| Basic Information | |
|---|---|
| Family ID | F020332 |
| Family Type | Metagenome |
| Number of Sequences | 224 |
| Average Sequence Length | 47 residues |
| Representative Sequence | TVDAFVAYRPEEHEPDPERREAYDEAYRRYRDVYFALKPVFARG |
| Number of Associated Samples | 189 |
| Number of Associated Scaffolds | 224 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.83 % |
| % of genes near scaffold ends (potentially truncated) | 93.75 % |
| % of genes from short scaffolds (< 2000 bps) | 90.18 % |
| Associated GOLD sequencing projects | 175 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.946 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (15.625 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.982 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.286 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 224 Family Scaffolds |
|---|---|---|
| PF00202 | Aminotran_3 | 18.75 |
| PF00120 | Gln-synt_C | 13.39 |
| PF13561 | adh_short_C2 | 8.48 |
| PF02720 | DUF222 | 6.70 |
| PF07681 | DoxX | 2.68 |
| PF09350 | DJC28_CD | 2.68 |
| PF00990 | GGDEF | 2.68 |
| PF07722 | Peptidase_C26 | 2.23 |
| PF00106 | adh_short | 2.23 |
| PF07929 | PRiA4_ORF3 | 1.79 |
| PF01418 | HTH_6 | 1.34 |
| PF15919 | HicB_lk_antitox | 1.34 |
| PF14015 | DUF4231 | 1.34 |
| PF01844 | HNH | 1.34 |
| PF07045 | DUF1330 | 0.89 |
| PF00171 | Aldedh | 0.89 |
| PF13520 | AA_permease_2 | 0.89 |
| PF02782 | FGGY_C | 0.89 |
| PF00266 | Aminotran_5 | 0.89 |
| PF00015 | MCPsignal | 0.45 |
| PF12697 | Abhydrolase_6 | 0.45 |
| PF02738 | MoCoBD_1 | 0.45 |
| PF12681 | Glyoxalase_2 | 0.45 |
| PF14023 | DUF4239 | 0.45 |
| PF00809 | Pterin_bind | 0.45 |
| PF02535 | Zip | 0.45 |
| PF00528 | BPD_transp_1 | 0.45 |
| PF01565 | FAD_binding_4 | 0.45 |
| PF00111 | Fer2 | 0.45 |
| PF01435 | Peptidase_M48 | 0.45 |
| PF00117 | GATase | 0.45 |
| PF02080 | TrkA_C | 0.45 |
| PF14622 | Ribonucleas_3_3 | 0.45 |
| PF00196 | GerE | 0.45 |
| PF13432 | TPR_16 | 0.45 |
| PF14325 | DUF4383 | 0.45 |
| PF01321 | Creatinase_N | 0.45 |
| PF01037 | AsnC_trans_reg | 0.45 |
| PF00582 | Usp | 0.45 |
| PF00072 | Response_reg | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 224 Family Scaffolds |
|---|---|---|---|
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 2.68 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 2.68 |
| COG1737 | DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domains | Transcription [K] | 1.34 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.89 |
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 0.89 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.89 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.89 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.89 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.45 |
| COG0428 | Zinc transporter ZupT | Inorganic ion transport and metabolism [P] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.84 % |
| Unclassified | root | N/A | 11.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725001|GPWNP_F5MPXY301COYIG | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 542 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig1246774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300000891|JGI10214J12806_11746970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 547 | Open in IMG/M |
| 3300000956|JGI10216J12902_106400240 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300001537|A2065W1_11211063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 823 | Open in IMG/M |
| 3300001976|JGI24752J21851_1009856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1246 | Open in IMG/M |
| 3300003911|JGI25405J52794_10043587 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300003990|Ga0055455_10110064 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300004114|Ga0062593_100599875 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300004114|Ga0062593_103405603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300004479|Ga0062595_101977363 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005093|Ga0062594_101464851 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005163|Ga0066823_10115970 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005187|Ga0066675_10360341 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300005332|Ga0066388_106158800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300005356|Ga0070674_100505613 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300005440|Ga0070705_101435509 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005444|Ga0070694_101698878 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005445|Ga0070708_101087876 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005446|Ga0066686_11079810 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005450|Ga0066682_10254845 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300005450|Ga0066682_10903695 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005471|Ga0070698_101948668 | Not Available | 541 | Open in IMG/M |
| 3300005518|Ga0070699_100670628 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300005530|Ga0070679_101781190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 564 | Open in IMG/M |
| 3300005540|Ga0066697_10496245 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300005540|Ga0066697_10781720 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005543|Ga0070672_101349819 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005545|Ga0070695_100394286 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300005545|Ga0070695_101240520 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005552|Ga0066701_10069149 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300005552|Ga0066701_10160289 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300005553|Ga0066695_10805436 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005555|Ga0066692_10038550 | All Organisms → cellular organisms → Bacteria | 2587 | Open in IMG/M |
| 3300005557|Ga0066704_10874537 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005560|Ga0066670_10987431 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005561|Ga0066699_10661202 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300005569|Ga0066705_10059120 | All Organisms → cellular organisms → Bacteria | 2178 | Open in IMG/M |
| 3300005574|Ga0066694_10009432 | All Organisms → cellular organisms → Bacteria | 4119 | Open in IMG/M |
| 3300005587|Ga0066654_10201034 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300005614|Ga0068856_101655108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 653 | Open in IMG/M |
| 3300005713|Ga0066905_102201049 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005981|Ga0081538_10134785 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300006041|Ga0075023_100167545 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300006046|Ga0066652_101802714 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006049|Ga0075417_10221155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 901 | Open in IMG/M |
| 3300006058|Ga0075432_10465345 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006794|Ga0066658_10020207 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
| 3300006844|Ga0075428_101409140 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300006844|Ga0075428_101826800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300006844|Ga0075428_102708841 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006847|Ga0075431_101278918 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300006852|Ga0075433_10340143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1326 | Open in IMG/M |
| 3300006852|Ga0075433_10790090 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300006854|Ga0075425_100740151 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300006854|Ga0075425_101496170 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300006871|Ga0075434_100423859 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300006881|Ga0068865_100758439 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300006969|Ga0075419_11313637 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300007076|Ga0075435_101035743 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300007258|Ga0099793_10561693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 570 | Open in IMG/M |
| 3300009012|Ga0066710_100032075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6140 | Open in IMG/M |
| 3300009090|Ga0099827_10270506 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300009090|Ga0099827_11738959 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 543 | Open in IMG/M |
| 3300009094|Ga0111539_13222983 | Not Available | 526 | Open in IMG/M |
| 3300009137|Ga0066709_101367020 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300009137|Ga0066709_101512382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 968 | Open in IMG/M |
| 3300009137|Ga0066709_101658626 | Not Available | 910 | Open in IMG/M |
| 3300009147|Ga0114129_12985371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 557 | Open in IMG/M |
| 3300009157|Ga0105092_10451413 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300009157|Ga0105092_10708875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 586 | Open in IMG/M |
| 3300009162|Ga0075423_10702419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1068 | Open in IMG/M |
| 3300009797|Ga0105080_1013891 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300009808|Ga0105071_1109691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 509 | Open in IMG/M |
| 3300009809|Ga0105089_1029914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
| 3300009809|Ga0105089_1059846 | Not Available | 608 | Open in IMG/M |
| 3300009810|Ga0105088_1111581 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 514 | Open in IMG/M |
| 3300009817|Ga0105062_1038596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 852 | Open in IMG/M |
| 3300009818|Ga0105072_1004078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2407 | Open in IMG/M |
| 3300009822|Ga0105066_1106350 | Not Available | 622 | Open in IMG/M |
| 3300009837|Ga0105058_1041017 | Not Available | 1021 | Open in IMG/M |
| 3300009840|Ga0126313_11855360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300009840|Ga0126313_11863838 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009840|Ga0126313_11871596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300010038|Ga0126315_10038938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2522 | Open in IMG/M |
| 3300010038|Ga0126315_10496870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. 1274761.0 | 778 | Open in IMG/M |
| 3300010040|Ga0126308_11046495 | Not Available | 573 | Open in IMG/M |
| 3300010041|Ga0126312_10764621 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300010336|Ga0134071_10667358 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300010362|Ga0126377_13517603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora kangleipakensis | 506 | Open in IMG/M |
| 3300010375|Ga0105239_10774243 | Not Available | 1099 | Open in IMG/M |
| 3300010396|Ga0134126_11790659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 673 | Open in IMG/M |
| 3300010401|Ga0134121_11765720 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300011000|Ga0138513_100005495 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1425 | Open in IMG/M |
| 3300011264|Ga0151623_1301656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 528 | Open in IMG/M |
| 3300012096|Ga0137389_10232090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1546 | Open in IMG/M |
| 3300012189|Ga0137388_10211707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1751 | Open in IMG/M |
| 3300012198|Ga0137364_10540063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 877 | Open in IMG/M |
| 3300012201|Ga0137365_10022833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4846 | Open in IMG/M |
| 3300012204|Ga0137374_10774264 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300012210|Ga0137378_11037846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 734 | Open in IMG/M |
| 3300012210|Ga0137378_11782822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 520 | Open in IMG/M |
| 3300012285|Ga0137370_10027124 | All Organisms → cellular organisms → Bacteria | 2939 | Open in IMG/M |
| 3300012350|Ga0137372_10066832 | All Organisms → cellular organisms → Bacteria | 3111 | Open in IMG/M |
| 3300012355|Ga0137369_10978471 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012360|Ga0137375_10616320 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300012360|Ga0137375_10874773 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012360|Ga0137375_11182808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300012685|Ga0137397_10041460 | All Organisms → cellular organisms → Bacteria | 3291 | Open in IMG/M |
| 3300012938|Ga0162651_100014116 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300012976|Ga0134076_10267867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 732 | Open in IMG/M |
| 3300013306|Ga0163162_12900737 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 552 | Open in IMG/M |
| 3300014157|Ga0134078_10416938 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300015241|Ga0137418_10879723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 661 | Open in IMG/M |
| 3300017939|Ga0187775_10472108 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300017965|Ga0190266_10451891 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 732 | Open in IMG/M |
| 3300017997|Ga0184610_1281134 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300018028|Ga0184608_10211284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 851 | Open in IMG/M |
| 3300018031|Ga0184634_10119373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1165 | Open in IMG/M |
| 3300018059|Ga0184615_10348358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 820 | Open in IMG/M |
| 3300018061|Ga0184619_10114855 | All Organisms → cellular organisms → Eukaryota | 1216 | Open in IMG/M |
| 3300018071|Ga0184618_10491209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 515 | Open in IMG/M |
| 3300018072|Ga0184635_10059421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1483 | Open in IMG/M |
| 3300018072|Ga0184635_10417765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300018074|Ga0184640_10161776 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 1002 | Open in IMG/M |
| 3300018075|Ga0184632_10402740 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 575 | Open in IMG/M |
| 3300018077|Ga0184633_10544356 | Not Available | 556 | Open in IMG/M |
| 3300018077|Ga0184633_10628397 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300018081|Ga0184625_10466132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 645 | Open in IMG/M |
| 3300018082|Ga0184639_10261157 | Not Available | 914 | Open in IMG/M |
| 3300018082|Ga0184639_10266705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 904 | Open in IMG/M |
| 3300018422|Ga0190265_11630443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
| 3300018466|Ga0190268_12259090 | Not Available | 511 | Open in IMG/M |
| 3300018469|Ga0190270_12918493 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300018482|Ga0066669_12333178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
| 3300021082|Ga0210380_10068818 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 1544 | Open in IMG/M |
| 3300021082|Ga0210380_10303640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 727 | Open in IMG/M |
| 3300022554|Ga0212093_1021467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4777 | Open in IMG/M |
| 3300022694|Ga0222623_10295451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 622 | Open in IMG/M |
| 3300022756|Ga0222622_10113213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1692 | Open in IMG/M |
| 3300025167|Ga0209642_10467330 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 700 | Open in IMG/M |
| 3300025312|Ga0209321_10001876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14237 | Open in IMG/M |
| 3300025313|Ga0209431_10218915 | Not Available | 1502 | Open in IMG/M |
| 3300025314|Ga0209323_10789467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300025552|Ga0210142_1091187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
| 3300025795|Ga0210114_1091453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300025915|Ga0207693_10753958 | Not Available | 752 | Open in IMG/M |
| 3300025927|Ga0207687_11055604 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300025937|Ga0207669_10445549 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 1025 | Open in IMG/M |
| 3300025944|Ga0207661_11020960 | Not Available | 762 | Open in IMG/M |
| 3300026298|Ga0209236_1198623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 764 | Open in IMG/M |
| 3300026306|Ga0209468_1205682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300026308|Ga0209265_1145283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 607 | Open in IMG/M |
| 3300026313|Ga0209761_1349300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300026314|Ga0209268_1103222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 773 | Open in IMG/M |
| 3300026323|Ga0209472_1180606 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300026324|Ga0209470_1113658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1206 | Open in IMG/M |
| 3300026325|Ga0209152_10092504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1130 | Open in IMG/M |
| 3300026334|Ga0209377_1239578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
| 3300026335|Ga0209804_1322155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 521 | Open in IMG/M |
| 3300026523|Ga0209808_1296789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
| 3300026530|Ga0209807_1227761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 636 | Open in IMG/M |
| 3300026672|Ga0208214_102322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 775 | Open in IMG/M |
| 3300026673|Ga0208847_100154 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300026973|Ga0207479_102893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300027277|Ga0209846_1023102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1011 | Open in IMG/M |
| 3300027471|Ga0209995_1092976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300027511|Ga0209843_1057715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 679 | Open in IMG/M |
| 3300027650|Ga0256866_1065651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 968 | Open in IMG/M |
| 3300027722|Ga0209819_10017224 | All Organisms → cellular organisms → Bacteria | 2375 | Open in IMG/M |
| 3300027809|Ga0209574_10268975 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300027862|Ga0209701_10666607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
| 3300027873|Ga0209814_10165772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 950 | Open in IMG/M |
| 3300027875|Ga0209283_10352396 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300027909|Ga0209382_10685985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1104 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10642222 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300028381|Ga0268264_10363873 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300028597|Ga0247820_10982255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 602 | Open in IMG/M |
| 3300028708|Ga0307295_10181688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 592 | Open in IMG/M |
| 3300028708|Ga0307295_10216657 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 545 | Open in IMG/M |
| 3300028710|Ga0307322_10031969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1248 | Open in IMG/M |
| 3300028722|Ga0307319_10135455 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300028744|Ga0307318_10075857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1125 | Open in IMG/M |
| 3300028784|Ga0307282_10503685 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300028784|Ga0307282_10595065 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300028787|Ga0307323_10153811 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300028796|Ga0307287_10176959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 810 | Open in IMG/M |
| 3300028803|Ga0307281_10441752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
| 3300028807|Ga0307305_10137029 | Not Available | 1130 | Open in IMG/M |
| 3300028812|Ga0247825_10520927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 847 | Open in IMG/M |
| 3300028814|Ga0307302_10477285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 618 | Open in IMG/M |
| 3300028828|Ga0307312_10028934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3215 | Open in IMG/M |
| 3300028828|Ga0307312_10820836 | Not Available | 616 | Open in IMG/M |
| 3300028878|Ga0307278_10028260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2572 | Open in IMG/M |
| 3300028880|Ga0307300_10350576 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300028881|Ga0307277_10125113 | Not Available | 1104 | Open in IMG/M |
| 3300030336|Ga0247826_11125966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300031229|Ga0299913_11851308 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031731|Ga0307405_11044087 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300031740|Ga0307468_102091868 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031847|Ga0310907_10703761 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 559 | Open in IMG/M |
| 3300031995|Ga0307409_100933289 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300031995|Ga0307409_102735039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
| 3300032002|Ga0307416_100486209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides dokdonensis → Nocardioides dokdonensis FR1436 | 1295 | Open in IMG/M |
| 3300032002|Ga0307416_100636904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1149 | Open in IMG/M |
| 3300032159|Ga0268251_10067764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1209 | Open in IMG/M |
| 3300032159|Ga0268251_10288062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300032174|Ga0307470_10101700 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 1648 | Open in IMG/M |
| 3300032174|Ga0307470_10983531 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300032174|Ga0307470_11298839 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 596 | Open in IMG/M |
| 3300032179|Ga0310889_10743001 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 514 | Open in IMG/M |
| 3300033407|Ga0214472_10344558 | All Organisms → cellular organisms → Eukaryota | 1409 | Open in IMG/M |
| 3300033551|Ga0247830_11384192 | Not Available | 562 | Open in IMG/M |
| 3300033759|Ga0314869_001880 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 872 | Open in IMG/M |
| 3300033814|Ga0364930_0167601 | Not Available | 749 | Open in IMG/M |
| 3300033814|Ga0364930_0319688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 521 | Open in IMG/M |
| 3300034354|Ga0364943_0228249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300034354|Ga0364943_0426139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes aureus | 515 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.04% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.70% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 5.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.57% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.23% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.79% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.34% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.34% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.34% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.34% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.89% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.45% |
| Sediment | Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment | 0.45% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.45% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.45% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.45% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.45% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725001 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009797 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011264 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022554 | Dewar_combined assembly | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026672 | Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026673 | Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1116 (SPAdes) | Environmental | Open in IMG/M |
| 3300026973 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-C (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033759 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_B | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWNP_01740190 | 2067725001 | Soil | CGDPGRAGVRLHAGVADAVNAFVAYRPDQHEPDAVTRRAYDEAYRRYRGVYGALRPVFAT |
| KansclcFeb2_12328200 | 2124908045 | Soil | FVAYEPEEHQPDPDRQEAYAEAYGRYRDLYFALKPVFGTG |
| JGI10213J12805_101800332 | 3300000858 | Soil | GAAVKAFVSYQPEEHRPDPDVREVYDEAYVRYRKVYASLRPVFSDG* |
| JGI10214J12806_117469701 | 3300000891 | Soil | VDAFVSYQPEEHEPDPDTREAYDDAYRRYRDVYFALKPTFAAG* |
| JGI10216J12902_1064002401 | 3300000956 | Soil | AVDAFVAFRPDAHEPDPGRAGIYEEAYRRYRDVYFALKPVFSAG* |
| A2065W1_112110632 | 3300001537 | Permafrost | AGAFVSYRPDEHQPDAERREIYNEAYGRYRDVYFALKPVFERA* |
| JGI24752J21851_10098562 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | HGNVADAVKAFVSYRPDEHEPDGGNRSVYDEAYQRYRQVYGALAPVFAAG* |
| JGI25405J52794_100435871 | 3300003911 | Tabebuia Heterophylla Rhizosphere | VKAFVAFRPDEHQPDPEHRDAYDDGYRRYRDLYAALRPVFDG* |
| Ga0055455_101100641 | 3300003990 | Natural And Restored Wetlands | VDAFVSYRPDEHVPDPECHEVYAQAYRRYRDLYFALKPVFDRAG* |
| Ga0062593_1005998752 | 3300004114 | Soil | AAAAFVSYRPEEHEPDPGRAAAYEEAYRRYREVYFALKPVFA* |
| Ga0062593_1034056031 | 3300004114 | Soil | VHGTVADAVNAFVAYRPDEHAPDPERREIYDDAYRRYRDVYGALAPVFMS* |
| Ga0062595_1019773632 | 3300004479 | Soil | GSGLHGSVAKAVDAFVAYQPGEQLPDPERHQRYASAYRRYREVYFALKPVFDRP* |
| Ga0062594_1014648513 | 3300005093 | Soil | IGDATRAFVRFRPEGHEPDPAVRDAYDAAYRRYREVYFALKPVFSSV* |
| Ga0066823_101159702 | 3300005163 | Soil | VSYQPEEHEPDPETREAYDDAYRRYRDVYFALKPTFATG* |
| Ga0066688_104164243 | 3300005178 | Soil | DAVESFVAYRPQQHSSDPERHQLYDEAYSRYRDVYFALKPIFDHGGLNA* |
| Ga0066675_103603412 | 3300005187 | Soil | HATVADAVRAFVSYRPEGHDPEPSVRDAYDEAYARYRDVYFALKPVFERS* |
| Ga0066388_1061588002 | 3300005332 | Tropical Forest Soil | TIDDAVRSFVRFRPDGHDPDPSAREAYDEAYRRYREVYFALKPVFAAG* |
| Ga0070674_1005056132 | 3300005356 | Miscanthus Rhizosphere | HGNVADAVRAFVSYRPDEHEPDGGNRSVYDEAYRRYRQVYRALAPVFAAG* |
| Ga0070705_1014355092 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GVADAVDAFVSFRPEEHEPEPAAAEAYDEAYRRYRELYFALVPVFGT* |
| Ga0070694_1016988781 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | KAFVRYLPQGHEPDPERQAVYDAAYRRYRDVYFALKPVFDS* |
| Ga0070708_1010878761 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VADAVDAFVAFRPEQHQPDPERREIYDEAYRRYRDVYFALKPVFAAG* |
| Ga0066686_110798102 | 3300005446 | Soil | AEAVGAFVAYEPDEHLPDPGRQEAYAEAYARYRDVYFALKPVFEGGSIG* |
| Ga0066682_102548452 | 3300005450 | Soil | AGVLPTVAEAVSAFVRYRPEEHTPDPERQAIYDDAYRRYRDVYYALKPVFDA* |
| Ga0066682_109036951 | 3300005450 | Soil | GAGVFPDVGSAVNAFVRYRPEEHAPDPGRRAVYDEAYRRYRDVYFALKPVFDG* |
| Ga0070698_1019486682 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AFVSFRPEEHEPDPAARDAYDDAYGLYREVYFALKPVFPATGES* |
| Ga0070699_1006706281 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AAVEAFVSYRPEEHQPDPGVREAYDEAYVRYRKVYASLKPVFSDG* |
| Ga0070679_1017811902 | 3300005530 | Corn Rhizosphere | AYQPHEHTPDPQNRAAYDDAYGRYRDLYFSLKPVFERGARG* |
| Ga0066697_104962452 | 3300005540 | Soil | EAVSAFVRYRPEEHTPDPERQAIYDDAYRRYRDVYYALKPVFDA* |
| Ga0066697_107817201 | 3300005540 | Soil | AFVSYRPDEHLPDPERHAMYDEAYRRYRDVYFALKPLFDRA* |
| Ga0070672_1013498191 | 3300005543 | Miscanthus Rhizosphere | AFVAFRPEEHEPDPDRREAYDEAYRRYRDTYFALKPVFATG* |
| Ga0070695_1003942861 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ILAAVGGGVQPSVAEAVRAFVRYRPEEHQPDQGRRQLYDDAYRRYRDVYFALKPVFDG* |
| Ga0070695_1012405202 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAVGGEVQPTVADAVRAFVRYQPDEHAPDPQRRETYDAAYRRYRDVYFALKPVFDT* |
| Ga0066701_100691493 | 3300005552 | Soil | AAGAFVEYRTEEHLPDPERHDIYDVAYRRYRDVYFALKPVFERA* |
| Ga0066701_101602893 | 3300005552 | Soil | AAAVDAFVAYRPEEHTPDPERRRFYDDAYRRYREVYFALKPVFDT* |
| Ga0066701_104661431 | 3300005552 | Soil | AGVRATVSDAVESFVAYRPQQHSSDPERHQLYDEAYSRYRDVYFALKPIFDKGGLKA* |
| Ga0066695_108054362 | 3300005553 | Soil | VAYRPEEHTPDPERRRFYDDAYRRYREVYFALKPVFDT* |
| Ga0066692_100385504 | 3300005555 | Soil | NAFVRYRPEEHAPDPGRRAVYDEAYRRYRDVYFALKPVFDG* |
| Ga0066704_108745371 | 3300005557 | Soil | LPSVAEAVSAFVHYRPEEHVPDAATRAAYDEAYGRYRAVYYALKPVFGA* |
| Ga0066670_109874312 | 3300005560 | Soil | LAAVGSGLFPSVAAAVDAFVAYRPEEHTPDPERRRFYDDAYRRYREVYFALKPVFDT* |
| Ga0066699_106612021 | 3300005561 | Soil | FVSFRPEEHVPDPEAEQSYEDAYRRYRDLYYALKPVFSGS* |
| Ga0066705_100591201 | 3300005569 | Soil | ILAAVGSGLQPSVASAVSAFVAYQPDELQPDPERRQVYGDAYKRYREVYFALKPVFNA* |
| Ga0066694_100094321 | 3300005574 | Soil | GAFVEYRTEEHLPDPERHDIYDVAYRRYRDVYFALKPVFERA* |
| Ga0066654_102010342 | 3300005587 | Soil | DVAAAVSAFVRYGPQEHLPDPERRAIYDDAYRRYRDVYYALKPVFDG* |
| Ga0068856_1016551081 | 3300005614 | Corn Rhizosphere | VADAVRAFVRYQPDEHAPDPQQREVYDAAYRRYRDVYFALKPVFDT* |
| Ga0066905_1022010491 | 3300005713 | Tropical Forest Soil | AVGSGVHGTIADAVKSFVAFRPEEHQPDPAARDAYDEAYARYREVYFALKPVFEAV* |
| Ga0081538_101347853 | 3300005981 | Tabebuia Heterophylla Rhizosphere | AVEAFVDYQPDEHVPDPERHQAYTEAYRRYRDVYFALKPVFERGPG* |
| Ga0075023_1001675451 | 3300006041 | Watersheds | AVEAFAAYQPDEHQPDPDRRQIYDEAYGRYRDVYFALKPVFDRA* |
| Ga0066652_1018027141 | 3300006046 | Soil | VGSGVLPSVAEAVSAFVHYRPEEHVPDAATRAAYDEAYGRYRAVYYALKPVFGA* |
| Ga0075417_102211551 | 3300006049 | Populus Rhizosphere | VQAFVAYRRDEHAPDPERREAYDDAYRRYRDLYDALRPVFST* |
| Ga0075432_104653451 | 3300006058 | Populus Rhizosphere | PEAVSAFVDYQPDEHVPDPERHQRYTEAYQRYREVYFALKPVFERGAS* |
| Ga0066658_100202074 | 3300006794 | Soil | AVGCGLLPNVASAAGAFAQYRPEEHLPDPDRHDIYDEAYRRYRDVYFALKPVFERA* |
| Ga0075428_1014091401 | 3300006844 | Populus Rhizosphere | AAFVTYEPDEHLPDPERHQAYSEAYRRYRDVYYALKPVFGREAAVG* |
| Ga0075428_1018268001 | 3300006844 | Populus Rhizosphere | FRPEEHAPDPAAQEAYDEAYTRYRDVYFALKPVFSS* |
| Ga0075428_1027088412 | 3300006844 | Populus Rhizosphere | ILAAVASGVHTTVADAVSAFVAYRPDEHQPDPERREVYDEAYRRYRGLYAALGPVFSA* |
| Ga0075431_1012789182 | 3300006847 | Populus Rhizosphere | GSGVHASVPEAVSAFVDYQPDEHVPDPERHQRYTEAYHRYREVYFALKPVFERGAS* |
| Ga0075433_103401432 | 3300006852 | Populus Rhizosphere | VHATVTDAVQAFVAYRRDEHAPDPERREAYDDAYRRYRDLYDALRPVFST* |
| Ga0075433_107900903 | 3300006852 | Populus Rhizosphere | HASVAEAVAAFVAYQPDEHVPDPGRHQRYSEAYARYRELYFALKPVFEAGAG* |
| Ga0075425_1007401511 | 3300006854 | Populus Rhizosphere | GSGVHGSVRDAVASFVRFRPEEHAPDPEAHEAYDEAYRRYRDVYFALKPVFASG* |
| Ga0075425_1014961702 | 3300006854 | Populus Rhizosphere | AILAAVGGGVQPSVAEAVKAFVRYRPEEHQPEAARRSSYDAAYRRYRDVYFALKPVFDG* |
| Ga0075434_1004238591 | 3300006871 | Populus Rhizosphere | LAAVGGEVQPAVADAVRAFVRYQPEEHAPDPQRRETYDAAYRRYRDVYFALKPVFDT* |
| Ga0068865_1007584392 | 3300006881 | Miscanthus Rhizosphere | GLHSSVAEAVAAFVRFRPESHDPDPATAAAYDDAYARYRSVYSALRPVFGT* |
| Ga0075419_113136372 | 3300006969 | Populus Rhizosphere | AAFVAYQPDEQVPDHGRHQAYDEAYRRYRDVYFSLKPAFQG* |
| Ga0075435_1010357431 | 3300007076 | Populus Rhizosphere | PSVAEAVRAFVRYRQEEHQPDEGRRAIYEDAYRLYRDVYFALKPVFDG* |
| Ga0099793_105616932 | 3300007258 | Vadose Zone Soil | ASAAAAFVKYRPEEHAPDAENGQAYDEAYRRYRDVYFALKPVFERG* |
| Ga0066710_1000320751 | 3300009012 | Grasslands Soil | ILAAVGSGLQPSVASAVSAFVAYQPDELQPDPERRQVYGDAHKRYREVYFALKPVFNA |
| Ga0099827_102705061 | 3300009090 | Vadose Zone Soil | YAPEEHVPDPEQSAAYETAYRRYREVYYALKPVFDA* |
| Ga0099827_117389591 | 3300009090 | Vadose Zone Soil | EEHEPDPRTREAYDEAYRRYRDVYFALKPVFTTG* |
| Ga0111539_132229831 | 3300009094 | Populus Rhizosphere | GSGVHASVAEAVAAFVAYQPDEHVPDPERHQRYSDAYHRYRDLYFALKPVFERVDGLPPTSP* |
| Ga0066709_1013670201 | 3300009137 | Grasslands Soil | QEGEHEPDPSVQDVYDEAYARYRAVYFALKPVFGA* |
| Ga0066709_1015123822 | 3300009137 | Grasslands Soil | RYRPQEHLPDPERRAMYDDAYRRYRDVYYALKPVFDG* |
| Ga0066709_1016586263 | 3300009137 | Grasslands Soil | GTIVEAVDAFVRFRPDQHLPDPEAHTAYENAYRRYRDVYFALKPVFAAG* |
| Ga0114129_129853712 | 3300009147 | Populus Rhizosphere | AGAVEAIVAFRPEEHEPQAERREVYDEAYRRYRDVFFALKPVFAHG* |
| Ga0105092_104514132 | 3300009157 | Freshwater Sediment | EAIVAFRPEEHEPEAERREVYDEAYRRYRDVFFALKPVFARG* |
| Ga0105092_107088751 | 3300009157 | Freshwater Sediment | VADAVDAFVAYRPEQHEPDPERREVYDEAYRRYRNTYAALKPVFAGG* |
| Ga0075423_107024191 | 3300009162 | Populus Rhizosphere | GVHTTVADAVRAFVAYRPDEHRPDPERREVYDEAYRRYRDVYSALVPVFSA* |
| Ga0105080_10138913 | 3300009797 | Groundwater Sand | EEQVPDPERRERYDDAYRRYRDVYFAMKPVFERG* |
| Ga0105071_11096911 | 3300009808 | Groundwater Sand | SDVHATVADAVRAFVAYRPEEHEPDQERREIYDEAHRRYRDTYFALKPVFAAAPA* |
| Ga0105089_10299142 | 3300009809 | Groundwater Sand | YRPEEHQPDPGVREAYDVAYVRYRKVYASLKPVFADS* |
| Ga0105089_10598462 | 3300009809 | Groundwater Sand | ADAVAAFVSFQPEEHRPDPERREAYERAYAKYREVYFALKPVFASG* |
| Ga0105088_11115812 | 3300009810 | Groundwater Sand | VADAVNAFVAYRPEQHEPDEVTRTAYDEAYRRYRGVYAALRPVFATA* |
| Ga0105084_10057643 | 3300009811 | Groundwater Sand | ILPTVGAAVEAFVSYQPEEHQPAPDVREVYDEAYLRYRKVYASLKPVFSDI* |
| Ga0105062_10385962 | 3300009817 | Groundwater Sand | EAFVSYRPEEHQPDPGVREAYDDAYVRYRKVYASLKPVFADG* |
| Ga0105072_10040783 | 3300009818 | Groundwater Sand | YQPEEHRPDPDVREVYDEAYARYRKLYASLKPVFSDS* |
| Ga0105066_11063502 | 3300009822 | Groundwater Sand | TAFVSFQPEEHRPDPERREAYERAYRKYREVYFALNPVFASG* |
| Ga0105058_10410173 | 3300009837 | Groundwater Sand | SFQPEEHRPDPERREAYERAYRKYREVYFALKPVFASG* |
| Ga0126313_118553601 | 3300009840 | Serpentine Soil | VEAFVTYQPDEHVPDPGRHQAYSEAYRRYRDLYYALKPVFERQAG* |
| Ga0126313_118638381 | 3300009840 | Serpentine Soil | QPDEHVPDPERHQRYTEAYQRYREVYFALKPVFERTGAAPA* |
| Ga0126313_118715961 | 3300009840 | Serpentine Soil | EEHQPDPEASAVYDAAYALYRDVYAAAKPVFERHAGA* |
| Ga0126315_100389383 | 3300010038 | Serpentine Soil | VHAGVAEAVAAFVDYQPEEHVPDPERHAAYTSAYHRYREVYYALKPVFEKVET* |
| Ga0126315_104968701 | 3300010038 | Serpentine Soil | VEAFVTYQPDEHVPDPERHQAYSEAYRRYRDLYYALKPVFERQAG* |
| Ga0126308_110464952 | 3300010040 | Serpentine Soil | AVAAFVTYQPEEHIPDPGRHQAYSEAYRRYREVYYALKPVFGREAAAG* |
| Ga0126312_107646211 | 3300010041 | Serpentine Soil | AAEQFVSFLPEEHQPDPEASAVYDAAYALYRDVYAAAKPVFERHAGA* |
| Ga0134071_106673581 | 3300010336 | Grasslands Soil | AVGAGLHGTVADAVNAFVAFRPEEHQPDPERREIYDEAYRRYRDVYFALKPVFAAG* |
| Ga0126377_135176031 | 3300010362 | Tropical Forest Soil | SVAEAVEAFVAFQPEEEVPDPDRQAAYDDAYRRYRELYFALKPVFESA* |
| Ga0105239_107742433 | 3300010375 | Corn Rhizosphere | AGVHATVADAVDAFVAFRPEEHEPDPDRREAYDEAYRRYRDTYFALKPVFATG* |
| Ga0134126_117906592 | 3300010396 | Terrestrial Soil | VASAAGAFVAYRPDEHQPDPERRAIYDEAYGRYRDVYYALKPVFERV* |
| Ga0134121_117657202 | 3300010401 | Terrestrial Soil | FVAYQPHEHTPDPQNRAAYDDAYGRYRDLYFSLKPVFERGARG* |
| Ga0138513_1000054953 | 3300011000 | Soil | GVHSSVADAVSAFVAYQPDEHVPDPERHQRYTEAYHRYREVYFALKPVFELGAS* |
| Ga0151623_13016561 | 3300011264 | Sediment | VAGAVEAFVSFQPEVHEPDPERHDAYGEAYRRYRDVYFALKPVFDSR* |
| Ga0137389_102320903 | 3300012096 | Vadose Zone Soil | VSYRPEGHEPDLSSRQAYDDAYGRYRDVYFTLKPVFEKA* |
| Ga0137388_102117071 | 3300012189 | Vadose Zone Soil | ILPSVAAAVEAFVSYQPHEHQPDPQRHHAYAEAYGRYRDVYFALKPVFEQGAGA* |
| Ga0137364_105400631 | 3300012198 | Vadose Zone Soil | AAVSAFVRYRPQEHLPDPERRAIYDDAYRRYRDVYYALKPVFDG* |
| Ga0137365_100228331 | 3300012201 | Vadose Zone Soil | AVAAFVAYQPTEHLPDPDRQQRYADAYRRYREVYFALKPVFARG* |
| Ga0137374_107742642 | 3300012204 | Vadose Zone Soil | FVAYQPEEQVPDPERQERYDDAYRRYRDVYFALKPVFERG* |
| Ga0137378_110378462 | 3300012210 | Vadose Zone Soil | AVGSGVLPDVAAAVSAFVRYRPEEHLPDPERRAIYDDAYRRYRDVYYALKPVFDG* |
| Ga0137378_117828222 | 3300012210 | Vadose Zone Soil | VGSGLHSTIADAVEAFVRFRPEEHVPDPEAAAAYEDAYRRYREVYFALKPVFAAG* |
| Ga0137370_100271244 | 3300012285 | Vadose Zone Soil | PDVAAAVSAFVRYGPEEHLPNPEQGAIYDDAYRRYRDVYYALKPVFDG* |
| Ga0137372_100668323 | 3300012350 | Vadose Zone Soil | VTEAVRAFVTYQPEEHQPDDGSHQAYEEPYRRYRDVYFALKPVFEGS* |
| Ga0137369_109784712 | 3300012355 | Vadose Zone Soil | AEAVDAFVAYQPEEQVPDPERQERYDDAYRRYRDVYFALKPVFERG* |
| Ga0137375_106163203 | 3300012360 | Vadose Zone Soil | GVHASVAEAVASFVSFQPDEHRPDPEQQEAYEPAYRKYREVYFALKPVFASG* |
| Ga0137375_108747731 | 3300012360 | Vadose Zone Soil | HPIVASAVDSFVADEPEAPQPDPDRQQAYAEAYGRYRDLYFALKPVFGAG* |
| Ga0137375_111828081 | 3300012360 | Vadose Zone Soil | ASAVDAFVAYEPEEHRPDPDRQEAYAEAYRRYRDLYFALKPVFAAG* |
| Ga0137397_100414604 | 3300012685 | Vadose Zone Soil | DIASAATAFVQYRPEEHVPDAANAQIYDEAYRRYRDVYFALKPVFERA* |
| Ga0162651_1000141164 | 3300012938 | Soil | VHASVPEAVSAFVDYQPTEHVPDPERHQRYTEAYHRYREVYFALKPVFERSDRELPA* |
| Ga0134076_102678671 | 3300012976 | Grasslands Soil | SAVDAFVAFEPEEHRPDPERHEAYEEAYRRYRDLYFALKPVFAAG* |
| Ga0163162_129007371 | 3300013306 | Switchgrass Rhizosphere | SGLHGNVADAVRAFVSYRPDEHEPDGGNRSVYDEAYRRYRQVYRALAPVFAAG* |
| Ga0134078_104169381 | 3300014157 | Grasslands Soil | VHPGIAEAVDAFVAYRPEEHVPDPERSEAYTAAYRRYRELYFALKPVFERA* |
| Ga0137418_108797231 | 3300015241 | Vadose Zone Soil | AATAFVQYRPEEHVPDAGHAQVYDEAYRRYRDVYYALKPVFERA* |
| Ga0187775_104721082 | 3300017939 | Tropical Peatland | DAVETFVRFQPDEHQPDPERREAYDEAYRRYREVYFALKPVFAAG |
| Ga0190266_104518912 | 3300017965 | Soil | ADAVNAFVAYRPEQHEPDELTRAGYDEAYRRYRGVYAALRPVFATG |
| Ga0184610_12811342 | 3300017997 | Groundwater Sediment | VGAEVHSSVAEAVEAFVAYRPGEQVPDPERREQYADAYRRYRDLYFTLKPIFDRP |
| Ga0184608_102112841 | 3300018028 | Groundwater Sediment | GAFVSYRPDEHRPDPERQEIYNEAYARYRDVYFALKPVFERA |
| Ga0184634_101193733 | 3300018031 | Groundwater Sediment | AAVASDVHPTVAGAVEAFVSYEPEEHHPDPGNREAYDEAYRRYRDVYFALKPVFDGA |
| Ga0184615_103483583 | 3300018059 | Groundwater Sediment | YRPEEHQPDPERREVYDEAYRRYRDVYFALKPVFARG |
| Ga0184619_101148551 | 3300018061 | Groundwater Sediment | AAFVAFRPEEHVPDPEASEAYDDAYRRYRDVYFALKPVFSAG |
| Ga0184618_104912092 | 3300018071 | Groundwater Sediment | VDAFVAFRPEEHEPDPERREVYNEAYRRYRDVYFALKPVFAAG |
| Ga0184635_100594212 | 3300018072 | Groundwater Sediment | AAVEAFVSYRPEEHQPDPGVREAYDEAYVRYRKVYASLKPVFSDS |
| Ga0184635_104177652 | 3300018072 | Groundwater Sediment | VRAFVSYRRDEHEPDDGHRSVYDEAYRRYREVYAALKPVFSDG |
| Ga0184640_101617761 | 3300018074 | Groundwater Sediment | RAFVSYRPAEHEPDGGNRSVYDEAYRRYRQVYRALAPVFAAG |
| Ga0184632_104027401 | 3300018075 | Groundwater Sediment | GLHGSVADAVNAFVAYRPEQHEPDDVTRTAYDEAYRRYRGVYAALRPVFSTG |
| Ga0184633_105443561 | 3300018077 | Groundwater Sediment | FQPDEHRPDPERREAYERAYRKYREVYFALKPVFASG |
| Ga0184633_106283972 | 3300018077 | Groundwater Sediment | FVSFQPDEHRPDPERREAYERAYRKYREVYFALKPVFASGE |
| Ga0184625_104661322 | 3300018081 | Groundwater Sediment | AVGSGVHASVPEAVSAFVDYQPDEHVPDPERHQRYTEAYHRYREVYFALKPVFERAGG |
| Ga0184639_102611573 | 3300018082 | Groundwater Sediment | AFVSFQPDEHRPDPERREAYERAYRKYREVYFALKPVFASG |
| Ga0184639_102667052 | 3300018082 | Groundwater Sediment | DAVMAFVSYEPEEHQPDPERRAAYDEAYRRYRDVYFALKPVFVSG |
| Ga0190265_116304433 | 3300018422 | Soil | SFRPDEHEPDAGTRQAYDDAYERYREVYFALKPVFPATGES |
| Ga0190268_122590901 | 3300018466 | Soil | VEAFVTYQPDEHVPDPERHQAYSEAYRHYRDLYYALKPVFERQAAG |
| Ga0190270_129184932 | 3300018469 | Soil | FVSFRPEEHEPDPKNRAAYDEAYNRYREVYFALKPVYEPK |
| Ga0190274_102671443 | 3300018476 | Soil | TVGAAVEAFVSYQPEEHRPDPDVREMYDEAYVRYRKVYASLKPVFSDS |
| Ga0066669_123331782 | 3300018482 | Grasslands Soil | YRPEEHVPDPERSEAYTAAYRRYRELYFALKPVFERA |
| Ga0210380_100688181 | 3300021082 | Groundwater Sediment | AGVHATVADAVDAFVSYQPEEHEPDPETREAYDDAYRRYRDVYFALKPTFATG |
| Ga0210380_103036402 | 3300021082 | Groundwater Sediment | ILAAVASGLHANVADAVRAFVSYRPDEHEPDDGHRSVYDEAYRRYREVYAALKPVFSDG |
| Ga0212093_10214675 | 3300022554 | Hot Spring Sediment | VAAGVHPDVASTVAAFVSYRPEEHEPDPSASAVYDEAYARYRRTYEALRPVFALG |
| Ga0222623_102954511 | 3300022694 | Groundwater Sediment | TVDAFVAYRPEEHEPDPERREAYDEAYRRYRDVYFALKPVFARG |
| Ga0222622_101132134 | 3300022756 | Groundwater Sediment | TYQPDEHVPDPGRHQAYSEAYRRYRDLYYALKPVFERQAG |
| Ga0209642_104673301 | 3300025167 | Soil | FVAYRPEEHEPNPEHREAYDEAYRRYRDVYGALRPVFERG |
| Ga0209321_1000187619 | 3300025312 | Soil | VAFRPEEHQPDPERREIYDDAYRRYREVYFALKPVFASG |
| Ga0209431_102189154 | 3300025313 | Soil | AVEAFVAFRPEEHQPDPERREVYDEAYRRYRDVYFALKPVFASGL |
| Ga0209323_107894671 | 3300025314 | Soil | ADAVEAFVAFRPDEHEPDPERREIYDEAYRRYRDVYFALKPVFALG |
| Ga0210142_10911871 | 3300025552 | Natural And Restored Wetlands | SYRPDEHVPDPECHEVYAQAYRRYRDLYFALKPVFDRAG |
| Ga0210114_10914531 | 3300025795 | Natural And Restored Wetlands | GVHDSVSSAVEAFVRFRPDEHEPDPSTREAYEEAYGRYRAVYGALRGVFGT |
| Ga0207693_107539582 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVAYRPEEHEPDPERSAAYDEAYGRYRDVYFALKPQFDRG |
| Ga0207687_110556042 | 3300025927 | Miscanthus Rhizosphere | PDEHVPDPERHQRYTEAYHRYREVYFALKPVFERGAS |
| Ga0207669_104455492 | 3300025937 | Miscanthus Rhizosphere | HGNVADAVRAFVSYRPDEHEPDGGNRSVYDEAYRRYRQVYRALAPVFAAG |
| Ga0207661_110209603 | 3300025944 | Corn Rhizosphere | ATVADAVDAFVAFRPEEHEPDPDRREAYDEAYRRYRDTYFALKPVFATG |
| Ga0209236_11986232 | 3300026298 | Grasslands Soil | AGAFVAYRPDEHQPDPERRAVYDEAYGRYRDVYYALKPVFERV |
| Ga0209468_12056821 | 3300026306 | Soil | AAVGSGVLPDVAAAVSAFVRYRPEEHLPDPEQGAIYDDAYRRYRDVYYALKPMFDG |
| Ga0209265_11452831 | 3300026308 | Soil | AILAAVGSGLQPSVASAVSAFVAYQPDELQPDPERRQVYGDAHKRYREVYFALKPVFNA |
| Ga0209761_13493002 | 3300026313 | Grasslands Soil | PSVAEAVSAFVHYRPEEHVPDAATRAAYDEAYGRYRAVYYALKPVFGA |
| Ga0209268_11032221 | 3300026314 | Soil | AFVEYRTEEHLPDPERHDIYDVAYRRYRDVYFALKPVFERA |
| Ga0209472_11806062 | 3300026323 | Soil | PEGNDPDPSVRDAYDEAYERYRDVYFALKPVFERS |
| Ga0209470_11136581 | 3300026324 | Soil | DAVRSFVRYRPEEHRPDERRREIYEDAYRRYRDVYFALKPVFDG |
| Ga0209152_100925042 | 3300026325 | Soil | AVGCGLLPNVASAAGAFAQYRPEEHLPDPDRHDIYDEAYRRYRDVYFALKPVFERA |
| Ga0209377_12395782 | 3300026334 | Soil | SAVNAFVRYRPEEHAPDPGRRAVYDEAYRRYRDVYFALKPVFDG |
| Ga0209804_13221552 | 3300026335 | Soil | ASAVSAFVAYQPEEHQPDPERRQAYDQAYERYREVYFALKPVFDA |
| Ga0209808_12967892 | 3300026523 | Soil | VGSGVLPDVAAAVSAFVRYRPQEHLPDPERRAIYDDAYRRYRDVYYALKPVFDG |
| Ga0209807_12277612 | 3300026530 | Soil | AVGAGLHRGVADAVGTFVSYRPEEHVPDPEAKEAYEDSYRRYREVYFALKPVFSGS |
| Ga0208214_1023221 | 3300026672 | Soil | GVHASVAEAVAAFVDYQPDEHVPDPERHQRYTDAYRRYRDVYYALKPVFERLDEQAPATT |
| Ga0208847_1001541 | 3300026673 | Soil | TAVGAGVHASVAEAVAAFVDYQPDEHVPDPERHQLYSSAYHRYREVYYALKPVFEKVET |
| Ga0207479_1028932 | 3300026973 | Soil | SYRPEEHQPDPGVRGAYGEAYVRYRKVYASLKPVFADS |
| Ga0209879_10278131 | 3300027056 | Groundwater Sand | GILPTVGAAVEAFVSYQPEEHQPAPDVREVYDEAYLRYRKVYASLKPVFSDI |
| Ga0209846_10231023 | 3300027277 | Groundwater Sand | VHPTVASAVDAFVAYEPEEHRPDPERQEAYAEAYRRYRDLYFALKPVFAAG |
| Ga0209995_10929762 | 3300027471 | Arabidopsis Thaliana Rhizosphere | FRPEEHEPDPATRQAYDDAYGLYREVYFALKPVFPATGES |
| Ga0209843_10577151 | 3300027511 | Groundwater Sand | ATVAEAVDAFVAYQPEEQVPDPERQERYDDAYRRYRDVYFALKPVFERG |
| Ga0256866_10656511 | 3300027650 | Soil | FVSFRPEEHEPDPGAREAYDEAYRQYRDVYFALKPVFGAS |
| Ga0209819_100172245 | 3300027722 | Freshwater Sediment | AIVAFRPEEHEPEAERREVYDEAYRRYRDVFFALKPVFARG |
| Ga0209574_102689752 | 3300027809 | Agave | AVAAFVDYQPDEHLPDPERHQRYTDAYRRYREVYFALKPVFERLDEPAPASP |
| Ga0209701_106666072 | 3300027862 | Vadose Zone Soil | VAYRPDEHRPDPERREIYDEAYARYRDVYFALKPVFERA |
| Ga0209814_101657721 | 3300027873 | Populus Rhizosphere | VQAFVAYRRDEHAPDPERREAYDDAYRRYRDLYDALRPVFST |
| Ga0209283_103523961 | 3300027875 | Vadose Zone Soil | AYQPHEHQPDPERHQAYANAYRRYRDVYFALKPVFERGLHV |
| Ga0209382_106859853 | 3300027909 | Populus Rhizosphere | VAYEPEEHQPDPERRAAYDDAYRRYRDVYYALKPVFKRA |
| (restricted) Ga0233417_106422222 | 3300028043 | Sediment | VHASVADAVEAFVAFRPEEHEPDPERTEIYDAAYRRYRDVYYALKPVFASG |
| Ga0268264_103638731 | 3300028381 | Switchgrass Rhizosphere | EAVSAFVDYQPDEHVPDPERHQRYTEAYHRYREVYFALKPVFERGAS |
| Ga0247820_109822551 | 3300028597 | Soil | PDEHVPDPERHQRYTEAYQRYREVYFALKPVFERGAS |
| Ga0307295_101816883 | 3300028708 | Soil | AAFVHYQPDEHVPDPERHQRYSEAYRRYREVYFALKPVFDRQSS |
| Ga0307295_102166572 | 3300028708 | Soil | GSVADAVRAFVSYRPDEHEPDGGNRSVYDEAYRRYRQVYRALAPVFAVG |
| Ga0307322_100319694 | 3300028710 | Soil | ADAVAAFVTYQPDEHVPDPGRHQAYSEAYRRYRDLYYALKPVFERQAG |
| Ga0307319_101354551 | 3300028722 | Soil | SAFVDYQPDEHVPDPERHQRYTEAYHRYRDVYFALKPVFERSDPELPA |
| Ga0307318_100758573 | 3300028744 | Soil | AVSAFVDYQPTEHVPDPERHQRYTEAYQRYREVYFALKPVFERTGAAPA |
| Ga0307282_105036851 | 3300028784 | Soil | GAGVHASVADAVDAFVAFQPDEQVPDPERHAAYAEAYRRYRDVYFALKPVFERA |
| Ga0307282_105950652 | 3300028784 | Soil | HASVAEAVSAFVAYQPDEHVPDPERHQRYTEAYARYRDLYFALKPVFERVEGQPLVSS |
| Ga0307323_101538112 | 3300028787 | Soil | VGSGVHASVPEAVSAFVDYQPDEHVPDPERHQRYTEAYHRYREVYFALKPVFERGAS |
| Ga0307287_101769592 | 3300028796 | Soil | ARMAAVGAGVHASVAEAVAAFVDYQPDEHVPDPERHQLYSSAYHRYRDVYYALKPVFEKVET |
| Ga0307281_104417522 | 3300028803 | Soil | RFRPEEHQPDPAAREAYDEAYRRYRDVYFALKPVFSVG |
| Ga0307305_101370293 | 3300028807 | Soil | AAFVHYQPDEHVPDPERHQHYSEAYRRYREVYFALKPVFDRQSS |
| Ga0247825_105209272 | 3300028812 | Soil | SVPEAVSAFVDYQPDEHVPDPERHQRYTEAYQRYREVYFALKPVFERGAS |
| Ga0307302_104772852 | 3300028814 | Soil | SAFVDYQPDEHVPDPERHQRYTEAYHRYREVYFALKPVFELGAS |
| Ga0307312_100289341 | 3300028828 | Soil | VDAFVAFQPDEQVPDPERHAAYAEAYRRYRDVYFALKPVFERA |
| Ga0307312_108208362 | 3300028828 | Soil | SFLPDEHRPDPERREAYERAYRKYREVYFALKPVFASG |
| Ga0307278_100282601 | 3300028878 | Soil | VETFVSFRPEEHQPDAEASESYDDAYGRYRAVYAALAPVFGS |
| Ga0307300_103505761 | 3300028880 | Soil | DEHGPDPERHQRYTEAYQRYREVYFALKPVFERTGAAPA |
| Ga0307277_101251131 | 3300028881 | Soil | GVHAGVAEAVAAFVAYQPEEHAPDPERHQRYSEAYRRYRDVYFALKPVFDGQG |
| Ga0247826_111259661 | 3300030336 | Soil | PEEHQPDPGVREAYDEAYVRYRKVYASLKPVFADS |
| Ga0299913_118513081 | 3300031229 | Soil | AAVGSGIHGTMAGAVDAFVSFRPEEHEPDPERREIYDEAYRRYRDVYFALKPVFERG |
| Ga0307405_110440872 | 3300031731 | Rhizosphere | DEHVPDPERHQRYTEAYHRYREVYFALKPVFERSPS |
| Ga0307468_1020918682 | 3300031740 | Hardwood Forest Soil | RPDGNEPDLSRRQAYDDAYGRYRDVYFALKPVFEKA |
| Ga0310907_107037612 | 3300031847 | Soil | AVDAFVSYQPEEHEPDLETREAYDDAYRRYRDVYFALKPTFATG |
| Ga0307409_1009332893 | 3300031995 | Rhizosphere | VADAVKAFVSFRPDEHVPDPSAREAYDEAYRRYRDVYFAMKPVFAAG |
| Ga0307409_1027350392 | 3300031995 | Rhizosphere | VAEAVDAFVAYQPEEHLPNPERHQRYTEAYRRYRDLYFALKPVFERVEGQPLVSS |
| Ga0307416_1004862092 | 3300032002 | Rhizosphere | VDYQPDEHVPDPERHQRYTDAYRRYRDVYYALKPVFERLDEQAPATT |
| Ga0307416_1006369043 | 3300032002 | Rhizosphere | DYQPTEHVPDPERHQAYTEAYQRYREVYFALKPVFDRAPS |
| Ga0268251_100677643 | 3300032159 | Agave | VGAGVHGNVAEAVAACVAYQPEEHLPEPEAHQAYSDAYRRYREVYFALKPVFERG |
| Ga0268251_102880621 | 3300032159 | Agave | HRHGNVAEAVAAFVAYQPQEHRPDPEAHQAYSDAYRRYREVYFALKPVFERG |
| Ga0307470_101017001 | 3300032174 | Hardwood Forest Soil | VSFRPDEHEPDDGNRSVYDEAYRRYREVYGALAPVFAAG |
| Ga0307470_109835311 | 3300032174 | Hardwood Forest Soil | KTFVSYRPDGNEPDLSRRQAYDDAYGRYRDVYFALKPVFEKA |
| Ga0307470_112988391 | 3300032174 | Hardwood Forest Soil | FVSYQPEEHEPDPDTREAYDDAYRRYRDVYFALKPTFATG |
| Ga0310889_107430012 | 3300032179 | Soil | VGAGLHGSVADAVRAFVSYRPEQHEPVGSNRSAYDEAYRRYRQVYRALAPVFAAG |
| Ga0214472_103445581 | 3300033407 | Soil | DAFVAFRPEEHEPEPERREIYDEAYRRYRDVYYALKPVFERG |
| Ga0247830_113841921 | 3300033551 | Soil | ILAAVGSGVHSSVADAVSAFVAYQPDEHVPDLETHQRYAVAYRRYRDLYAALKPVFEG |
| Ga0314869_001880_695_862 | 3300033759 | Peatland | VGSGVHATVAEAVDAFVRFQPEEHQPDPERREAYDDAYRRYREVYFALKPVFAAG |
| Ga0364930_0167601_6_125 | 3300033814 | Sediment | VSFQPDEHRPDPERREAYERAYRKYREVYFALKPVFASG |
| Ga0364930_0319688_2_142 | 3300033814 | Sediment | ADAVEAFVAYRPEEHQPDPERREVYDEAYRRYRDVYFALKPVFAAG |
| Ga0364943_0228249_537_689 | 3300034354 | Sediment | HANVADAVRAFVSYRPEEHEPDDGHRSVYDEAYRRYREVYAALKPVFSDG |
| Ga0364943_0426139_363_515 | 3300034354 | Sediment | VHSSVADAVSAFVAYQPDEHVPDPETHQRYADAYRRYRDLYAALKPVFEG |
| ⦗Top⦘ |