwater Lake | QSRIAPGGQIEGVDFTTVSPYRLGRSLFNRVSGLLGAFIDTDSMVQ* |
Ga0114880_12344921 | 3300008450 | Freshwater Lake | EGVDFSPTPFRMGRSLFNKCVGLLGSYMDTEGMAQ* |
Ga0114880_12402281 | 3300008450 | Freshwater Lake | EGVDFTVSPFRLGRSLFNRISGILGPYIDTETMIG* |
Ga0114880_12687842 | 3300008450 | Freshwater Lake | TAAGGQIEGVDFTVSPFRLGRSLFNRISGILGPYIDTETMIG* |
Ga0110928_10600601 | 3300008510 | Water Bodies | AAGGQIEGIDFTVSPYRLGRSLFNRISGLLGPYIDTETMVG* |
Ga0105105_100634475 | 3300009009 | Freshwater Sediment | GGQIEGIDFASSPYRMGRSLLNRVVGLLGNYIDVDTMVG* |
Ga0102829_12884051 | 3300009026 | Estuarine | VAGGGQIEGIDFTATPFRMGRSLFNRCVGLLGPYMDVESICQ* |
Ga0105093_102699063 | 3300009037 | Freshwater Sediment | AAGGQIEGIDFASSPYRMGRSLLNRVVGLLGNYIDVDTMVG* |
Ga0102860_12020832 | 3300009056 | Estuarine | IEGVDFQPSPYRMGRSLQNRVIGLLGNYIDVSTMAM* |
Ga0105098_105383441 | 3300009081 | Freshwater Sediment | VDFTTVSPYRLGRSLFNRVSGLLGAFIDTDSMVQ* |
Ga0105099_101020261 | 3300009082 | Freshwater Sediment | GQIEGIDFASSPYRMGRSLLNRVVGLLGNYIDVDTMVG* |
Ga0105099_110773291 | 3300009082 | Freshwater Sediment | EVFQSRTAAGGQIEGLDFASSSYRMGRSLLNRVVGLLGNYIDVDTMVQ* |
Ga0105103_105125013 | 3300009085 | Freshwater Sediment | QIEGIDFTNVSPYRLGRSLFNRVSGLLGPYIDTDSMVQ* |
Ga0105103_107994211 | 3300009085 | Freshwater Sediment | VAVEVFQSRIAPGGQIEGIDFTTVSPYRLGRSLFNRVSGLLGQYLDVETMAQ* |
Ga0114980_105851831 | 3300009152 | Freshwater Lake | IEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ* |
Ga0114968_106368541 | 3300009155 | Freshwater Lake | FQSVVAAGGQIEGVDFTPSPFRMGRSLNNRVIGLLGSYIDVETMAM* |
Ga0114977_107572371 | 3300009158 | Freshwater Lake | QARLAGGGQIEGVDFTATPFRMGRSLFNKCVGILGSYIDTESMCQ* |
Ga0114978_102207191 | 3300009159 | Freshwater Lake | TAAGGQIEGVDFSPSPFRMGRSLYNRCVGLLGSLVDVGTIAQ* |
Ga0114978_106888521 | 3300009159 | Freshwater Lake | GGQIEGVDFSPSPYRMGRSLFNRCVGLLGPYVDVETMAQ* |
Ga0114966_100936906 | 3300009161 | Freshwater Lake | SLEVFQSRVAGGGQIEGIDFTATPFRMGRSLFNRCVGLLGPYMDVESICQ* |
Ga0114966_104988161 | 3300009161 | Freshwater Lake | IFQSVVAPGGQIEGVDFQPSPYKMGRSLMNRVIGLISPYIDVETMAM* |
Ga0105102_102008093 | 3300009165 | Freshwater Sediment | SVYVFQARLAGSGQIEGVDFTSTPFRMGRSLFNKTVGLLGSYMDTEGICQ* |
Ga0105102_104800871 | 3300009165 | Freshwater Sediment | EVFQSRVAPGGQIEGVDFTPTPYRMGRSLFNRCVGLLGPYIDVESIVQ* |
Ga0105104_106292571 | 3300009168 | Freshwater Sediment | IEGVDFTSTPFRMGRSLFNKCVGLLGSYMDTGSMAQ* |
Ga0115028_106553713 | 3300009179 | Wetland | QIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ* |
Ga0114979_103836151 | 3300009180 | Freshwater Lake | EIFQSVVAPGGQIEGVDFQPSPYRMGRSLQNRVIGLLGNYIDVSTMAM* |
Ga0114979_107159961 | 3300009180 | Freshwater Lake | GGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPEGMCQ* |
Ga0114969_100452256 | 3300009181 | Freshwater Lake | EIFQSITAAGGQIEGVDFQPSPFRMGRSLQNRVVGLLSPFLDVETICQ* |
Ga0114969_107360361 | 3300009181 | Freshwater Lake | TAPGGQIEGVDFSPSPFRMGRSLYNRVSGLLGSLVDVGSIAQ* |
Ga0114974_107307931 | 3300009183 | Freshwater Lake | VEVFTSRNQAGGQMEGVDFSNVSPYRLGRSLFNRVSGLLGSYIDVESIAQ* |
Ga0114976_106338252 | 3300009184 | Freshwater Lake | VEVFQSRVAAGGQIEGVDFSPSPYRMGRSLFNRCVGLLGSYIDTESMAQ* |
Ga0114971_100889041 | 3300009185 | Freshwater Lake | IFQSVTAAGGQIEGVDFTPSPYRMGRSLQNRVIGLIGNYVDVETMAQ* |
Ga0114983_10917461 | 3300009194 | Deep Subsurface | PGGQIEGIDFTNVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ* |
Ga0114983_10959731 | 3300009194 | Deep Subsurface | IFQSVVAPGGQIEGVDFTPSPFRMGRSLQNRVIGLLGNYIDVSTMAM* |
Ga0114982_11498701 | 3300009419 | Deep Subsurface | EGVDFTNVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ* |
Ga0127391_10796651 | 3300009450 | Meromictic Pond | GQIEGVDFTPTPYRMGRSLFNRCVGLLGPYIDVESIVQ* |
Ga0127401_11662311 | 3300009469 | Meromictic Pond | QSRVAPGGQIEGVDFTPTPYRMGRSLFNRCVGLLGPYIDVESIVQ* |
Ga0136655_11844241 | 3300010316 | Freshwater To Marine Saline Gradient | GVDFTATPFKMGRSLFNRCVGLLGAYLDVESMAQ* |
Ga0129336_105377741 | 3300010370 | Freshwater To Marine Saline Gradient | QSRTAAGGQIEGVDFAVTPFRLGRSLFNRVVGLLGPYIDTETMIG* |
Ga0138308_1810551 | 3300010965 | Lake Chemocline | GQIEGVDFQPSPFRMGRSLQNRVIGLLGNYIDVSTMAM* |
Ga0153801_10344913 | 3300012017 | Freshwater | QIEGVDFTPSPYRMGRSLMNRVIGLLSPYIDVETMAM* |
Ga0157208_100104471 | 3300012667 | Freshwater | VAPGGQMEGIDFTNVSPYRLGRSLFNRVSGLLGAYLDVETMAQ* |
Ga0157595_10025732 | 3300012708 | Freshwater | GGQIEGVDFAPTPYRMGRSLQNRVIGLISAFYDVDSICQ* |
Ga0157608_10151081 | 3300012709 | Freshwater | QIEGVDFASSPYRMGRSLLNRVIGLLGNYIDVDTMVG* |
Ga0157597_10773381 | 3300012726 | Freshwater | EGVDFTATPFRMGRSLFNRCVGLLGPFIDVESMAQ* |
Ga0157606_10736361 | 3300012733 | Freshwater | QIEGIDMAVSPYRMGRSLTNRVSTLLMPYLDAETVVQ* |
Ga0157626_10661361 | 3300012759 | Freshwater | QIEGVDFTASPYRMGRSLFNRCVGLLGAYLDVESMAQ* |
Ga0164293_102996574 | 3300013004 | Freshwater | GVDFQISPYALGRSLFNRVSGMLGGLLDVETMIG* |
Ga0177922_100881781 | 3300013372 | Freshwater | IEGVDFASSPYRMGRSLTNRVSTLLMPYLDAETVVQ* |
Ga0119960_10565473 | 3300014811 | Aquatic | FPVTITRGGQIEGVDFAPSPYRMGRSLYNRVAGLLGAYVDVESIAQ* |
Ga0119960_10746391 | 3300014811 | Aquatic | FPSHDQSTAAGGQIEGVDFTGTPYRMGRSLLNRVSSLLQPYIDVETIVQ* |
Ga0119960_10799391 | 3300014811 | Aquatic | FPSHDLEDVDFAPTPFRMGRSLYNRVSGLLGAYVDVESIAQ* |
Ga0163144_112568151 | 3300015360 | Freshwater Microbial Mat | AGGQIEGVDFASSPYRMGRSLTNRVSTLLMPFLDVETMVQ* |
Ga0181362_10672501 | 3300017723 | Freshwater Lake | SGGQIEGVDFAVTPFKMGRSLFNTCVGLLGSYMDTESMCQ |
Ga0181365_10419554 | 3300017736 | Freshwater Lake | GQIEGVDFAVTPFKMGRSLFNTCVGLLGSYMDTESMCQ |
Ga0181365_11593471 | 3300017736 | Freshwater Lake | VFQARLAGGGQIEGIDFTATPFRMGRSLFNRCVGLLGPYMDVESICQ |
Ga0181343_11968651 | 3300017766 | Freshwater Lake | EVFQSRTAPGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ |
Ga0181343_12268361 | 3300017766 | Freshwater Lake | EGVDFTASPFRMGRSLFNRCVGLLGPYLDVESMCQ |
Ga0181358_12401931 | 3300017774 | Freshwater Lake | AGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ |
Ga0181358_12716912 | 3300017774 | Freshwater Lake | ARLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ |
Ga0181346_11287381 | 3300017780 | Freshwater Lake | SVVAPGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM |
Ga0181346_13037581 | 3300017780 | Freshwater Lake | QSVVAPGGQIEGVDFTPSPYRMGRSLMNRVMGLLSPYIDVSTMAM |
Ga0181348_11365501 | 3300017784 | Freshwater Lake | PGGQIEGVDFTPSPFRMGRSLQNRVIGLLGNYVDVSTMAM |
Ga0181355_12015773 | 3300017785 | Freshwater Lake | EGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM |
Ga0180431_111653692 | 3300017987 | Hypersaline Lake Sediment | VDVFQSRVAPGGQTEAIDFTPGPYRMGRSLMTRVSGLLGRYLDTSMLAR |
Ga0181359_10183406 | 3300019784 | Freshwater Lake | SGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ |
Ga0181359_11100563 | 3300019784 | Freshwater Lake | VFQSRTAAGGQIEGVDFQPTPFKMGRSLLNRCIGLLGELLDVEALAQ |
Ga0211733_106510023 | 3300020160 | Freshwater | SRTAAGGQIEGVDFGATPYRMGRSLLNRVIGLLGNYIDVETMVG |
Ga0211731_107305541 | 3300020205 | Freshwater | GGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDTESMAQ |
Ga0208091_10070331 | 3300020506 | Freshwater | EVFQSRTAAGGQIEGLDFASTPFRMGRSLLNRVVGLLGNYIDVETMVG |
Ga0207942_10266121 | 3300020549 | Freshwater | SRIAPGGQIEGVDFTNVSPYRLGRSLFNRVSGLLGPYIDTDSMVQ |
Ga0208600_10477353 | 3300020550 | Freshwater | QIEGVDFAPSPFRMGRSLQNRVIGLLGNYIDVSTMAM |
Ga0208599_10123921 | 3300020554 | Freshwater | AGGGQIEGVDFSPTPFRMGRSLFNKCVGLLGSYMDTEGMAQ |
Ga0208599_10334483 | 3300020554 | Freshwater | LAGGGQIEGVDFTATPFRMGRSLFNKCVGILGSYIDTESMCQ |
Ga0208222_10495461 | 3300020566 | Freshwater | IEGVDFQPTPFRMGRSLFNKCVGLLGSYMDTESMAQ |
Ga0163149_104724473 | 3300020596 | Freshwater Microbial Mat | QIEGVDFASSPYRMGRSLTNRVSTLLMPFLDVETMVQ |
Ga0194123_102402291 | 3300021093 | Freshwater Lake | RVAAGGQIEGVDFTATPFRMGRSLFNRCVGILGAYLDVESMCQ |
Ga0213920_10740641 | 3300021438 | Freshwater | AGGQIEGVDFAPTPFRMGRSLLNRVIGLISPFIDVETIAQ |
Ga0222712_107905551 | 3300021963 | Estuarine Water | AAGGQIEGVDFTATPFRMGRSLFNRCVGLLGPYLDVESMAQ |
Ga0181354_11262701 | 3300022190 | Freshwater Lake | RLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ |
Ga0181354_12494432 | 3300022190 | Freshwater Lake | QARLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ |
Ga0181351_10765251 | 3300022407 | Freshwater Lake | VEGVDFTPSPFRMGRSLQNRVIGLLGNYVDVSTMAM |
Ga0228702_10368635 | 3300022748 | Freshwater | TSAGGQLEGVDFNTVSPYRLGRGLFNRVVGLLGKYLDVESLAQ |
Ga0214921_1001242022 | 3300023174 | Freshwater | IEGVDFAPTPFRMGRSLYNRVSGLLGSLVDVGSIAQ |
Ga0247724_10766162 | 3300024239 | Deep Subsurface Sediment | EGVDFAVTPFRLGRSLFNRVAGLLGPYIDTETMIG |
Ga0255151_10742091 | 3300024496 | Freshwater | VSVEIFQSITAAGGQIEGVDFQPTPYRIGRSLLNRVVGILGKSLDTGAMLA |
Ga0208147_10356634 | 3300025635 | Aqueous | APGGQIEGVDFTASPFRMGRSLFNRCVGLLGPYLDTETLAQ |
Ga0208161_10160631 | 3300025646 | Aqueous | RTSVGGQIEGIDFTVSPFRLGRSLFNKVSGILGKHIDQESIAL |
Ga0208005_12008121 | 3300025848 | Aqueous | APGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ |
Ga0208783_100646731 | 3300025872 | Aqueous | APGGQIEGVDFTPSPYRMGRSLMNRVVGLLSPYLDTSTMAI |
Ga0208644_11837943 | 3300025889 | Aqueous | GQIEGVDFAPSPFRLGRSLFNRVSGLLGPYLDVETMVQ |
Ga0208916_100823794 | 3300025896 | Aqueous | VSVEIFQSITAAGGQIEGVDFQPTPYRMGRGLLNRVIGILGKSLDQDAMLA |
Ga0255155_10397071 | 3300026455 | Freshwater | EGIDFTNVSPYRLGRSLFNRVSGLLGPYIDTDSMVQ |
Ga0255166_10404913 | 3300026473 | Freshwater | VEVFQSITAAGGQIEGVDFQVTPYRMGRSLLNRVVGILGKSLDVDAMVG |
Ga0209850_10097151 | 3300026931 | Sand | EGVDFTATPFKMGRSLYNTCVGLLGSYIDPEGMCQ |
Ga0255070_10083241 | 3300027133 | Freshwater | QIEGVDFTPSPYRMGRSLMNRVVGLLSPYLDTSTMAI |
Ga0208923_10519483 | 3300027320 | Estuarine | RLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPEGMCQ |
Ga0255091_10522681 | 3300027487 | Freshwater | QSVVAPGGQIEGVDFQPSPYRMGRSLMNRVVGLLSPYLETGTMAI |
Ga0208951_11153221 | 3300027621 | Freshwater Lentic | GGQIEGVDFTPSPFRMGRSLQNRVIGLLGNYVDVSTMAM |
Ga0209356_11616513 | 3300027644 | Freshwater Lake | RLAGGGQIEGVDFTSTPFRMGRSLFNKCVGILGSYIDTESMCQ |
Ga0208975_11585251 | 3300027659 | Freshwater Lentic | VSVEVFQSRIAPGGQIEGVDFTQVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ |
Ga0209769_11030893 | 3300027679 | Freshwater Lake | VLAVSVEVFQSRIAPGGQIEGIDFTNVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ |
Ga0209599_101589991 | 3300027710 | Deep Subsurface | IEGVDFTNVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ |
Ga0209190_13777242 | 3300027736 | Freshwater Lake | QSVTAPGGQIEGVDFAPTPFRMGRSLQNRVIGLISAFYDVDSICQ |
Ga0209355_13673332 | 3300027744 | Freshwater Lake | VSVEVFQSITAAGGQIEGVDFQVTPYRMGRSLLNRVIGILGKSLDTGAMLA |
Ga0209296_12199663 | 3300027759 | Freshwater Lake | GGQIEGVDFAPSPFRMGRSLFNRVSGLLGAYIDVKTMVG |
Ga0209296_14144561 | 3300027759 | Freshwater Lake | RLAGGGQIEGVDFTSTPFRMGRSLFNKCVGLLGSYIDIESMAQ |
Ga0209134_102036701 | 3300027764 | Freshwater Lake | IAPGGQIEGVDFTTVSPYRLGRSLFNRVSGLLGPFIDTDSMVQ |
Ga0209134_103415471 | 3300027764 | Freshwater Lake | LAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDTESMAQ |
Ga0209500_100496366 | 3300027782 | Freshwater Lake | IEGVDFSPSPFRMGRSLYNRCAGLLGSLIDVGTIAQ |
Ga0209500_101184701 | 3300027782 | Freshwater Lake | IVVSVEVFQSINAAGGQIEGVDFQPTPYRMGRSLLNRVIGILGKSLDTGSMLA |
Ga0209246_103555242 | 3300027785 | Freshwater Lake | LSSGGQIEGVDFTATPFKMGRSLYNTCVGLLGSYIDPEGMCQ |
Ga0209972_104889731 | 3300027793 | Freshwater Lake | SRIAPGGQIEGIDFTNVSPYRLGRSLFNRVSGLLGPFIDTDSMVQ |
Ga0209354_104272611 | 3300027808 | Freshwater Lake | EIFQSVVAPGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM |
(restricted) Ga0247837_12858462 | 3300027970 | Freshwater | SAVLAVSVEVFQSRIAPGGQIEGVDFTQVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ |
Ga0247723_11596571 | 3300028025 | Deep Subsurface Sediment | EVFQSRIAPGGQIEGVDFTSVSPYRLGRSLFNRVSGLLGPFIDTDSMVQ |
Ga0255172_10459891 | 3300028103 | Freshwater | QIEGVDFQVTPYRMGRSLLNRVVGILGKSLDVDAMVG |
(restricted) Ga0247839_13529832 | 3300028553 | Freshwater | AGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYMDVESMAQ |
(restricted) Ga0247844_11327644 | 3300028571 | Freshwater | IEGIDFASTPFRMGRSLFNKCVGLLGSYMDTESMCQ |
Ga0307379_103231651 | 3300031565 | Soil | GQIEGVDFASTPYRMGRSLTNRVSTLLMPYLDVETVCQ |
Ga0315291_110664631 | 3300031707 | Sediment | APGGQIEGVDFTPSPFRMGRSLQNRVIGLLGNYIDVSTMAM |
Ga0315908_114359211 | 3300031786 | Freshwater | EGVDFAPSPYRMGRSLFNRVVGLLGSYIDVETMAQ |
Ga0315900_110281491 | 3300031787 | Freshwater | QIEGIDFTPSPFRLGRSLFNRVSGLLGPYIDVETMVQ |
Ga0315290_113797163 | 3300031834 | Sediment | IEGVDFQPSPYKMGRSLMNRVIGLISPYIDVETMAM |
Ga0315909_104985151 | 3300031857 | Freshwater | RTAAGGQIEGVDFSGTPYRMGRSLMNRVSSLLQPYLDVETIVQ |
Ga0315909_105063433 | 3300031857 | Freshwater | QSRIAPGGQIEGVDFTQVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ |
Ga0315904_103842674 | 3300031951 | Freshwater | SRIAAGGQIEGVDFTASPFRMGRSLFNRCVGLLGPYLDVESMAQ |
Ga0315904_105077054 | 3300031951 | Freshwater | GGQIEGVDFAPTPYRMGRSLVNRVQALLAPFIDVESLCQ |
Ga0315904_112175731 | 3300031951 | Freshwater | PGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ |
Ga0315294_108533763 | 3300031952 | Sediment | GQIEGVDFTPSPYRMGRSLMNRVIGLISPYVDVETMAM |
Ga0315901_100296921 | 3300031963 | Freshwater | ITAAGGQIEGIDFQPTPYRMGRSLLNRVIGILGKSLDTGAMLA |
Ga0315284_115225321 | 3300032053 | Sediment | LSSGGQIEGVDFTSTPFKMGRSLYNTCVGLLGSYIDPESMCQ |
Ga0315284_124959452 | 3300032053 | Sediment | SRVAPGGQIEGVDFSPSPFRMGRSLYNRISGLLGNLVDVDSIVG |
Ga0315905_1002260612 | 3300032092 | Freshwater | FQSRTAAGGQIEGVDFTVTPFRLGRSLFNRVSGILGPYLDIETMIG |
Ga0315902_105052844 | 3300032093 | Freshwater | GGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ |
Ga0315903_100404098 | 3300032116 | Freshwater | VEVFQSRIAPGGQIEGVDFTQVSPYRLGRSLFNRVSGLLGAFIDTDSMVQ |
Ga0315903_103448524 | 3300032116 | Freshwater | TAAGGQIEGVDFAPTPYRMGRSLVNRVQALLAPFIDVESLCQ |
Ga0315268_104027854 | 3300032173 | Sediment | PGGQIEGVDFAPSPFRMGRSLYNRISGLLGNQVDVDSIVG |
Ga0315273_127964162 | 3300032516 | Sediment | VFQSRVAGGGQIEGIDFTATPFRMGRSLFNRCVGLLGPYMDVESICQ |
Ga0315273_128261282 | 3300032516 | Sediment | QSVVAAGGQIEGVDFTPSPYRMGRSLMNRVIGLISPYINVETMAM |
Ga0334982_0083605_1580_1705 | 3300033981 | Freshwater | AGGGQIEGVDFSPTPFRMGRSLFNKCVGLLGSYMDTESMAL |
Ga0334992_0118976_1265_1390 | 3300033992 | Freshwater | AAGGQIEGLDFASSPYRMGRSLQNRVIGLLGNYIDVEVMVG |
Ga0335003_0410052_468_578 | 3300033995 | Freshwater | IEGVDFQPSPFRMGRSLQNRVIGLLGNYVDVSTMAM |
Ga0334987_0038973_3952_4062 | 3300034061 | Freshwater | IEGVDFTPSPFRMGRSLQNRVIGLLGNYIDVSTMAM |
Ga0334987_0527730_605_712 | 3300034061 | Freshwater | GVDFTQVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ |
Ga0334995_0021425_2_127 | 3300034062 | Freshwater | APGGQIEGVDFSPSPYRMGRSLFNRVVGLLGPYIDVETMAQ |
Ga0335019_0194178_1185_1316 | 3300034066 | Freshwater | TAAGGQIEGLDFQSSPYRMGRSLQNRVIGLLGNYIDVDVMIGG |
Ga0335010_0268260_856_996 | 3300034092 | Freshwater | FQSRVAAGGQIEGVDFASSPYRMGRSLTNRVSTLLMPYLDAETVVQ |
Ga0335010_0408456_2_169 | 3300034092 | Freshwater | VLAVSVEVFQSRIAPGGQIEGIDFTQVSPYRLGRSLFNRVSGLLGPFIDTDSMVQ |
Ga0335012_0055569_1_135 | 3300034093 | Freshwater | ARLAGGGQIEGVDFTATPFRMGRSLYNKCVGLLGSYIDPEGMCQ |
Ga0335027_0330752_1_132 | 3300034101 | Freshwater | RLAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYMDTESMAQ |
Ga0335027_0577638_530_688 | 3300034101 | Freshwater | VAVEVFQSRIAPGGQIEGVDFTSVSPYRLGRSLFNRVSGLLGQYLDVETMAQ |
Ga0335029_0604569_468_614 | 3300034102 | Freshwater | VFQSRIAPGGQIEGIDFTQVSPYRLGRSLFNRVSGLLGPFIDTDSMVQ |
Ga0335029_0632620_442_591 | 3300034102 | Freshwater | VEIFQSVVAPGGQIEGVDFTPSPFRMGRSLQNRVIGLIGNYVDVSTMAM |
Ga0335029_0731917_2_136 | 3300034102 | Freshwater | SVVAPGGQIEGVDFTPSPFRMGRSLQNRVIGLIGNYVDVSTMAM |
Ga0335031_0714315_3_155 | 3300034104 | Freshwater | SVEVFQSRTAPGGQIEGVDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ |
Ga0335036_0141863_1589_1717 | 3300034106 | Freshwater | TAAGGQIEGVDFTGTPYRMGRSLMNRVSSLLQPYLDVETIVQ |
Ga0335036_0310812_2_115 | 3300034106 | Freshwater | IEGVDFQSSPYRMGRSLQNRVIGLLGNYIDVDVMIGG |
Ga0335036_0655474_2_112 | 3300034106 | Freshwater | IEGVDFTATPFRMGRSLFNKCVGLLGSYMDTESMAQ |
Ga0335036_0866687_388_516 | 3300034106 | Freshwater | LAGGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDTDSMAQ |
Ga0335050_0359667_560_667 | 3300034108 | Freshwater | EGVDFTPSPYRMGRSLFNRVVGLLGPYIDVETMAQ |
Ga0335066_0589259_1_132 | 3300034112 | Freshwater | RTAAGGQIEGVDFAPTPYRMGRSLVNRVQALLAPFIDVESLCQ |
Ga0335054_0005547_7412_7540 | 3300034119 | Freshwater | TAPGGQIEGIDFAPSPYRMGRSLFNRVVGLLGPYIDVETMAQ |
Ga0335058_0049832_2328_2450 | 3300034121 | Freshwater | GGGQIEGVDFTATPFRMGRSLFNKCVGLLGSYIDPESMCQ |
Ga0335060_0017603_4602_4730 | 3300034122 | Freshwater | TAAGGQIEGLDFQSSPYRMGRSLQNRVIGLLGNYIDVEVMVG |
Ga0335017_0552819_483_602 | 3300034167 | Freshwater | GGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM |
Ga0335065_0284232_929_1048 | 3300034200 | Freshwater | GQIEGIDFTNVSPYRLGRSLFNRVSGLLGAYIDTDSMVQ |
Ga0335007_0002492_14458_14568 | 3300034283 | Freshwater | IEGVDFAPSPFRMGRSLYNRISGLLGNQVDVDSIVG |
Ga0335048_0154127_2_127 | 3300034356 | Freshwater | APGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM |
Ga0335048_0588579_385_516 | 3300034356 | Freshwater | VVAPGGQIEGVDFTPSPYRMGRSLQNRVIGLLGNYIDVSTMAM |
⦗Top⦘ |