NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F020332

Metagenome Family F020332

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020332
Family Type Metagenome
Number of Sequences 224
Average Sequence Length 47 residues
Representative Sequence TVDAFVAYRPEEHEPDPERREAYDEAYRRYRDVYFALKPVFARG
Number of Associated Samples 189
Number of Associated Scaffolds 224

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.83 %
% of genes near scaffold ends (potentially truncated) 93.75 %
% of genes from short scaffolds (< 2000 bps) 90.18 %
Associated GOLD sequencing projects 175
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.946 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(15.625 % of family members)
Environment Ontology (ENVO) Unclassified
(20.982 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.286 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.28%    β-sheet: 0.00%    Coil/Unstructured: 59.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 224 Family Scaffolds
PF00202Aminotran_3 18.75
PF00120Gln-synt_C 13.39
PF13561adh_short_C2 8.48
PF02720DUF222 6.70
PF07681DoxX 2.68
PF09350DJC28_CD 2.68
PF00990GGDEF 2.68
PF07722Peptidase_C26 2.23
PF00106adh_short 2.23
PF07929PRiA4_ORF3 1.79
PF01418HTH_6 1.34
PF15919HicB_lk_antitox 1.34
PF14015DUF4231 1.34
PF01844HNH 1.34
PF07045DUF1330 0.89
PF00171Aldedh 0.89
PF13520AA_permease_2 0.89
PF02782FGGY_C 0.89
PF00266Aminotran_5 0.89
PF00015MCPsignal 0.45
PF12697Abhydrolase_6 0.45
PF02738MoCoBD_1 0.45
PF12681Glyoxalase_2 0.45
PF14023DUF4239 0.45
PF00809Pterin_bind 0.45
PF02535Zip 0.45
PF00528BPD_transp_1 0.45
PF01565FAD_binding_4 0.45
PF00111Fer2 0.45
PF01435Peptidase_M48 0.45
PF00117GATase 0.45
PF02080TrkA_C 0.45
PF14622Ribonucleas_3_3 0.45
PF00196GerE 0.45
PF13432TPR_16 0.45
PF14325DUF4383 0.45
PF01321Creatinase_N 0.45
PF01037AsnC_trans_reg 0.45
PF00582Usp 0.45
PF00072Response_reg 0.45

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 224 Family Scaffolds
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 2.68
COG4270Uncharacterized membrane proteinFunction unknown [S] 2.68
COG1737DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domainsTranscription [K] 1.34
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.89
COG0840Methyl-accepting chemotaxis protein (MCP)Signal transduction mechanisms [T] 0.89
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.89
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.89
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.89
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 0.45
COG0428Zinc transporter ZupTInorganic ion transport and metabolism [P] 0.45


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.84 %
UnclassifiedrootN/A11.16 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725001|GPWNP_F5MPXY301COYIGAll Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12542Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig1246774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300000891|JGI10214J12806_11746970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales547Open in IMG/M
3300000956|JGI10216J12902_106400240All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300001537|A2065W1_11211063All Organisms → cellular organisms → Bacteria → Terrabacteria group823Open in IMG/M
3300001976|JGI24752J21851_1009856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1246Open in IMG/M
3300003911|JGI25405J52794_10043587All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300003990|Ga0055455_10110064All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300004114|Ga0062593_100599875All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300004114|Ga0062593_103405603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300004479|Ga0062595_101977363All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005093|Ga0062594_101464851All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300005163|Ga0066823_10115970All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300005187|Ga0066675_10360341All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300005332|Ga0066388_106158800All Organisms → cellular organisms → Bacteria → Proteobacteria606Open in IMG/M
3300005356|Ga0070674_100505613All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300005440|Ga0070705_101435509All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300005444|Ga0070694_101698878All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005445|Ga0070708_101087876All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300005446|Ga0066686_11079810All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005450|Ga0066682_10254845All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300005450|Ga0066682_10903695All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005471|Ga0070698_101948668Not Available541Open in IMG/M
3300005518|Ga0070699_100670628All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300005530|Ga0070679_101781190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales564Open in IMG/M
3300005540|Ga0066697_10496245All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300005540|Ga0066697_10781720All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005543|Ga0070672_101349819All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300005545|Ga0070695_100394286All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300005545|Ga0070695_101240520All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300005552|Ga0066701_10069149All Organisms → cellular organisms → Bacteria1996Open in IMG/M
3300005552|Ga0066701_10160289All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300005553|Ga0066695_10805436All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005555|Ga0066692_10038550All Organisms → cellular organisms → Bacteria2587Open in IMG/M
3300005557|Ga0066704_10874537All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300005560|Ga0066670_10987431All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005561|Ga0066699_10661202All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300005569|Ga0066705_10059120All Organisms → cellular organisms → Bacteria2178Open in IMG/M
3300005574|Ga0066694_10009432All Organisms → cellular organisms → Bacteria4119Open in IMG/M
3300005587|Ga0066654_10201034All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300005614|Ga0068856_101655108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales653Open in IMG/M
3300005713|Ga0066905_102201049All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005981|Ga0081538_10134785All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300006041|Ga0075023_100167545All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300006046|Ga0066652_101802714All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300006049|Ga0075417_10221155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia901Open in IMG/M
3300006058|Ga0075432_10465345All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300006794|Ga0066658_10020207All Organisms → cellular organisms → Bacteria2592Open in IMG/M
3300006844|Ga0075428_101409140All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300006844|Ga0075428_101826800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300006844|Ga0075428_102708841All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300006847|Ga0075431_101278918All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300006852|Ga0075433_10340143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1326Open in IMG/M
3300006852|Ga0075433_10790090All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300006854|Ga0075425_100740151All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300006854|Ga0075425_101496170All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300006871|Ga0075434_100423859All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300006881|Ga0068865_100758439All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300006969|Ga0075419_11313637All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300007076|Ga0075435_101035743All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300007258|Ga0099793_10561693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium570Open in IMG/M
3300009012|Ga0066710_100032075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6140Open in IMG/M
3300009090|Ga0099827_10270506All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300009090|Ga0099827_11738959All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12543Open in IMG/M
3300009094|Ga0111539_13222983Not Available526Open in IMG/M
3300009137|Ga0066709_101367020All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300009137|Ga0066709_101512382All Organisms → cellular organisms → Bacteria → Terrabacteria group968Open in IMG/M
3300009137|Ga0066709_101658626Not Available910Open in IMG/M
3300009147|Ga0114129_12985371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium557Open in IMG/M
3300009157|Ga0105092_10451413All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300009157|Ga0105092_10708875All Organisms → cellular organisms → Bacteria → Terrabacteria group586Open in IMG/M
3300009162|Ga0075423_10702419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1068Open in IMG/M
3300009797|Ga0105080_1013891All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300009808|Ga0105071_1109691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium509Open in IMG/M
3300009809|Ga0105089_1029914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium774Open in IMG/M
3300009809|Ga0105089_1059846Not Available608Open in IMG/M
3300009810|Ga0105088_1111581All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12514Open in IMG/M
3300009817|Ga0105062_1038596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium852Open in IMG/M
3300009818|Ga0105072_1004078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2407Open in IMG/M
3300009822|Ga0105066_1106350Not Available622Open in IMG/M
3300009837|Ga0105058_1041017Not Available1021Open in IMG/M
3300009840|Ga0126313_11855360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300009840|Ga0126313_11863838All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300009840|Ga0126313_11871596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300010038|Ga0126315_10038938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2522Open in IMG/M
3300010038|Ga0126315_10496870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. 1274761.0778Open in IMG/M
3300010040|Ga0126308_11046495Not Available573Open in IMG/M
3300010041|Ga0126312_10764621All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300010336|Ga0134071_10667358All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300010362|Ga0126377_13517603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora kangleipakensis506Open in IMG/M
3300010375|Ga0105239_10774243Not Available1099Open in IMG/M
3300010396|Ga0134126_11790659All Organisms → cellular organisms → Bacteria → Terrabacteria group673Open in IMG/M
3300010401|Ga0134121_11765720All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300011000|Ga0138513_100005495All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1425Open in IMG/M
3300011264|Ga0151623_1301656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium528Open in IMG/M
3300012096|Ga0137389_10232090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1546Open in IMG/M
3300012189|Ga0137388_10211707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1751Open in IMG/M
3300012198|Ga0137364_10540063All Organisms → cellular organisms → Bacteria → Terrabacteria group877Open in IMG/M
3300012201|Ga0137365_10022833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4846Open in IMG/M
3300012204|Ga0137374_10774264All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300012210|Ga0137378_11037846All Organisms → cellular organisms → Bacteria → Terrabacteria group734Open in IMG/M
3300012210|Ga0137378_11782822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium520Open in IMG/M
3300012285|Ga0137370_10027124All Organisms → cellular organisms → Bacteria2939Open in IMG/M
3300012350|Ga0137372_10066832All Organisms → cellular organisms → Bacteria3111Open in IMG/M
3300012355|Ga0137369_10978471All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300012360|Ga0137375_10616320All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300012360|Ga0137375_10874773All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300012360|Ga0137375_11182808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300012685|Ga0137397_10041460All Organisms → cellular organisms → Bacteria3291Open in IMG/M
3300012938|Ga0162651_100014116All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300012976|Ga0134076_10267867All Organisms → cellular organisms → Bacteria → Terrabacteria group732Open in IMG/M
3300013306|Ga0163162_12900737All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12552Open in IMG/M
3300014157|Ga0134078_10416938All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300015241|Ga0137418_10879723All Organisms → cellular organisms → Bacteria → Terrabacteria group661Open in IMG/M
3300017939|Ga0187775_10472108All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300017965|Ga0190266_10451891All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12732Open in IMG/M
3300017997|Ga0184610_1281134All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300018028|Ga0184608_10211284All Organisms → cellular organisms → Bacteria → Terrabacteria group851Open in IMG/M
3300018031|Ga0184634_10119373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1165Open in IMG/M
3300018059|Ga0184615_10348358All Organisms → cellular organisms → Bacteria → Terrabacteria group820Open in IMG/M
3300018061|Ga0184619_10114855All Organisms → cellular organisms → Eukaryota1216Open in IMG/M
3300018071|Ga0184618_10491209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium515Open in IMG/M
3300018072|Ga0184635_10059421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1483Open in IMG/M
3300018072|Ga0184635_10417765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300018074|Ga0184640_10161776All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR121002Open in IMG/M
3300018075|Ga0184632_10402740All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12575Open in IMG/M
3300018077|Ga0184633_10544356Not Available556Open in IMG/M
3300018077|Ga0184633_10628397All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300018081|Ga0184625_10466132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium645Open in IMG/M
3300018082|Ga0184639_10261157Not Available914Open in IMG/M
3300018082|Ga0184639_10266705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium904Open in IMG/M
3300018422|Ga0190265_11630443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium756Open in IMG/M
3300018466|Ga0190268_12259090Not Available511Open in IMG/M
3300018469|Ga0190270_12918493All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300018482|Ga0066669_12333178All Organisms → cellular organisms → Bacteria → Terrabacteria group511Open in IMG/M
3300021082|Ga0210380_10068818All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR121544Open in IMG/M
3300021082|Ga0210380_10303640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium727Open in IMG/M
3300022554|Ga0212093_1021467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4777Open in IMG/M
3300022694|Ga0222623_10295451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium622Open in IMG/M
3300022756|Ga0222622_10113213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1692Open in IMG/M
3300025167|Ga0209642_10467330All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12700Open in IMG/M
3300025312|Ga0209321_10001876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria14237Open in IMG/M
3300025313|Ga0209431_10218915Not Available1502Open in IMG/M
3300025314|Ga0209323_10789467All Organisms → cellular organisms → Bacteria → Terrabacteria group501Open in IMG/M
3300025552|Ga0210142_1091187All Organisms → cellular organisms → Bacteria → Terrabacteria group599Open in IMG/M
3300025795|Ga0210114_1091453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300025915|Ga0207693_10753958Not Available752Open in IMG/M
3300025927|Ga0207687_11055604All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300025937|Ga0207669_10445549All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR121025Open in IMG/M
3300025944|Ga0207661_11020960Not Available762Open in IMG/M
3300026298|Ga0209236_1198623All Organisms → cellular organisms → Bacteria → Terrabacteria group764Open in IMG/M
3300026306|Ga0209468_1205682All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300026308|Ga0209265_1145283All Organisms → cellular organisms → Bacteria → Terrabacteria group607Open in IMG/M
3300026313|Ga0209761_1349300All Organisms → cellular organisms → Bacteria → Terrabacteria group501Open in IMG/M
3300026314|Ga0209268_1103222All Organisms → cellular organisms → Bacteria → Terrabacteria group773Open in IMG/M
3300026323|Ga0209472_1180606All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300026324|Ga0209470_1113658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1206Open in IMG/M
3300026325|Ga0209152_10092504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1130Open in IMG/M
3300026334|Ga0209377_1239578All Organisms → cellular organisms → Bacteria → Terrabacteria group596Open in IMG/M
3300026335|Ga0209804_1322155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium521Open in IMG/M
3300026523|Ga0209808_1296789All Organisms → cellular organisms → Bacteria → Terrabacteria group520Open in IMG/M
3300026530|Ga0209807_1227761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium636Open in IMG/M
3300026672|Ga0208214_102322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae775Open in IMG/M
3300026673|Ga0208847_100154All Organisms → cellular organisms → Bacteria1570Open in IMG/M
3300026973|Ga0207479_102893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300027277|Ga0209846_1023102All Organisms → cellular organisms → Bacteria → Terrabacteria group1011Open in IMG/M
3300027471|Ga0209995_1092976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300027511|Ga0209843_1057715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces679Open in IMG/M
3300027650|Ga0256866_1065651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium968Open in IMG/M
3300027722|Ga0209819_10017224All Organisms → cellular organisms → Bacteria2375Open in IMG/M
3300027809|Ga0209574_10268975All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300027862|Ga0209701_10666607All Organisms → cellular organisms → Bacteria → Terrabacteria group541Open in IMG/M
3300027873|Ga0209814_10165772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium950Open in IMG/M
3300027875|Ga0209283_10352396All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300027909|Ga0209382_10685985All Organisms → cellular organisms → Bacteria → Terrabacteria group1104Open in IMG/M
(restricted) 3300028043|Ga0233417_10642222All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300028381|Ga0268264_10363873All Organisms → cellular organisms → Bacteria1380Open in IMG/M
3300028597|Ga0247820_10982255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales602Open in IMG/M
3300028708|Ga0307295_10181688All Organisms → cellular organisms → Bacteria → Terrabacteria group592Open in IMG/M
3300028708|Ga0307295_10216657All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12545Open in IMG/M
3300028710|Ga0307322_10031969All Organisms → cellular organisms → Bacteria → Terrabacteria group1248Open in IMG/M
3300028722|Ga0307319_10135455All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300028744|Ga0307318_10075857All Organisms → cellular organisms → Bacteria → Terrabacteria group1125Open in IMG/M
3300028784|Ga0307282_10503685All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300028784|Ga0307282_10595065All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300028787|Ga0307323_10153811All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300028796|Ga0307287_10176959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia810Open in IMG/M
3300028803|Ga0307281_10441752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium502Open in IMG/M
3300028807|Ga0307305_10137029Not Available1130Open in IMG/M
3300028812|Ga0247825_10520927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium847Open in IMG/M
3300028814|Ga0307302_10477285All Organisms → cellular organisms → Bacteria → Terrabacteria group618Open in IMG/M
3300028828|Ga0307312_10028934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces3215Open in IMG/M
3300028828|Ga0307312_10820836Not Available616Open in IMG/M
3300028878|Ga0307278_10028260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2572Open in IMG/M
3300028880|Ga0307300_10350576All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300028881|Ga0307277_10125113Not Available1104Open in IMG/M
3300030336|Ga0247826_11125966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300031229|Ga0299913_11851308All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300031731|Ga0307405_11044087All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300031740|Ga0307468_102091868All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300031847|Ga0310907_10703761All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12559Open in IMG/M
3300031995|Ga0307409_100933289All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300031995|Ga0307409_102735039All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300032002|Ga0307416_100486209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides dokdonensis → Nocardioides dokdonensis FR14361295Open in IMG/M
3300032002|Ga0307416_100636904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1149Open in IMG/M
3300032159|Ga0268251_10067764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1209Open in IMG/M
3300032159|Ga0268251_10288062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300032174|Ga0307470_10101700All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR121648Open in IMG/M
3300032174|Ga0307470_10983531All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300032174|Ga0307470_11298839All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12596Open in IMG/M
3300032179|Ga0310889_10743001All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12514Open in IMG/M
3300033407|Ga0214472_10344558All Organisms → cellular organisms → Eukaryota1409Open in IMG/M
3300033551|Ga0247830_11384192Not Available562Open in IMG/M
3300033759|Ga0314869_001880All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12872Open in IMG/M
3300033814|Ga0364930_0167601Not Available749Open in IMG/M
3300033814|Ga0364930_0319688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium521Open in IMG/M
3300034354|Ga0364943_0228249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium691Open in IMG/M
3300034354|Ga0364943_0426139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes aureus515Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil15.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.27%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.04%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.70%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand5.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.57%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.12%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.23%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.23%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.79%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.79%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.34%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.34%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.34%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave1.34%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.89%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.89%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.45%
SedimentEnvironmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment0.45%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.45%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.45%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.45%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.45%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.45%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.45%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.45%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.45%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.45%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.45%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.45%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725001Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009797Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20EnvironmentalOpen in IMG/M
3300009808Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50EnvironmentalOpen in IMG/M
3300009809Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300011264Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300022554Dewar_combined assemblyEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025314Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2EnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025795Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026672Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1102 (SPAdes)EnvironmentalOpen in IMG/M
3300026673Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1116 (SPAdes)EnvironmentalOpen in IMG/M
3300026973Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-C (SPAdes)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027471Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027511Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027650Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeqEnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033759Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_BEnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GPWNP_017401902067725001SoilCGDPGRAGVRLHAGVADAVNAFVAYRPDQHEPDAVTRRAYDEAYRRYRGVYGALRPVFAT
KansclcFeb2_123282002124908045SoilFVAYEPEEHQPDPDRQEAYAEAYGRYRDLYFALKPVFGTG
JGI10213J12805_1018003323300000858SoilGAAVKAFVSYQPEEHRPDPDVREVYDEAYVRYRKVYASLRPVFSDG*
JGI10214J12806_1174697013300000891SoilVDAFVSYQPEEHEPDPDTREAYDDAYRRYRDVYFALKPTFAAG*
JGI10216J12902_10640024013300000956SoilAVDAFVAFRPDAHEPDPGRAGIYEEAYRRYRDVYFALKPVFSAG*
A2065W1_1121106323300001537PermafrostAGAFVSYRPDEHQPDAERREIYNEAYGRYRDVYFALKPVFERA*
JGI24752J21851_100985623300001976Corn, Switchgrass And Miscanthus RhizosphereHGNVADAVKAFVSYRPDEHEPDGGNRSVYDEAYQRYRQVYGALAPVFAAG*
JGI25405J52794_1004358713300003911Tabebuia Heterophylla RhizosphereVKAFVAFRPDEHQPDPEHRDAYDDGYRRYRDLYAALRPVFDG*
Ga0055455_1011006413300003990Natural And Restored WetlandsVDAFVSYRPDEHVPDPECHEVYAQAYRRYRDLYFALKPVFDRAG*
Ga0062593_10059987523300004114SoilAAAAFVSYRPEEHEPDPGRAAAYEEAYRRYREVYFALKPVFA*
Ga0062593_10340560313300004114SoilVHGTVADAVNAFVAYRPDEHAPDPERREIYDDAYRRYRDVYGALAPVFMS*
Ga0062595_10197736323300004479SoilGSGLHGSVAKAVDAFVAYQPGEQLPDPERHQRYASAYRRYREVYFALKPVFDRP*
Ga0062594_10146485133300005093SoilIGDATRAFVRFRPEGHEPDPAVRDAYDAAYRRYREVYFALKPVFSSV*
Ga0066823_1011597023300005163SoilVSYQPEEHEPDPETREAYDDAYRRYRDVYFALKPTFATG*
Ga0066688_1041642433300005178SoilDAVESFVAYRPQQHSSDPERHQLYDEAYSRYRDVYFALKPIFDHGGLNA*
Ga0066675_1036034123300005187SoilHATVADAVRAFVSYRPEGHDPEPSVRDAYDEAYARYRDVYFALKPVFERS*
Ga0066388_10615880023300005332Tropical Forest SoilTIDDAVRSFVRFRPDGHDPDPSAREAYDEAYRRYREVYFALKPVFAAG*
Ga0070674_10050561323300005356Miscanthus RhizosphereHGNVADAVRAFVSYRPDEHEPDGGNRSVYDEAYRRYRQVYRALAPVFAAG*
Ga0070705_10143550923300005440Corn, Switchgrass And Miscanthus RhizosphereGVADAVDAFVSFRPEEHEPEPAAAEAYDEAYRRYRELYFALVPVFGT*
Ga0070694_10169887813300005444Corn, Switchgrass And Miscanthus RhizosphereKAFVRYLPQGHEPDPERQAVYDAAYRRYRDVYFALKPVFDS*
Ga0070708_10108787613300005445Corn, Switchgrass And Miscanthus RhizosphereVADAVDAFVAFRPEQHQPDPERREIYDEAYRRYRDVYFALKPVFAAG*
Ga0066686_1107981023300005446SoilAEAVGAFVAYEPDEHLPDPGRQEAYAEAYARYRDVYFALKPVFEGGSIG*
Ga0066682_1025484523300005450SoilAGVLPTVAEAVSAFVRYRPEEHTPDPERQAIYDDAYRRYRDVYYALKPVFDA*
Ga0066682_1090369513300005450SoilGAGVFPDVGSAVNAFVRYRPEEHAPDPGRRAVYDEAYRRYRDVYFALKPVFDG*
Ga0070698_10194866823300005471Corn, Switchgrass And Miscanthus RhizosphereAFVSFRPEEHEPDPAARDAYDDAYGLYREVYFALKPVFPATGES*
Ga0070699_10067062813300005518Corn, Switchgrass And Miscanthus RhizosphereAAVEAFVSYRPEEHQPDPGVREAYDEAYVRYRKVYASLKPVFSDG*
Ga0070679_10178119023300005530Corn RhizosphereAYQPHEHTPDPQNRAAYDDAYGRYRDLYFSLKPVFERGARG*
Ga0066697_1049624523300005540SoilEAVSAFVRYRPEEHTPDPERQAIYDDAYRRYRDVYYALKPVFDA*
Ga0066697_1078172013300005540SoilAFVSYRPDEHLPDPERHAMYDEAYRRYRDVYFALKPLFDRA*
Ga0070672_10134981913300005543Miscanthus RhizosphereAFVAFRPEEHEPDPDRREAYDEAYRRYRDTYFALKPVFATG*
Ga0070695_10039428613300005545Corn, Switchgrass And Miscanthus RhizosphereILAAVGGGVQPSVAEAVRAFVRYRPEEHQPDQGRRQLYDDAYRRYRDVYFALKPVFDG*
Ga0070695_10124052023300005545Corn, Switchgrass And Miscanthus RhizosphereLAAVGGEVQPTVADAVRAFVRYQPDEHAPDPQRRETYDAAYRRYRDVYFALKPVFDT*
Ga0066701_1006914933300005552SoilAAGAFVEYRTEEHLPDPERHDIYDVAYRRYRDVYFALKPVFERA*
Ga0066701_1016028933300005552SoilAAAVDAFVAYRPEEHTPDPERRRFYDDAYRRYREVYFALKPVFDT*
Ga0066701_1046614313300005552SoilAGVRATVSDAVESFVAYRPQQHSSDPERHQLYDEAYSRYRDVYFALKPIFDKGGLKA*
Ga0066695_1080543623300005553SoilVAYRPEEHTPDPERRRFYDDAYRRYREVYFALKPVFDT*
Ga0066692_1003855043300005555SoilNAFVRYRPEEHAPDPGRRAVYDEAYRRYRDVYFALKPVFDG*
Ga0066704_1087453713300005557SoilLPSVAEAVSAFVHYRPEEHVPDAATRAAYDEAYGRYRAVYYALKPVFGA*
Ga0066670_1098743123300005560SoilLAAVGSGLFPSVAAAVDAFVAYRPEEHTPDPERRRFYDDAYRRYREVYFALKPVFDT*
Ga0066699_1066120213300005561SoilFVSFRPEEHVPDPEAEQSYEDAYRRYRDLYYALKPVFSGS*
Ga0066705_1005912013300005569SoilILAAVGSGLQPSVASAVSAFVAYQPDELQPDPERRQVYGDAYKRYREVYFALKPVFNA*
Ga0066694_1000943213300005574SoilGAFVEYRTEEHLPDPERHDIYDVAYRRYRDVYFALKPVFERA*
Ga0066654_1020103423300005587SoilDVAAAVSAFVRYGPQEHLPDPERRAIYDDAYRRYRDVYYALKPVFDG*
Ga0068856_10165510813300005614Corn RhizosphereVADAVRAFVRYQPDEHAPDPQQREVYDAAYRRYRDVYFALKPVFDT*
Ga0066905_10220104913300005713Tropical Forest SoilAVGSGVHGTIADAVKSFVAFRPEEHQPDPAARDAYDEAYARYREVYFALKPVFEAV*
Ga0081538_1013478533300005981Tabebuia Heterophylla RhizosphereAVEAFVDYQPDEHVPDPERHQAYTEAYRRYRDVYFALKPVFERGPG*
Ga0075023_10016754513300006041WatershedsAVEAFAAYQPDEHQPDPDRRQIYDEAYGRYRDVYFALKPVFDRA*
Ga0066652_10180271413300006046SoilVGSGVLPSVAEAVSAFVHYRPEEHVPDAATRAAYDEAYGRYRAVYYALKPVFGA*
Ga0075417_1022115513300006049Populus RhizosphereVQAFVAYRRDEHAPDPERREAYDDAYRRYRDLYDALRPVFST*
Ga0075432_1046534513300006058Populus RhizospherePEAVSAFVDYQPDEHVPDPERHQRYTEAYQRYREVYFALKPVFERGAS*
Ga0066658_1002020743300006794SoilAVGCGLLPNVASAAGAFAQYRPEEHLPDPDRHDIYDEAYRRYRDVYFALKPVFERA*
Ga0075428_10140914013300006844Populus RhizosphereAAFVTYEPDEHLPDPERHQAYSEAYRRYRDVYYALKPVFGREAAVG*
Ga0075428_10182680013300006844Populus RhizosphereFRPEEHAPDPAAQEAYDEAYTRYRDVYFALKPVFSS*
Ga0075428_10270884123300006844Populus RhizosphereILAAVASGVHTTVADAVSAFVAYRPDEHQPDPERREVYDEAYRRYRGLYAALGPVFSA*
Ga0075431_10127891823300006847Populus RhizosphereGSGVHASVPEAVSAFVDYQPDEHVPDPERHQRYTEAYHRYREVYFALKPVFERGAS*
Ga0075433_1034014323300006852Populus RhizosphereVHATVTDAVQAFVAYRRDEHAPDPERREAYDDAYRRYRDLYDALRPVFST*
Ga0075433_1079009033300006852Populus RhizosphereHASVAEAVAAFVAYQPDEHVPDPGRHQRYSEAYARYRELYFALKPVFEAGAG*
Ga0075425_10074015113300006854Populus RhizosphereGSGVHGSVRDAVASFVRFRPEEHAPDPEAHEAYDEAYRRYRDVYFALKPVFASG*
Ga0075425_10149617023300006854Populus RhizosphereAILAAVGGGVQPSVAEAVKAFVRYRPEEHQPEAARRSSYDAAYRRYRDVYFALKPVFDG*
Ga0075434_10042385913300006871Populus RhizosphereLAAVGGEVQPAVADAVRAFVRYQPEEHAPDPQRRETYDAAYRRYRDVYFALKPVFDT*
Ga0068865_10075843923300006881Miscanthus RhizosphereGLHSSVAEAVAAFVRFRPESHDPDPATAAAYDDAYARYRSVYSALRPVFGT*
Ga0075419_1131363723300006969Populus RhizosphereAAFVAYQPDEQVPDHGRHQAYDEAYRRYRDVYFSLKPAFQG*
Ga0075435_10103574313300007076Populus RhizospherePSVAEAVRAFVRYRQEEHQPDEGRRAIYEDAYRLYRDVYFALKPVFDG*
Ga0099793_1056169323300007258Vadose Zone SoilASAAAAFVKYRPEEHAPDAENGQAYDEAYRRYRDVYFALKPVFERG*
Ga0066710_10003207513300009012Grasslands SoilILAAVGSGLQPSVASAVSAFVAYQPDELQPDPERRQVYGDAHKRYREVYFALKPVFNA
Ga0099827_1027050613300009090Vadose Zone SoilYAPEEHVPDPEQSAAYETAYRRYREVYYALKPVFDA*
Ga0099827_1173895913300009090Vadose Zone SoilEEHEPDPRTREAYDEAYRRYRDVYFALKPVFTTG*
Ga0111539_1322298313300009094Populus RhizosphereGSGVHASVAEAVAAFVAYQPDEHVPDPERHQRYSDAYHRYRDLYFALKPVFERVDGLPPTSP*
Ga0066709_10136702013300009137Grasslands SoilQEGEHEPDPSVQDVYDEAYARYRAVYFALKPVFGA*
Ga0066709_10151238223300009137Grasslands SoilRYRPQEHLPDPERRAMYDDAYRRYRDVYYALKPVFDG*
Ga0066709_10165862633300009137Grasslands SoilGTIVEAVDAFVRFRPDQHLPDPEAHTAYENAYRRYRDVYFALKPVFAAG*
Ga0114129_1298537123300009147Populus RhizosphereAGAVEAIVAFRPEEHEPQAERREVYDEAYRRYRDVFFALKPVFAHG*
Ga0105092_1045141323300009157Freshwater SedimentEAIVAFRPEEHEPEAERREVYDEAYRRYRDVFFALKPVFARG*
Ga0105092_1070887513300009157Freshwater SedimentVADAVDAFVAYRPEQHEPDPERREVYDEAYRRYRNTYAALKPVFAGG*
Ga0075423_1070241913300009162Populus RhizosphereGVHTTVADAVRAFVAYRPDEHRPDPERREVYDEAYRRYRDVYSALVPVFSA*
Ga0105080_101389133300009797Groundwater SandEEQVPDPERRERYDDAYRRYRDVYFAMKPVFERG*
Ga0105071_110969113300009808Groundwater SandSDVHATVADAVRAFVAYRPEEHEPDQERREIYDEAHRRYRDTYFALKPVFAAAPA*
Ga0105089_102991423300009809Groundwater SandYRPEEHQPDPGVREAYDVAYVRYRKVYASLKPVFADS*
Ga0105089_105984623300009809Groundwater SandADAVAAFVSFQPEEHRPDPERREAYERAYAKYREVYFALKPVFASG*
Ga0105088_111158123300009810Groundwater SandVADAVNAFVAYRPEQHEPDEVTRTAYDEAYRRYRGVYAALRPVFATA*
Ga0105084_100576433300009811Groundwater SandILPTVGAAVEAFVSYQPEEHQPAPDVREVYDEAYLRYRKVYASLKPVFSDI*
Ga0105062_103859623300009817Groundwater SandEAFVSYRPEEHQPDPGVREAYDDAYVRYRKVYASLKPVFADG*
Ga0105072_100407833300009818Groundwater SandYQPEEHRPDPDVREVYDEAYARYRKLYASLKPVFSDS*
Ga0105066_110635023300009822Groundwater SandTAFVSFQPEEHRPDPERREAYERAYRKYREVYFALNPVFASG*
Ga0105058_104101733300009837Groundwater SandSFQPEEHRPDPERREAYERAYRKYREVYFALKPVFASG*
Ga0126313_1185536013300009840Serpentine SoilVEAFVTYQPDEHVPDPGRHQAYSEAYRRYRDLYYALKPVFERQAG*
Ga0126313_1186383813300009840Serpentine SoilQPDEHVPDPERHQRYTEAYQRYREVYFALKPVFERTGAAPA*
Ga0126313_1187159613300009840Serpentine SoilEEHQPDPEASAVYDAAYALYRDVYAAAKPVFERHAGA*
Ga0126315_1003893833300010038Serpentine SoilVHAGVAEAVAAFVDYQPEEHVPDPERHAAYTSAYHRYREVYYALKPVFEKVET*
Ga0126315_1049687013300010038Serpentine SoilVEAFVTYQPDEHVPDPERHQAYSEAYRRYRDLYYALKPVFERQAG*
Ga0126308_1104649523300010040Serpentine SoilAVAAFVTYQPEEHIPDPGRHQAYSEAYRRYREVYYALKPVFGREAAAG*
Ga0126312_1076462113300010041Serpentine SoilAAEQFVSFLPEEHQPDPEASAVYDAAYALYRDVYAAAKPVFERHAGA*
Ga0134071_1066735813300010336Grasslands SoilAVGAGLHGTVADAVNAFVAFRPEEHQPDPERREIYDEAYRRYRDVYFALKPVFAAG*
Ga0126377_1351760313300010362Tropical Forest SoilSVAEAVEAFVAFQPEEEVPDPDRQAAYDDAYRRYRELYFALKPVFESA*
Ga0105239_1077424333300010375Corn RhizosphereAGVHATVADAVDAFVAFRPEEHEPDPDRREAYDEAYRRYRDTYFALKPVFATG*
Ga0134126_1179065923300010396Terrestrial SoilVASAAGAFVAYRPDEHQPDPERRAIYDEAYGRYRDVYYALKPVFERV*
Ga0134121_1176572023300010401Terrestrial SoilFVAYQPHEHTPDPQNRAAYDDAYGRYRDLYFSLKPVFERGARG*
Ga0138513_10000549533300011000SoilGVHSSVADAVSAFVAYQPDEHVPDPERHQRYTEAYHRYREVYFALKPVFELGAS*
Ga0151623_130165613300011264SedimentVAGAVEAFVSFQPEVHEPDPERHDAYGEAYRRYRDVYFALKPVFDSR*
Ga0137389_1023209033300012096Vadose Zone SoilVSYRPEGHEPDLSSRQAYDDAYGRYRDVYFTLKPVFEKA*
Ga0137388_1021170713300012189Vadose Zone SoilILPSVAAAVEAFVSYQPHEHQPDPQRHHAYAEAYGRYRDVYFALKPVFEQGAGA*
Ga0137364_1054006313300012198Vadose Zone SoilAAVSAFVRYRPQEHLPDPERRAIYDDAYRRYRDVYYALKPVFDG*
Ga0137365_1002283313300012201Vadose Zone SoilAVAAFVAYQPTEHLPDPDRQQRYADAYRRYREVYFALKPVFARG*
Ga0137374_1077426423300012204Vadose Zone SoilFVAYQPEEQVPDPERQERYDDAYRRYRDVYFALKPVFERG*
Ga0137378_1103784623300012210Vadose Zone SoilAVGSGVLPDVAAAVSAFVRYRPEEHLPDPERRAIYDDAYRRYRDVYYALKPVFDG*
Ga0137378_1178282223300012210Vadose Zone SoilVGSGLHSTIADAVEAFVRFRPEEHVPDPEAAAAYEDAYRRYREVYFALKPVFAAG*
Ga0137370_1002712443300012285Vadose Zone SoilPDVAAAVSAFVRYGPEEHLPNPEQGAIYDDAYRRYRDVYYALKPVFDG*
Ga0137372_1006683233300012350Vadose Zone SoilVTEAVRAFVTYQPEEHQPDDGSHQAYEEPYRRYRDVYFALKPVFEGS*
Ga0137369_1097847123300012355Vadose Zone SoilAEAVDAFVAYQPEEQVPDPERQERYDDAYRRYRDVYFALKPVFERG*
Ga0137375_1061632033300012360Vadose Zone SoilGVHASVAEAVASFVSFQPDEHRPDPEQQEAYEPAYRKYREVYFALKPVFASG*
Ga0137375_1087477313300012360Vadose Zone SoilHPIVASAVDSFVADEPEAPQPDPDRQQAYAEAYGRYRDLYFALKPVFGAG*
Ga0137375_1118280813300012360Vadose Zone SoilASAVDAFVAYEPEEHRPDPDRQEAYAEAYRRYRDLYFALKPVFAAG*
Ga0137397_1004146043300012685Vadose Zone SoilDIASAATAFVQYRPEEHVPDAANAQIYDEAYRRYRDVYFALKPVFERA*
Ga0162651_10001411643300012938SoilVHASVPEAVSAFVDYQPTEHVPDPERHQRYTEAYHRYREVYFALKPVFERSDRELPA*
Ga0134076_1026786713300012976Grasslands SoilSAVDAFVAFEPEEHRPDPERHEAYEEAYRRYRDLYFALKPVFAAG*
Ga0163162_1290073713300013306Switchgrass RhizosphereSGLHGNVADAVRAFVSYRPDEHEPDGGNRSVYDEAYRRYRQVYRALAPVFAAG*
Ga0134078_1041693813300014157Grasslands SoilVHPGIAEAVDAFVAYRPEEHVPDPERSEAYTAAYRRYRELYFALKPVFERA*
Ga0137418_1087972313300015241Vadose Zone SoilAATAFVQYRPEEHVPDAGHAQVYDEAYRRYRDVYYALKPVFERA*
Ga0187775_1047210823300017939Tropical PeatlandDAVETFVRFQPDEHQPDPERREAYDEAYRRYREVYFALKPVFAAG
Ga0190266_1045189123300017965SoilADAVNAFVAYRPEQHEPDELTRAGYDEAYRRYRGVYAALRPVFATG
Ga0184610_128113423300017997Groundwater SedimentVGAEVHSSVAEAVEAFVAYRPGEQVPDPERREQYADAYRRYRDLYFTLKPIFDRP
Ga0184608_1021128413300018028Groundwater SedimentGAFVSYRPDEHRPDPERQEIYNEAYARYRDVYFALKPVFERA
Ga0184634_1011937333300018031Groundwater SedimentAAVASDVHPTVAGAVEAFVSYEPEEHHPDPGNREAYDEAYRRYRDVYFALKPVFDGA
Ga0184615_1034835833300018059Groundwater SedimentYRPEEHQPDPERREVYDEAYRRYRDVYFALKPVFARG
Ga0184619_1011485513300018061Groundwater SedimentAAFVAFRPEEHVPDPEASEAYDDAYRRYRDVYFALKPVFSAG
Ga0184618_1049120923300018071Groundwater SedimentVDAFVAFRPEEHEPDPERREVYNEAYRRYRDVYFALKPVFAAG
Ga0184635_1005942123300018072Groundwater SedimentAAVEAFVSYRPEEHQPDPGVREAYDEAYVRYRKVYASLKPVFSDS
Ga0184635_1041776523300018072Groundwater SedimentVRAFVSYRRDEHEPDDGHRSVYDEAYRRYREVYAALKPVFSDG
Ga0184640_1016177613300018074Groundwater SedimentRAFVSYRPAEHEPDGGNRSVYDEAYRRYRQVYRALAPVFAAG
Ga0184632_1040274013300018075Groundwater SedimentGLHGSVADAVNAFVAYRPEQHEPDDVTRTAYDEAYRRYRGVYAALRPVFSTG
Ga0184633_1054435613300018077Groundwater SedimentFQPDEHRPDPERREAYERAYRKYREVYFALKPVFASG
Ga0184633_1062839723300018077Groundwater SedimentFVSFQPDEHRPDPERREAYERAYRKYREVYFALKPVFASGE
Ga0184625_1046613223300018081Groundwater SedimentAVGSGVHASVPEAVSAFVDYQPDEHVPDPERHQRYTEAYHRYREVYFALKPVFERAGG
Ga0184639_1026115733300018082Groundwater SedimentAFVSFQPDEHRPDPERREAYERAYRKYREVYFALKPVFASG
Ga0184639_1026670523300018082Groundwater SedimentDAVMAFVSYEPEEHQPDPERRAAYDEAYRRYRDVYFALKPVFVSG
Ga0190265_1163044333300018422SoilSFRPDEHEPDAGTRQAYDDAYERYREVYFALKPVFPATGES
Ga0190268_1225909013300018466SoilVEAFVTYQPDEHVPDPERHQAYSEAYRHYRDLYYALKPVFERQAAG
Ga0190270_1291849323300018469SoilFVSFRPEEHEPDPKNRAAYDEAYNRYREVYFALKPVYEPK
Ga0190274_1026714433300018476SoilTVGAAVEAFVSYQPEEHRPDPDVREMYDEAYVRYRKVYASLKPVFSDS
Ga0066669_1233317823300018482Grasslands SoilYRPEEHVPDPERSEAYTAAYRRYRELYFALKPVFERA
Ga0210380_1006881813300021082Groundwater SedimentAGVHATVADAVDAFVSYQPEEHEPDPETREAYDDAYRRYRDVYFALKPTFATG
Ga0210380_1030364023300021082Groundwater SedimentILAAVASGLHANVADAVRAFVSYRPDEHEPDDGHRSVYDEAYRRYREVYAALKPVFSDG
Ga0212093_102146753300022554Hot Spring SedimentVAAGVHPDVASTVAAFVSYRPEEHEPDPSASAVYDEAYARYRRTYEALRPVFALG
Ga0222623_1029545113300022694Groundwater SedimentTVDAFVAYRPEEHEPDPERREAYDEAYRRYRDVYFALKPVFARG
Ga0222622_1011321343300022756Groundwater SedimentTYQPDEHVPDPGRHQAYSEAYRRYRDLYYALKPVFERQAG
Ga0209642_1046733013300025167SoilFVAYRPEEHEPNPEHREAYDEAYRRYRDVYGALRPVFERG
Ga0209321_10001876193300025312SoilVAFRPEEHQPDPERREIYDDAYRRYREVYFALKPVFASG
Ga0209431_1021891543300025313SoilAVEAFVAFRPEEHQPDPERREVYDEAYRRYRDVYFALKPVFASGL
Ga0209323_1078946713300025314SoilADAVEAFVAFRPDEHEPDPERREIYDEAYRRYRDVYFALKPVFALG
Ga0210142_109118713300025552Natural And Restored WetlandsSYRPDEHVPDPECHEVYAQAYRRYRDLYFALKPVFDRAG
Ga0210114_109145313300025795Natural And Restored WetlandsGVHDSVSSAVEAFVRFRPDEHEPDPSTREAYEEAYGRYRAVYGALRGVFGT
Ga0207693_1075395823300025915Corn, Switchgrass And Miscanthus RhizosphereVTVAYRPEEHEPDPERSAAYDEAYGRYRDVYFALKPQFDRG
Ga0207687_1105560423300025927Miscanthus RhizospherePDEHVPDPERHQRYTEAYHRYREVYFALKPVFERGAS
Ga0207669_1044554923300025937Miscanthus RhizosphereHGNVADAVRAFVSYRPDEHEPDGGNRSVYDEAYRRYRQVYRALAPVFAAG
Ga0207661_1102096033300025944Corn RhizosphereATVADAVDAFVAFRPEEHEPDPDRREAYDEAYRRYRDTYFALKPVFATG
Ga0209236_119862323300026298Grasslands SoilAGAFVAYRPDEHQPDPERRAVYDEAYGRYRDVYYALKPVFERV
Ga0209468_120568213300026306SoilAAVGSGVLPDVAAAVSAFVRYRPEEHLPDPEQGAIYDDAYRRYRDVYYALKPMFDG
Ga0209265_114528313300026308SoilAILAAVGSGLQPSVASAVSAFVAYQPDELQPDPERRQVYGDAHKRYREVYFALKPVFNA
Ga0209761_134930023300026313Grasslands SoilPSVAEAVSAFVHYRPEEHVPDAATRAAYDEAYGRYRAVYYALKPVFGA
Ga0209268_110322213300026314SoilAFVEYRTEEHLPDPERHDIYDVAYRRYRDVYFALKPVFERA
Ga0209472_118060623300026323SoilPEGNDPDPSVRDAYDEAYERYRDVYFALKPVFERS
Ga0209470_111365813300026324SoilDAVRSFVRYRPEEHRPDERRREIYEDAYRRYRDVYFALKPVFDG
Ga0209152_1009250423300026325SoilAVGCGLLPNVASAAGAFAQYRPEEHLPDPDRHDIYDEAYRRYRDVYFALKPVFERA
Ga0209377_123957823300026334SoilSAVNAFVRYRPEEHAPDPGRRAVYDEAYRRYRDVYFALKPVFDG
Ga0209804_132215523300026335SoilASAVSAFVAYQPEEHQPDPERRQAYDQAYERYREVYFALKPVFDA
Ga0209808_129678923300026523SoilVGSGVLPDVAAAVSAFVRYRPQEHLPDPERRAIYDDAYRRYRDVYYALKPVFDG
Ga0209807_122776123300026530SoilAVGAGLHRGVADAVGTFVSYRPEEHVPDPEAKEAYEDSYRRYREVYFALKPVFSGS
Ga0208214_10232213300026672SoilGVHASVAEAVAAFVDYQPDEHVPDPERHQRYTDAYRRYRDVYYALKPVFERLDEQAPATT
Ga0208847_10015413300026673SoilTAVGAGVHASVAEAVAAFVDYQPDEHVPDPERHQLYSSAYHRYREVYYALKPVFEKVET
Ga0207479_10289323300026973SoilSYRPEEHQPDPGVRGAYGEAYVRYRKVYASLKPVFADS
Ga0209879_102781313300027056Groundwater SandGILPTVGAAVEAFVSYQPEEHQPAPDVREVYDEAYLRYRKVYASLKPVFSDI
Ga0209846_102310233300027277Groundwater SandVHPTVASAVDAFVAYEPEEHRPDPERQEAYAEAYRRYRDLYFALKPVFAAG
Ga0209995_109297623300027471Arabidopsis Thaliana RhizosphereFRPEEHEPDPATRQAYDDAYGLYREVYFALKPVFPATGES
Ga0209843_105771513300027511Groundwater SandATVAEAVDAFVAYQPEEQVPDPERQERYDDAYRRYRDVYFALKPVFERG
Ga0256866_106565113300027650SoilFVSFRPEEHEPDPGAREAYDEAYRQYRDVYFALKPVFGAS
Ga0209819_1001722453300027722Freshwater SedimentAIVAFRPEEHEPEAERREVYDEAYRRYRDVFFALKPVFARG
Ga0209574_1026897523300027809AgaveAVAAFVDYQPDEHLPDPERHQRYTDAYRRYREVYFALKPVFERLDEPAPASP
Ga0209701_1066660723300027862Vadose Zone SoilVAYRPDEHRPDPERREIYDEAYARYRDVYFALKPVFERA
Ga0209814_1016577213300027873Populus RhizosphereVQAFVAYRRDEHAPDPERREAYDDAYRRYRDLYDALRPVFST
Ga0209283_1035239613300027875Vadose Zone SoilAYQPHEHQPDPERHQAYANAYRRYRDVYFALKPVFERGLHV
Ga0209382_1068598533300027909Populus RhizosphereVAYEPEEHQPDPERRAAYDDAYRRYRDVYYALKPVFKRA
(restricted) Ga0233417_1064222223300028043SedimentVHASVADAVEAFVAFRPEEHEPDPERTEIYDAAYRRYRDVYYALKPVFASG
Ga0268264_1036387313300028381Switchgrass RhizosphereEAVSAFVDYQPDEHVPDPERHQRYTEAYHRYREVYFALKPVFERGAS
Ga0247820_1098225513300028597SoilPDEHVPDPERHQRYTEAYQRYREVYFALKPVFERGAS
Ga0307295_1018168833300028708SoilAAFVHYQPDEHVPDPERHQRYSEAYRRYREVYFALKPVFDRQSS
Ga0307295_1021665723300028708SoilGSVADAVRAFVSYRPDEHEPDGGNRSVYDEAYRRYRQVYRALAPVFAVG
Ga0307322_1003196943300028710SoilADAVAAFVTYQPDEHVPDPGRHQAYSEAYRRYRDLYYALKPVFERQAG
Ga0307319_1013545513300028722SoilSAFVDYQPDEHVPDPERHQRYTEAYHRYRDVYFALKPVFERSDPELPA
Ga0307318_1007585733300028744SoilAVSAFVDYQPTEHVPDPERHQRYTEAYQRYREVYFALKPVFERTGAAPA
Ga0307282_1050368513300028784SoilGAGVHASVADAVDAFVAFQPDEQVPDPERHAAYAEAYRRYRDVYFALKPVFERA
Ga0307282_1059506523300028784SoilHASVAEAVSAFVAYQPDEHVPDPERHQRYTEAYARYRDLYFALKPVFERVEGQPLVSS
Ga0307323_1015381123300028787SoilVGSGVHASVPEAVSAFVDYQPDEHVPDPERHQRYTEAYHRYREVYFALKPVFERGAS
Ga0307287_1017695923300028796SoilARMAAVGAGVHASVAEAVAAFVDYQPDEHVPDPERHQLYSSAYHRYRDVYYALKPVFEKVET
Ga0307281_1044175223300028803SoilRFRPEEHQPDPAAREAYDEAYRRYRDVYFALKPVFSVG
Ga0307305_1013702933300028807SoilAAFVHYQPDEHVPDPERHQHYSEAYRRYREVYFALKPVFDRQSS
Ga0247825_1052092723300028812SoilSVPEAVSAFVDYQPDEHVPDPERHQRYTEAYQRYREVYFALKPVFERGAS
Ga0307302_1047728523300028814SoilSAFVDYQPDEHVPDPERHQRYTEAYHRYREVYFALKPVFELGAS
Ga0307312_1002893413300028828SoilVDAFVAFQPDEQVPDPERHAAYAEAYRRYRDVYFALKPVFERA
Ga0307312_1082083623300028828SoilSFLPDEHRPDPERREAYERAYRKYREVYFALKPVFASG
Ga0307278_1002826013300028878SoilVETFVSFRPEEHQPDAEASESYDDAYGRYRAVYAALAPVFGS
Ga0307300_1035057613300028880SoilDEHGPDPERHQRYTEAYQRYREVYFALKPVFERTGAAPA
Ga0307277_1012511313300028881SoilGVHAGVAEAVAAFVAYQPEEHAPDPERHQRYSEAYRRYRDVYFALKPVFDGQG
Ga0247826_1112596613300030336SoilPEEHQPDPGVREAYDEAYVRYRKVYASLKPVFADS
Ga0299913_1185130813300031229SoilAAVGSGIHGTMAGAVDAFVSFRPEEHEPDPERREIYDEAYRRYRDVYFALKPVFERG
Ga0307405_1104408723300031731RhizosphereDEHVPDPERHQRYTEAYHRYREVYFALKPVFERSPS
Ga0307468_10209186823300031740Hardwood Forest SoilRPDGNEPDLSRRQAYDDAYGRYRDVYFALKPVFEKA
Ga0310907_1070376123300031847SoilAVDAFVSYQPEEHEPDLETREAYDDAYRRYRDVYFALKPTFATG
Ga0307409_10093328933300031995RhizosphereVADAVKAFVSFRPDEHVPDPSAREAYDEAYRRYRDVYFAMKPVFAAG
Ga0307409_10273503923300031995RhizosphereVAEAVDAFVAYQPEEHLPNPERHQRYTEAYRRYRDLYFALKPVFERVEGQPLVSS
Ga0307416_10048620923300032002RhizosphereVDYQPDEHVPDPERHQRYTDAYRRYRDVYYALKPVFERLDEQAPATT
Ga0307416_10063690433300032002RhizosphereDYQPTEHVPDPERHQAYTEAYQRYREVYFALKPVFDRAPS
Ga0268251_1006776433300032159AgaveVGAGVHGNVAEAVAACVAYQPEEHLPEPEAHQAYSDAYRRYREVYFALKPVFERG
Ga0268251_1028806213300032159AgaveHRHGNVAEAVAAFVAYQPQEHRPDPEAHQAYSDAYRRYREVYFALKPVFERG
Ga0307470_1010170013300032174Hardwood Forest SoilVSFRPDEHEPDDGNRSVYDEAYRRYREVYGALAPVFAAG
Ga0307470_1098353113300032174Hardwood Forest SoilKTFVSYRPDGNEPDLSRRQAYDDAYGRYRDVYFALKPVFEKA
Ga0307470_1129883913300032174Hardwood Forest SoilFVSYQPEEHEPDPDTREAYDDAYRRYRDVYFALKPTFATG
Ga0310889_1074300123300032179SoilVGAGLHGSVADAVRAFVSYRPEQHEPVGSNRSAYDEAYRRYRQVYRALAPVFAAG
Ga0214472_1034455813300033407SoilDAFVAFRPEEHEPEPERREIYDEAYRRYRDVYYALKPVFERG
Ga0247830_1138419213300033551SoilILAAVGSGVHSSVADAVSAFVAYQPDEHVPDLETHQRYAVAYRRYRDLYAALKPVFEG
Ga0314869_001880_695_8623300033759PeatlandVGSGVHATVAEAVDAFVRFQPEEHQPDPERREAYDDAYRRYREVYFALKPVFAAG
Ga0364930_0167601_6_1253300033814SedimentVSFQPDEHRPDPERREAYERAYRKYREVYFALKPVFASG
Ga0364930_0319688_2_1423300033814SedimentADAVEAFVAYRPEEHQPDPERREVYDEAYRRYRDVYFALKPVFAAG
Ga0364943_0228249_537_6893300034354SedimentHANVADAVRAFVSYRPEEHEPDDGHRSVYDEAYRRYREVYAALKPVFSDG
Ga0364943_0426139_363_5153300034354SedimentVHSSVADAVSAFVAYQPDEHVPDPETHQRYADAYRRYRDLYAALKPVFEG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.