| Basic Information | |
|---|---|
| Family ID | F019694 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 228 |
| Average Sequence Length | 39 residues |
| Representative Sequence | PTHSVSEKLSVFAFAAVVLAVIVGGAFAAGYLIGRILL |
| Number of Associated Samples | 182 |
| Number of Associated Scaffolds | 228 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 57.52 % |
| % of genes near scaffold ends (potentially truncated) | 20.61 % |
| % of genes from short scaffolds (< 2000 bps) | 82.02 % |
| Associated GOLD sequencing projects | 167 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.930 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.421 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.105 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 228 Family Scaffolds |
|---|---|---|
| PF12773 | DZR | 19.30 |
| PF08245 | Mur_ligase_M | 8.77 |
| PF00334 | NDK | 5.70 |
| PF10458 | Val_tRNA-synt_C | 3.95 |
| PF08241 | Methyltransf_11 | 3.51 |
| PF02545 | Maf | 0.88 |
| PF02518 | HATPase_c | 0.44 |
| PF01957 | NfeD | 0.44 |
| PF14539 | DUF4442 | 0.44 |
| PF01797 | Y1_Tnp | 0.44 |
| PF01168 | Ala_racemase_N | 0.44 |
| PF07927 | HicA_toxin | 0.44 |
| PF04655 | APH_6_hur | 0.44 |
| PF02574 | S-methyl_trans | 0.44 |
| PF01925 | TauE | 0.44 |
| PF07729 | FCD | 0.44 |
| PF12704 | MacB_PCD | 0.44 |
| PF13400 | Tad | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 228 Family Scaffolds |
|---|---|---|---|
| COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 5.70 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.44 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.44 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.44 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.44 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.44 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.44 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.44 |
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.93 % |
| Unclassified | root | N/A | 3.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig92067 | Not Available | 557 | Open in IMG/M |
| 2166559005|cont_contig00529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3788 | Open in IMG/M |
| 2166559005|cont_contig56732 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300000955|JGI1027J12803_100677014 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300000956|JGI10216J12902_118788114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 805 | Open in IMG/M |
| 3300001535|A3PFW1_10088410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1025 | Open in IMG/M |
| 3300001536|A1565W1_10037358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 881 | Open in IMG/M |
| 3300002568|C688J35102_119033858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300003990|Ga0055455_10210742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300004063|Ga0055483_10222418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300004479|Ga0062595_100905876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 744 | Open in IMG/M |
| 3300005172|Ga0066683_10240323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1122 | Open in IMG/M |
| 3300005187|Ga0066675_10278097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1205 | Open in IMG/M |
| 3300005327|Ga0070658_10017461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5740 | Open in IMG/M |
| 3300005327|Ga0070658_10054748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3239 | Open in IMG/M |
| 3300005327|Ga0070658_10067190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2929 | Open in IMG/M |
| 3300005327|Ga0070658_11491340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300005329|Ga0070683_100433583 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300005434|Ga0070709_10467255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 953 | Open in IMG/M |
| 3300005435|Ga0070714_100140148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 2170 | Open in IMG/M |
| 3300005436|Ga0070713_101446270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300005439|Ga0070711_101436438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300005445|Ga0070708_102074443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 526 | Open in IMG/M |
| 3300005458|Ga0070681_10767501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 881 | Open in IMG/M |
| 3300005467|Ga0070706_101367306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300005471|Ga0070698_100999565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 784 | Open in IMG/M |
| 3300005526|Ga0073909_10089717 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300005529|Ga0070741_10149376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2352 | Open in IMG/M |
| 3300005529|Ga0070741_10228497 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300005529|Ga0070741_10342004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1391 | Open in IMG/M |
| 3300005530|Ga0070679_100661957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 987 | Open in IMG/M |
| 3300005532|Ga0070739_10000270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 104365 | Open in IMG/M |
| 3300005534|Ga0070735_10238867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1104 | Open in IMG/M |
| 3300005537|Ga0070730_10006554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9944 | Open in IMG/M |
| 3300005537|Ga0070730_10727542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 628 | Open in IMG/M |
| 3300005538|Ga0070731_10035026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3384 | Open in IMG/M |
| 3300005538|Ga0070731_10443502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 864 | Open in IMG/M |
| 3300005555|Ga0066692_10469661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 802 | Open in IMG/M |
| 3300005556|Ga0066707_10357260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 955 | Open in IMG/M |
| 3300005556|Ga0066707_10555117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
| 3300005556|Ga0066707_10676330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300005559|Ga0066700_10348365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1046 | Open in IMG/M |
| 3300005561|Ga0066699_10468679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
| 3300005563|Ga0068855_100193245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2294 | Open in IMG/M |
| 3300005568|Ga0066703_10900163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300005569|Ga0066705_10126642 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300005576|Ga0066708_10182047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1309 | Open in IMG/M |
| 3300005598|Ga0066706_10270499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1328 | Open in IMG/M |
| 3300005614|Ga0068856_100781167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 975 | Open in IMG/M |
| 3300005764|Ga0066903_100181698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3103 | Open in IMG/M |
| 3300005764|Ga0066903_104951250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 707 | Open in IMG/M |
| 3300005874|Ga0075288_1048451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 655 | Open in IMG/M |
| 3300005900|Ga0075272_1123950 | Not Available | 505 | Open in IMG/M |
| 3300006028|Ga0070717_11016362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 755 | Open in IMG/M |
| 3300006032|Ga0066696_10281684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1078 | Open in IMG/M |
| 3300006059|Ga0075017_100685171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 788 | Open in IMG/M |
| 3300006175|Ga0070712_100978239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 732 | Open in IMG/M |
| 3300006426|Ga0075037_1524735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300006794|Ga0066658_10539642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
| 3300006796|Ga0066665_11156021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 590 | Open in IMG/M |
| 3300006804|Ga0079221_10649191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 723 | Open in IMG/M |
| 3300006950|Ga0075524_10038813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1945 | Open in IMG/M |
| 3300007775|Ga0102953_1008144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5259 | Open in IMG/M |
| 3300007820|Ga0104324_105793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1098 | Open in IMG/M |
| 3300009012|Ga0066710_102098969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 831 | Open in IMG/M |
| 3300009038|Ga0099829_10347136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1221 | Open in IMG/M |
| 3300009038|Ga0099829_11293115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300009038|Ga0099829_11522130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300009090|Ga0099827_10118046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2132 | Open in IMG/M |
| 3300009090|Ga0099827_10604045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 946 | Open in IMG/M |
| 3300009090|Ga0099827_10622642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 931 | Open in IMG/M |
| 3300009090|Ga0099827_10633289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 923 | Open in IMG/M |
| 3300009090|Ga0099827_12002678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300009137|Ga0066709_102457395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
| 3300009143|Ga0099792_10643979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 680 | Open in IMG/M |
| 3300009143|Ga0099792_10681018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
| 3300009147|Ga0114129_13172444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300009162|Ga0075423_11206047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
| 3300009174|Ga0105241_11704197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300009518|Ga0116128_1029375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1830 | Open in IMG/M |
| 3300009551|Ga0105238_11185296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 788 | Open in IMG/M |
| 3300009792|Ga0126374_10395293 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300010046|Ga0126384_10996028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 763 | Open in IMG/M |
| 3300010325|Ga0134064_10399411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300010337|Ga0134062_10211438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 888 | Open in IMG/M |
| 3300010361|Ga0126378_11524690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
| 3300010362|Ga0126377_10113362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2493 | Open in IMG/M |
| 3300010362|Ga0126377_13617520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300010371|Ga0134125_11472816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
| 3300010371|Ga0134125_11530003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
| 3300010373|Ga0134128_10169344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2466 | Open in IMG/M |
| 3300010373|Ga0134128_12309343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300010396|Ga0134126_10705925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1146 | Open in IMG/M |
| 3300010396|Ga0134126_10811320 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300010396|Ga0134126_10942688 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300010396|Ga0134126_10978253 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300010396|Ga0134126_11429982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 763 | Open in IMG/M |
| 3300010399|Ga0134127_10658687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
| 3300010400|Ga0134122_12373714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300011270|Ga0137391_11119986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 635 | Open in IMG/M |
| 3300011270|Ga0137391_11267067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300011991|Ga0120153_1019252 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300012001|Ga0120167_1028882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1330 | Open in IMG/M |
| 3300012014|Ga0120159_1101081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 826 | Open in IMG/M |
| 3300012189|Ga0137388_10188034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1854 | Open in IMG/M |
| 3300012200|Ga0137382_10674588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 740 | Open in IMG/M |
| 3300012200|Ga0137382_10722698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
| 3300012202|Ga0137363_11393423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300012203|Ga0137399_11195714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300012204|Ga0137374_10022339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 7140 | Open in IMG/M |
| 3300012205|Ga0137362_11321020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300012208|Ga0137376_10333520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1317 | Open in IMG/M |
| 3300012209|Ga0137379_10624098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 984 | Open in IMG/M |
| 3300012212|Ga0150985_109790546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300012285|Ga0137370_10998394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300012285|Ga0137370_11020714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300012350|Ga0137372_11072330 | Not Available | 555 | Open in IMG/M |
| 3300012362|Ga0137361_10760841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 883 | Open in IMG/M |
| 3300012469|Ga0150984_108241787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
| 3300012469|Ga0150984_120818772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1289 | Open in IMG/M |
| 3300012582|Ga0137358_10462404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
| 3300012683|Ga0137398_10171977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1417 | Open in IMG/M |
| 3300012922|Ga0137394_10403314 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300012923|Ga0137359_10276707 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300012924|Ga0137413_10063348 | All Organisms → cellular organisms → Bacteria | 2188 | Open in IMG/M |
| 3300012924|Ga0137413_10516898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 881 | Open in IMG/M |
| 3300012925|Ga0137419_11165273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 644 | Open in IMG/M |
| 3300012927|Ga0137416_11273007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
| 3300012929|Ga0137404_10616097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 977 | Open in IMG/M |
| 3300012929|Ga0137404_11655978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300012931|Ga0153915_11321491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 843 | Open in IMG/M |
| 3300012931|Ga0153915_11655193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
| 3300012944|Ga0137410_10857508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 766 | Open in IMG/M |
| 3300012948|Ga0126375_11633916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
| 3300012957|Ga0164303_10650233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300012960|Ga0164301_10340658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1027 | Open in IMG/M |
| 3300012960|Ga0164301_10967094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300012964|Ga0153916_11250994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 820 | Open in IMG/M |
| 3300012972|Ga0134077_10385180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300012976|Ga0134076_10136820 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300012982|Ga0168317_1000530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 26175 | Open in IMG/M |
| 3300012984|Ga0164309_10593175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 864 | Open in IMG/M |
| 3300012986|Ga0164304_10542900 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300012987|Ga0164307_10798188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
| 3300013100|Ga0157373_11459168 | Not Available | 521 | Open in IMG/M |
| 3300013104|Ga0157370_10813478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
| 3300013104|Ga0157370_10834608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 838 | Open in IMG/M |
| 3300013105|Ga0157369_10560376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1181 | Open in IMG/M |
| 3300013105|Ga0157369_11333379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
| 3300013307|Ga0157372_12090986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
| 3300013503|Ga0120127_10122817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300014157|Ga0134078_10500396 | Not Available | 565 | Open in IMG/M |
| 3300014497|Ga0182008_10106723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1386 | Open in IMG/M |
| 3300014497|Ga0182008_10316057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 821 | Open in IMG/M |
| 3300014497|Ga0182008_10384776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
| 3300015087|Ga0167637_1028785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 778 | Open in IMG/M |
| 3300015164|Ga0167652_1040311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 901 | Open in IMG/M |
| 3300015195|Ga0167658_1042122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1152 | Open in IMG/M |
| 3300015261|Ga0182006_1028031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2294 | Open in IMG/M |
| 3300015262|Ga0182007_10142929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300015262|Ga0182007_10255935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300015264|Ga0137403_10075832 | All Organisms → cellular organisms → Bacteria | 3406 | Open in IMG/M |
| 3300015264|Ga0137403_11452118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300015358|Ga0134089_10459682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300015371|Ga0132258_10246542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4364 | Open in IMG/M |
| 3300015371|Ga0132258_10823490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2341 | Open in IMG/M |
| 3300017654|Ga0134069_1166967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
| 3300017927|Ga0187824_10223325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 647 | Open in IMG/M |
| 3300017929|Ga0187849_1000912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 36082 | Open in IMG/M |
| 3300017936|Ga0187821_10136315 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300017961|Ga0187778_10365487 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300017994|Ga0187822_10003815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3262 | Open in IMG/M |
| 3300018005|Ga0187878_1003446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 13063 | Open in IMG/M |
| 3300018468|Ga0066662_11067866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 804 | Open in IMG/M |
| 3300018482|Ga0066669_11812833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300019887|Ga0193729_1018961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3000 | Open in IMG/M |
| 3300019888|Ga0193751_1125127 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300019888|Ga0193751_1186161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 709 | Open in IMG/M |
| 3300020075|Ga0206349_1074255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300020081|Ga0206354_11255090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300020081|Ga0206354_11493316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300021363|Ga0193699_10016754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2650 | Open in IMG/M |
| 3300021372|Ga0213877_10003597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3574 | Open in IMG/M |
| 3300021478|Ga0210402_11580030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300024055|Ga0247794_10351110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300024330|Ga0137417_1509936 | All Organisms → cellular organisms → Bacteria | 3696 | Open in IMG/M |
| 3300025482|Ga0208715_1093724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300025484|Ga0208587_1107931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300025588|Ga0208586_1083170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
| 3300025909|Ga0207705_10077152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2423 | Open in IMG/M |
| 3300025912|Ga0207707_10072205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3008 | Open in IMG/M |
| 3300025912|Ga0207707_10170249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1903 | Open in IMG/M |
| 3300025912|Ga0207707_10880567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
| 3300025915|Ga0207693_10891941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300025922|Ga0207646_10658208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 938 | Open in IMG/M |
| 3300025928|Ga0207700_10477134 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300025928|Ga0207700_11150966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300025929|Ga0207664_10014552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5686 | Open in IMG/M |
| 3300025929|Ga0207664_11902472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300025939|Ga0207665_10464478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
| 3300025993|Ga0208415_1019789 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300026306|Ga0209468_1062906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1249 | Open in IMG/M |
| 3300026335|Ga0209804_1206613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300027466|Ga0207484_105655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300027738|Ga0208989_10063980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1265 | Open in IMG/M |
| 3300027773|Ga0209810_1000124 | All Organisms → cellular organisms → Bacteria | 232486 | Open in IMG/M |
| 3300027815|Ga0209726_10007178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12562 | Open in IMG/M |
| 3300027826|Ga0209060_10058627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1841 | Open in IMG/M |
| 3300027846|Ga0209180_10566455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 631 | Open in IMG/M |
| 3300027869|Ga0209579_10309948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 851 | Open in IMG/M |
| 3300027903|Ga0209488_10664023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
| 3300027986|Ga0209168_10220291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 945 | Open in IMG/M |
| 3300028536|Ga0137415_11083942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300028563|Ga0265319_1001966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11608 | Open in IMG/M |
| 3300030006|Ga0299907_10150245 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
| 3300031229|Ga0299913_11149020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
| 3300031240|Ga0265320_10024094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3226 | Open in IMG/M |
| 3300031670|Ga0307374_10101466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2492 | Open in IMG/M |
| 3300031712|Ga0265342_10509467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300031716|Ga0310813_11700310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300031938|Ga0308175_100111224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2547 | Open in IMG/M |
| 3300031996|Ga0308176_12744351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300032770|Ga0335085_11766993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
| 3300032892|Ga0335081_10961350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1000 | Open in IMG/M |
| 3300032893|Ga0335069_10576416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1294 | Open in IMG/M |
| 3300033233|Ga0334722_10040938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3727 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.63% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.19% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.75% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.32% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.32% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.32% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.88% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.88% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.88% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.44% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.44% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.44% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.44% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.44% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.44% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.44% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004063 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300007775 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D2_MG | Environmental | Open in IMG/M |
| 3300007820 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015087 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015164 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300027466 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-B (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_10593150 | 2124908045 | Soil | VAAATTHSVGEKLGVFAFAAVVLVVIVGGAFAAGYLIGRILL |
| cont_0529.00000070 | 2166559005 | Simulated | NVREKISVFAVAIFVLVVVVGGAFAAGYLIGRILL |
| cont_0732.00004090 | 2166559005 | Simulated | VASARPHTFGEKVSVFALAAFVLLVIVGGAFAAGYFIGKMFL |
| JGI1027J12803_1006770142 | 3300000955 | Soil | LSEKASVFALAAFLLVAIVGGAFAAGYLIGRMLL* |
| JGI10216J12902_1187881142 | 3300000956 | Soil | VSEKLSVFALAIFVLVIIVGGAFAAGYLIGRILL* |
| A3PFW1_100884103 | 3300001535 | Permafrost | VRDKASVFALAAFVLLAIVGGAFAAGYLIGRMLLC |
| A1565W1_100373582 | 3300001536 | Permafrost | MATAPAHRLSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL* |
| C688J35102_1190338582 | 3300002568 | Soil | MAPTHRLSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL* |
| Ga0055455_102107421 | 3300003990 | Natural And Restored Wetlands | MNAATTTTHSVGEKLSIFALAAFVLATVVGGAFAAGYLIGRMLL* |
| Ga0055483_102224182 | 3300004063 | Natural And Restored Wetlands | MNAATTTRHSVGERLSIFALAAFVLAVVVGGAFAAGYLIGRMLL* |
| Ga0062595_1009058762 | 3300004479 | Soil | MHAARTHTVGERVGIFAFAALVLTLIVGGAFAAGYLIGRIFL* |
| Ga0066683_102403232 | 3300005172 | Soil | VAPTHSFSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL* |
| Ga0066675_102780972 | 3300005187 | Soil | VTRPHSVGERLSVFALAVFFLVSLVGVAFAAGYLIGRMLL* |
| Ga0070658_100174619 | 3300005327 | Corn Rhizosphere | VTPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL* |
| Ga0070658_100547483 | 3300005327 | Corn Rhizosphere | VNPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRI |
| Ga0070658_100671906 | 3300005327 | Corn Rhizosphere | PATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL* |
| Ga0070658_114913401 | 3300005327 | Corn Rhizosphere | NPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL* |
| Ga0070683_1004335832 | 3300005329 | Corn Rhizosphere | MPTHTVSEKLGVFAFAALVLAVIVGGAFAAGYLIGRILL* |
| Ga0070709_104672552 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPARPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL* |
| Ga0070714_1001401483 | 3300005435 | Agricultural Soil | VNPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL |
| Ga0070713_1014462702 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VARGRPHTFGDKASVFALAAFVLLAIVGGAFAAGYVIGRMLL* |
| Ga0070711_1014364382 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPTHRVSDKLSVFAFAAVVLLVIVGGAFAAGYLIGRILL* |
| Ga0070708_1020744432 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRATTHSVSDKLGVFAFAAVVLVVIVGGAFAAGYLIGRILL* |
| Ga0070681_107675012 | 3300005458 | Corn Rhizosphere | VAPARPHTFGEKVSVFALAAFVLIAIVGGAFAAGYVIGRMFL* |
| Ga0070706_1013673062 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPARTHTASEKLSVFALAIFVLLAIVGGAFAAGYLIGRMLL* |
| Ga0070698_1009995652 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGATTHSVSEKLGIFAVAGLVLVVVVGGAFLAGYLIGRILL* |
| Ga0073909_100897173 | 3300005526 | Surface Soil | VGEKVSVFALATFVLVLIVGGAFAAGYLIGRILL* |
| Ga0070741_101493764 | 3300005529 | Surface Soil | VNAATHRGSEKLGVFAFAIGVLIVIVGGAFAAGYLIGRILL* |
| Ga0070741_102284972 | 3300005529 | Surface Soil | MSEKLGVFAFATTILVVIVGGAFAAGYLIGRILL* |
| Ga0070741_103420042 | 3300005529 | Surface Soil | VHAVTHSPREKLSIFVFAAAVLVLVVGGAFAAGYLIGRMLL* |
| Ga0070679_1006619572 | 3300005530 | Corn Rhizosphere | VAHTHSVSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL* |
| Ga0070739_1000027090 | 3300005532 | Surface Soil | VAAATHRGSEKLGVFAFAIGLLVVIVGGAFAAGYLIGRILL* |
| Ga0070734_101894003 | 3300005533 | Surface Soil | VHAAIHSPREKLSIFLFAAVVLVVVVGGAFAAGYLIGRIFL* |
| Ga0070735_102388672 | 3300005534 | Surface Soil | VAARTHTAGEKVSVFALAIFVLLAIVGGAFAAGYLIGRMLL* |
| Ga0070730_100065546 | 3300005537 | Surface Soil | VSERLGVFAFAAVVLVVIVGGAFAAGYLIGRILL* |
| Ga0070730_107275422 | 3300005537 | Surface Soil | LSDKLSVFAFAAVVLLVIVGGAFAAGYLIGRILL* |
| Ga0070731_100350263 | 3300005538 | Surface Soil | VSEKLGVFAFAIAILVVIVGGAFAAGYLIGRILL* |
| Ga0070731_104435022 | 3300005538 | Surface Soil | MQAARSHTVGERVGIFAFAAFVLTVIVGGAFAAGYLIGRIFL* |
| Ga0066692_104696612 | 3300005555 | Soil | VSEKLSVFGLATVVLAVIVGGAFAAGYLIGRILL* |
| Ga0066707_103572602 | 3300005556 | Soil | VSEKLSVFAMAAVVLAVIVGGAFAAGYLIGRILL* |
| Ga0066707_105551172 | 3300005556 | Soil | VSEKLSVFALAIFVLLVIVGGAFAAGYLIGRILL* |
| Ga0066707_106763302 | 3300005556 | Soil | VAQARTHTASEKLSVFALAIFVLLTIVGGAFAAGYLIGRMFL* |
| Ga0066700_103483652 | 3300005559 | Soil | VSEKLSVFAFAAFVLAVIVGGAFAAGYLIGRILL* |
| Ga0066699_104686792 | 3300005561 | Soil | MAAFGEKLGVFAFAFFVLVAIVGGAFLAGYLIGRMLL* |
| Ga0068855_1001932453 | 3300005563 | Corn Rhizosphere | VSEKLSVFAFAAVVLAVIVGGAFAAGYLIGRILL* |
| Ga0066703_109001632 | 3300005568 | Soil | MAAFREKLGVFAFALFVLVAIVGGAFLAGYLIGRMLL* |
| Ga0066705_101266421 | 3300005569 | Soil | VAAAPTHTHKVSEKLGVFAFAIAILVMIVGGAFAAGYLIGRI |
| Ga0066708_101820472 | 3300005576 | Soil | VSEKLSVFAFAAFVLAVIVGGAFAAGYFIGRILL* |
| Ga0066706_102704992 | 3300005598 | Soil | VSEKLSVFALAAVVLAVIVGGAFAAGYLIGRILL* |
| Ga0068856_1007811672 | 3300005614 | Corn Rhizosphere | VSEKLSVFTLAAVVLAVIVGGAFAAGYLIGRILL* |
| Ga0066903_1001816982 | 3300005764 | Tropical Forest Soil | VRERISVFALAAFVLVVVVGGAFAAGYLIGRILL* |
| Ga0066903_1049512502 | 3300005764 | Tropical Forest Soil | VGEKISVFAVAIFVLVVVVGGAFAAGYLIGRILL* |
| Ga0075288_10484512 | 3300005874 | Rice Paddy Soil | VPTHSVSEKLGVFAFAALVLAVIVGGAFAAGYLIGRILL* |
| Ga0075272_11239502 | 3300005900 | Rice Paddy Soil | VSEKLSVFALATFVLVVIVGGAFAAGYLIGRILL* |
| Ga0070717_110163622 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEKLGVFAFAAVVLVLIVGGAFAAGYLIGRVLL* |
| Ga0066696_102816842 | 3300006032 | Soil | VAAAPTHTHKVSEKLGVFAFAIAILVMIVGGAFAAGY |
| Ga0075017_1006851712 | 3300006059 | Watersheds | VREKISVFAVAIFVLVLVVGGAFAAGYLIGRILL* |
| Ga0070712_1009782392 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEKVSVFALAAFVLVVIVGGAFAAGYLIGRILL* |
| Ga0075037_15247352 | 3300006426 | Permafrost Soil | PHTLRDKASVFALAAFLLLAIVGGAFAAGYLIGRMLL* |
| Ga0066658_105396421 | 3300006794 | Soil | MAAATTHRVSEKLSVFAFAAALLVVIVGGAFAAGYFIGRILL* |
| Ga0066665_111560212 | 3300006796 | Soil | MSDKLSVFAFAAVVLLVIVGGAFAAGYLIGRILL* |
| Ga0079221_106491912 | 3300006804 | Agricultural Soil | VGEKLGVFAFAIAILVVIVGGAFAAGYLIGRILL* |
| Ga0075524_100388134 | 3300006950 | Arctic Peat Soil | VSDKASVFALAAFVLLAIVGGAFAAGYLIGRMLL* |
| Ga0102953_10081443 | 3300007775 | Soil | MREKLPIFALAAAVLVIVVGGAFAAGYLIGRMIL* |
| Ga0104324_1057932 | 3300007820 | Soil | VSEKASVFALAALVLLAIVGGAFAAGYLIGRMLL* |
| Ga0066710_1020989692 | 3300009012 | Grasslands Soil | VAPTHSFSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL |
| Ga0099829_103471362 | 3300009038 | Vadose Zone Soil | VAQARTHTASEKLSVFALAIFVLLAIVGGAFAAGYLIGRMFL* |
| Ga0099829_112931152 | 3300009038 | Vadose Zone Soil | VSDKLSVFAFAAVVLLVIVGGAFAAGYLIGRILL* |
| Ga0099829_115221302 | 3300009038 | Vadose Zone Soil | VSERLSVFALAAVVLAVIVGGAFAAGYLIGRILL* |
| Ga0099827_101180465 | 3300009090 | Vadose Zone Soil | VARATTHSVSEKLSVFAFAAFLLLAIVGGAFAAGYFIGRMLL* |
| Ga0099827_106040452 | 3300009090 | Vadose Zone Soil | VSEKVSVFALAAVVLVVIVGGAFAAGYLIGRILL* |
| Ga0099827_106226422 | 3300009090 | Vadose Zone Soil | VSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL* |
| Ga0099827_106332892 | 3300009090 | Vadose Zone Soil | MATAPAHRLSDKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL* |
| Ga0099827_120026782 | 3300009090 | Vadose Zone Soil | VSQKLGVFAFAAVVLVVIVGGAFAAGYLIGRVLL* |
| Ga0066709_1024573951 | 3300009137 | Grasslands Soil | VAQVRTHSVGERLSVFALAVFVLVAIVGVAFAAGYLIGRMLL* |
| Ga0099792_106439792 | 3300009143 | Vadose Zone Soil | VATASTHTVGEKLSVFALAIFVLLAIVGGAFAAGYLIGRMLL* |
| Ga0099792_106810182 | 3300009143 | Vadose Zone Soil | MATAPVHRLSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL* |
| Ga0114129_131724441 | 3300009147 | Populus Rhizosphere | TTHSVGEKLGVFAFAAVVLVMIVGGAFAAGYLIGRILL* |
| Ga0075423_112060471 | 3300009162 | Populus Rhizosphere | VAAATTHSVGEKLGVFAFAAVVLVMIVGGAFAAGYLIGR |
| Ga0105241_117041972 | 3300009174 | Corn Rhizosphere | VNPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL* |
| Ga0116128_10293754 | 3300009518 | Peatland | VVEKLSIFAVAGLVLVVIVGGAFAAGYLIGRVLL* |
| Ga0105238_111852962 | 3300009551 | Corn Rhizosphere | VSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL* |
| Ga0126374_103952933 | 3300009792 | Tropical Forest Soil | VAPTHRGEKVGVFALAACLLVVIVGGAFAAGYLIGRILL* |
| Ga0126384_109960282 | 3300010046 | Tropical Forest Soil | MTRVGERLGVFAIALLILLAIVGGAFAAGYVIGKMFL* |
| Ga0134064_103994111 | 3300010325 | Grasslands Soil | PHSVGERLSVFALAVFFLVSLVGVAFAAGYLIGRMLL* |
| Ga0134062_102114382 | 3300010337 | Grasslands Soil | VRQTHSVGERLSVFALAVFVLVTIVGVAFAAGYLIGRMLL* |
| Ga0126378_115246902 | 3300010361 | Tropical Forest Soil | VARPPTHSVGERISVFALALFVLVLVVGGAFAAGYLIGRILL* |
| Ga0126377_101133623 | 3300010362 | Tropical Forest Soil | MTRVGDRLGVFAIALLVLLAIVGGAFAAGYLIGKMFL* |
| Ga0126377_136175202 | 3300010362 | Tropical Forest Soil | VARATTHSVGERLSVFAFATFLLIAIVGGAFAAGYFIGRMLL* |
| Ga0134125_114728163 | 3300010371 | Terrestrial Soil | PTSVMTAVTHRSEKLGVFAFATLVLVVIVGGAFAAGYLIGRILL* |
| Ga0134125_115300032 | 3300010371 | Terrestrial Soil | MATAPTHKLSDKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL* |
| Ga0134128_101693442 | 3300010373 | Terrestrial Soil | VTPATVHSLGDRISVFALAFFLLVVIVGGAFAAGYLIGRILL* |
| Ga0134128_123093432 | 3300010373 | Terrestrial Soil | VSEKLGVFAFAITVLVVIVGGAFAAGYLIGRILL* |
| Ga0134126_107059252 | 3300010396 | Terrestrial Soil | VSEKVSVFALAAVVLAVIVGGAFAAGYLIGRILL* |
| Ga0134126_108113202 | 3300010396 | Terrestrial Soil | MTAVTHRSEKLGVFAFATLVLVVIVGGAFAAGYLIGRILL* |
| Ga0134126_109426882 | 3300010396 | Terrestrial Soil | VNPATVHSLGDRISVFALAFFVLVVIVGGAFAAGYLIGRILL* |
| Ga0134126_109782531 | 3300010396 | Terrestrial Soil | KVSEKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL* |
| Ga0134126_114299821 | 3300010396 | Terrestrial Soil | VAPASPHTLGDRISVFALAAFLLVVIVGGAFAAGYLIGRMLL* |
| Ga0134127_106586872 | 3300010399 | Terrestrial Soil | VNPATVHSLGDRVSVFALAFFVLAVIVGGAFAAGYLIGRILL* |
| Ga0134122_123737142 | 3300010400 | Terrestrial Soil | VGEKLSVFALATFVLVLIVGGAFAAGYLIGRILL* |
| Ga0137391_111199862 | 3300011270 | Vadose Zone Soil | VREKISVFAVAIFVLVVVVGGAFAAGYLIGRILL* |
| Ga0137391_112670672 | 3300011270 | Vadose Zone Soil | ARTHTASEKLSVFALAIFVLLTIVGGAFAAGYLIGRMFL* |
| Ga0120153_10192524 | 3300011991 | Permafrost | MATAPAHRLSDKLSVFAFALGVLAVIVGGAFAAGYLIGRILL* |
| Ga0120167_10288822 | 3300012001 | Permafrost | VSEKASVFALATFVLLAIVGGAFAAGYLIGRMLL* |
| Ga0120159_11010812 | 3300012014 | Permafrost | VSDKASVFALAAFVLLAIVGGAFAAGYLIGRILL* |
| Ga0137388_101880344 | 3300012189 | Vadose Zone Soil | RTSVPPARTHTANEKLSVFALAIFVLLAIVGGAFAAGYLIGRMLL* |
| Ga0137382_106745882 | 3300012200 | Vadose Zone Soil | VAAATTHSVGEKLGVFAFAAVVLVVIVGGAFAAGYLIGRILL* |
| Ga0137382_107226983 | 3300012200 | Vadose Zone Soil | SENEKLSVFGLAAVVLVVIVGGAFAPGYLLGRILL* |
| Ga0137363_113934231 | 3300012202 | Vadose Zone Soil | VATASTHTVGEKLSVFALAIFVLLAIVGGAFAAGYLI |
| Ga0137399_111957141 | 3300012203 | Vadose Zone Soil | PAHRLSDKLSVFAFALGVLAVIVGGAFAAGYLIGRILL* |
| Ga0137374_100223393 | 3300012204 | Vadose Zone Soil | VSEKLSVFALAIFVLVLIVGGAFAAGYLIGRILL* |
| Ga0137362_113210202 | 3300012205 | Vadose Zone Soil | VATASTHTVGEKLSVFALAIFVLLAIVGGAFAAGYLIGRMFL* |
| Ga0137376_103335202 | 3300012208 | Vadose Zone Soil | LSDKLSVFAFALGVLAVIVGGAFAAGYLIGRILL* |
| Ga0137379_106240982 | 3300012209 | Vadose Zone Soil | VAPTHSLSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL* |
| Ga0150985_1097905462 | 3300012212 | Avena Fatua Rhizosphere | VAAAQTHSVGEKLTVFAFAAVLLVVIVGGAFAAGYFIGRILL* |
| Ga0137370_109983942 | 3300012285 | Vadose Zone Soil | VNEKFSVFALAAVVLAVIVGYAFTAGYLIGRILL* |
| Ga0137370_110207141 | 3300012285 | Vadose Zone Soil | VSEKLSVFALAAIVLAVIVGGAFAAGYLIGRILL* |
| Ga0137372_110723302 | 3300012350 | Vadose Zone Soil | VSEKLSVFALAIFVLLVIVGGAFAAGYLICRILL* |
| Ga0137361_107608411 | 3300012362 | Vadose Zone Soil | VAQARTHTASEKLSVFALAIFVLLTIVGGAFAAGYLI |
| Ga0150984_1082417872 | 3300012469 | Avena Fatua Rhizosphere | VAAAQTHSAGEKLTVFAFAAVLLVVIVGGAFAAGYFIGRILL* |
| Ga0150984_1208187724 | 3300012469 | Avena Fatua Rhizosphere | SPSSVAAAQTHSAGEKLTVFAFAAVILVVIVGGAFAAGYFIGRILL* |
| Ga0137358_104624041 | 3300012582 | Vadose Zone Soil | APSIFLRRSVATASTHTVGEKLSVFALAIFVLLAIVGGAFAAGYLIGRMLL* |
| Ga0137398_101719772 | 3300012683 | Vadose Zone Soil | VSDKLSVFAFALGVLLVIVGGAFAAGYLIGRILL* |
| Ga0137394_104033142 | 3300012922 | Vadose Zone Soil | MATAPTHRLSDKLSVFAFAFGVLVVIVGGAFAAGYLIGRILL* |
| Ga0137359_102767073 | 3300012923 | Vadose Zone Soil | MRTRTHSVSQKLGVFAFAAVVLVVIVGGAFAAGYLIGRVLL* |
| Ga0137413_100633482 | 3300012924 | Vadose Zone Soil | MAPPHRLSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL* |
| Ga0137413_105168982 | 3300012924 | Vadose Zone Soil | VAPARPHTLGDKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL* |
| Ga0137419_111652732 | 3300012925 | Vadose Zone Soil | VREKASVFALAAFLLLAIVGGAFAAGYLIGRMLL* |
| Ga0137416_112730072 | 3300012927 | Vadose Zone Soil | FLATSVAPARRHTVTDKASVFALAAFVLLAIVGGAFAAGYLIGRMLL* |
| Ga0137404_106160972 | 3300012929 | Vadose Zone Soil | VAQARTHTASEKLSVFALASFVLLAIVGGAFAAGYLIGRMFL* |
| Ga0137404_116559782 | 3300012929 | Vadose Zone Soil | VAQATTHSVSEKLSVFAFAAFLLLAIVGGAFAAGYFIGRMLL* |
| Ga0153915_113214912 | 3300012931 | Freshwater Wetlands | VAVASTHSLGEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL* |
| Ga0153915_116551932 | 3300012931 | Freshwater Wetlands | LSEKASVFALAAFVLLAIVGGAFAAGYLIGRMLL* |
| Ga0137410_108575082 | 3300012944 | Vadose Zone Soil | VSEKLSVFAFATFLLLAIVGGAFAAGYFIGRMLL* |
| Ga0126375_116339162 | 3300012948 | Tropical Forest Soil | MTRVGERLGVFAIALLVLLGIVGGAFAAGYVIGKMFL* |
| Ga0164303_106502331 | 3300012957 | Soil | PHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL* |
| Ga0164301_103406582 | 3300012960 | Soil | VTPATVHSLGDRISVFALAFFRLGVIVGGAVAAGYLSGRILL* |
| Ga0164301_109670942 | 3300012960 | Soil | VASARPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL* |
| Ga0153916_112509942 | 3300012964 | Freshwater Wetlands | LSEKASVFALAAFVLFAIVGGAFAAGYLIGRMLL* |
| Ga0134077_103851802 | 3300012972 | Grasslands Soil | VPPAPTHSLGDRVSVFALALFVLALIVGGAFAAGYLIGRILL* |
| Ga0134076_101368202 | 3300012976 | Grasslands Soil | VSEKLSVFALAIFVLLVIVAGAFAAGYLIGRILL* |
| Ga0168317_100053011 | 3300012982 | Weathered Mine Tailings | VATVRAHSATEKLSVFALAIFVLLAVVGGAFAAGYLIGRMFL* |
| Ga0164309_105931752 | 3300012984 | Soil | VAAAQTNSVGEKLTVFAFAAVLLVVIVGGAFAAGYFIGRILL* |
| Ga0164304_105429001 | 3300012986 | Soil | TVREKASVFALAAFVLLAIVGGAFAAGYLIGRMLL* |
| Ga0164307_107981881 | 3300012987 | Soil | VAPARPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIG |
| Ga0157373_114591681 | 3300013100 | Corn Rhizosphere | VTPATVHSLGDRISVVALAFFLLVVIVGGAFAAGYLIGRILL* |
| Ga0157370_108134782 | 3300013104 | Corn Rhizosphere | VNPATVHSLGDRLSVFALAFFLLVVIVGGAFAAGYLIGRILL* |
| Ga0157370_108346083 | 3300013104 | Corn Rhizosphere | VTPATVHSLGDRFAVFALAFFVLVVIVGGAFAAGYLIGRILL* |
| Ga0157369_105603763 | 3300013105 | Corn Rhizosphere | VAPATVHSLGDRLSVFALAFFVLVVIVGGAFAAGYLIGRILL* |
| Ga0157369_113333791 | 3300013105 | Corn Rhizosphere | LGDRFAVFALAFFVLVVIVGGAFAAGYLLGRILL* |
| Ga0157372_120909862 | 3300013307 | Corn Rhizosphere | VAPATVHSPGDRFAVFALAFFVLVVIVGGAFAAGYLIGRILL* |
| Ga0120127_101228172 | 3300013503 | Permafrost | VSDKLSVFAFAAAVLVVIVGGAFAAGYLIGRILL* |
| Ga0134078_105003962 | 3300014157 | Grasslands Soil | VAAAPTHSVSEKLGVFAFAAIVLAVIVGSAFAAGYLIGRILL* |
| Ga0182008_101067232 | 3300014497 | Rhizosphere | VNPATVHSLGDRISVFALAFFLLVVIVGGAFAAGYLIGRILL* |
| Ga0182008_103160572 | 3300014497 | Rhizosphere | VTEKLGVFAFAIAILVVIVGGAFAAGYLIGRILL* |
| Ga0182008_103847762 | 3300014497 | Rhizosphere | VTPATVHSRGDKLSVFALAFFVLVVIVGGAFAAGYLIGRILL* |
| Ga0167637_10287852 | 3300015087 | Glacier Forefield Soil | LSDKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL* |
| Ga0167652_10403112 | 3300015164 | Glacier Forefield Soil | MATAPAHRLSDRLSVFAFAAGVLVVIVGGAFAAGYLIGRILL* |
| Ga0167658_10421222 | 3300015195 | Glacier Forefield Soil | VGEKASVFALAAFVLLAIVGGAFAAGYVIGRMLL* |
| Ga0182006_10280312 | 3300015261 | Rhizosphere | VARATPHSLGDRVSVFALAFFVLAVIVGGAFAAGYLIGRILL* |
| Ga0182007_101429293 | 3300015262 | Rhizosphere | TPAVVHSRGDKLSVFALAFFVLVVIVGGAFAAGYLIGRILL* |
| Ga0182007_102559351 | 3300015262 | Rhizosphere | VTPATVHSRGDKLSVFALAFFVLVAIVGGAFAAGYLIGRILL* |
| Ga0137403_100758323 | 3300015264 | Vadose Zone Soil | VAQARTHTASEKISVFALASFVLLTIVGGAFAAGYLIGRMFL* |
| Ga0137403_114521182 | 3300015264 | Vadose Zone Soil | MAPPHRVSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL* |
| Ga0134089_104596822 | 3300015358 | Grasslands Soil | PSSVAVAPTHSFSEKLGVFAFAAVVIAVIVGGAFAAGYLIGRILL* |
| Ga0132258_102465428 | 3300015371 | Arabidopsis Rhizosphere | VEAAPTHRAEKLGIFALAACLLVLIVGGAFTAGYLIGRILL* |
| Ga0132258_108234902 | 3300015371 | Arabidopsis Rhizosphere | VAAAGTHSGSEKLTVFAFAAFLLVVIVGGAFAAGYLIGRILL* |
| Ga0134069_11669671 | 3300017654 | Grasslands Soil | VAAATTHSVSEKLSVFALAIFVLVLIVGGAFAAGYLI |
| Ga0187824_102233252 | 3300017927 | Freshwater Sediment | MHAARTHTVGERVGIFAFAALVLTLIVGGAFAAGYLIGRIFL |
| Ga0187849_100091210 | 3300017929 | Peatland | MPRVTTHGVVEKLSIFAVAGLVLVVIVGGAFAAGYLIGRVLL |
| Ga0187821_101363151 | 3300017936 | Freshwater Sediment | VNAATHRGSEKLGVFAFAIGVLIVIVGGAFAAGYLIGRILL |
| Ga0187778_103654872 | 3300017961 | Tropical Peatland | VPRVKTHSVVEKLSIFAVAGLVLVVIVGGAFAAGYLIGRILL |
| Ga0187822_100038157 | 3300017994 | Freshwater Sediment | MHAARTHTVGERVGIFALAALVLTLIVGGAFAAGYLIGRIFL |
| Ga0187878_100344615 | 3300018005 | Peatland | MPRVTTHSVVEKLSIFAVAGLVLVVIVGGAFAAGYLIGRVLL |
| Ga0066662_110678662 | 3300018468 | Grasslands Soil | VAQARTHTASEKLSVFALAIFVLLTIVGGAFAAGYLIGRMFL |
| Ga0066669_118128332 | 3300018482 | Grasslands Soil | PSSVPVTRPHSVGERLSVFALAVFFLVSLVGVAFAAGYLIGRMLL |
| Ga0193729_10189614 | 3300019887 | Soil | MAPTHKVSEKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL |
| Ga0193751_11251272 | 3300019888 | Soil | MATAPAHKLSDKLSVFAFALGVLAVIVGGAFAAGYLIGRILL |
| Ga0193751_11861612 | 3300019888 | Soil | MAPTHRVSDKLSVFAFAAVVLLVIVGGAFAAGYLIGRILL |
| Ga0206349_10742552 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | SVTPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL |
| Ga0206354_112550902 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAAPTHTHKVNEKLGVFAFAIAVLVVIVGGAFAAGYLIG |
| Ga0206354_114933162 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTHTVSEKLGVFAFAALVLAVIVGGAFAAGYLIGRILL |
| Ga0193699_100167544 | 3300021363 | Soil | VASARPHTLGEKISVFALAAFVLLVIVGGAFAAGYLIGRMLL |
| Ga0213877_100035974 | 3300021372 | Bulk Soil | MNAVTHSPREKLSIFLFAAAVLVVVVGGAFAAGYLIGRILL |
| Ga0210402_115800302 | 3300021478 | Soil | MATAPTHKLSDKLSVFAFAAGVLLVIVGGAFAAGYLIGRILL |
| Ga0247794_103511102 | 3300024055 | Soil | VAAQTHSAGEKLTVFAFAAVLLVVIVGGAFAAGYFIGRILL |
| Ga0137417_15099362 | 3300024330 | Vadose Zone Soil | MATAPTHRLSDKLSVFAFAFGVLVVIVGGAFAAGYLIGRILL |
| Ga0208715_10937241 | 3300025482 | Arctic Peat Soil | IFSATSVAPTRPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL |
| Ga0208587_11079311 | 3300025484 | Arctic Peat Soil | VAPTRPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL |
| Ga0208586_10831702 | 3300025588 | Arctic Peat Soil | VPRPTAHSVTDKLGIFAVAALVLVVIVGGAFAAGYLIGKVLL |
| Ga0207705_100771522 | 3300025909 | Corn Rhizosphere | VTPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL |
| Ga0207707_100722052 | 3300025912 | Corn Rhizosphere | VAPARPHTFGEKVSVFALAAFVLIAIVGGAFAAGYVIGRMFL |
| Ga0207707_101702494 | 3300025912 | Corn Rhizosphere | VAHTHSVSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL |
| Ga0207707_108805672 | 3300025912 | Corn Rhizosphere | VTPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIG |
| Ga0207693_108919411 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VATATTNSVSEKLSVFTLAAVVLAVIVGGAFAAGYLIGR |
| Ga0207646_106582082 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VAQARTHTASEKLSVFALAIFVLVAIVGGAFAAGYLIGRMFL |
| Ga0207700_104771342 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMAPPHRVSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL |
| Ga0207700_111509662 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LPSSVATATTNSVSEKLSVFTLAAVVLAVIVGGAFAAGYLIGRILL |
| Ga0207664_100145523 | 3300025929 | Agricultural Soil | MATAPTHKLSDKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL |
| Ga0207664_119024721 | 3300025929 | Agricultural Soil | MAAATTHRVSEKLSVFAFAAAVLVIIVGGAFAAGYFIGRILL |
| Ga0207665_104644783 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | PTHSVSEKLSVFAFAAVVLAVIVGGAFAAGYLIGRILL |
| Ga0208415_10197892 | 3300025993 | Rice Paddy Soil | VPTHSVSEKLGVFAFAALVLAVIVGGAFAAGYLIGRILL |
| Ga0209468_10629062 | 3300026306 | Soil | VTRPHSVGERLSVFALAVFFLVSLVGVAFAAGYLIGRMLL |
| Ga0209804_12066133 | 3300026335 | Soil | TSVSEKLSVFAFAAFVLAVIVGGAFAAGYLIGRILL |
| Ga0207484_1056552 | 3300027466 | Soil | HRVSEKLGVFAFAIAILVVIVGGAFAAGYLIGRILL |
| Ga0208989_100639802 | 3300027738 | Forest Soil | MATAPTHRLGDKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL |
| Ga0209810_100012429 | 3300027773 | Surface Soil | VAAATHRGSEKLGVFAFAIGLLVVIVGGAFAAGYLIGRILL |
| Ga0209726_1000717812 | 3300027815 | Groundwater | VAPARPHTLGEKASVFALATFVLLAIVGGAFAAGYLIGRMLL |
| Ga0209060_100586272 | 3300027826 | Surface Soil | VHAAIHSPREKLSIFLFAAVVLVVVVGGAFAAGYLIGRIFL |
| Ga0209180_105664552 | 3300027846 | Vadose Zone Soil | VAQARTHTASEKLSVFALAIFVLLAIVGGAFAAGYLIGRMFL |
| Ga0209579_103099482 | 3300027869 | Surface Soil | MQAARSHTVGERVGIFAFAAFVLTVIVGGAFAAGYLIGRIFL |
| Ga0209488_106640232 | 3300027903 | Vadose Zone Soil | MATAPVHRLSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL |
| Ga0209168_102202912 | 3300027986 | Surface Soil | VAARTHTAGEKVSVFALAIFVLLAIVGGAFAAGYLIGRMLL |
| Ga0137415_110839422 | 3300028536 | Vadose Zone Soil | MAPPHRVSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL |
| Ga0265319_100196612 | 3300028563 | Rhizosphere | VAPLRPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL |
| Ga0299907_101502451 | 3300030006 | Soil | MMSKLVEQLSVFAFATVVVALIVGVAFAAGYLIGKMLL |
| Ga0299913_111490202 | 3300031229 | Soil | MSKLVEQLSVFAFATVVVALIVGVAFAAGYLIGKMLL |
| Ga0265320_100240946 | 3300031240 | Rhizosphere | PTRPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL |
| Ga0307374_101014664 | 3300031670 | Soil | VASARTHTATDKLSVFALAIFVLLAIVGGAFAAGYVIGRMFL |
| Ga0265342_105094672 | 3300031712 | Rhizosphere | VAPTRPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLI |
| Ga0310813_117003101 | 3300031716 | Soil | THSVSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL |
| Ga0308175_1001112244 | 3300031938 | Soil | VNPATVHSLGDRISVFALAFFLLVVIVGGAFAAGYLIGRILL |
| Ga0308176_127443511 | 3300031996 | Soil | VTPATVHSLGDKLSVFALAFFVLVVIVGGAFAAGYLIGRILL |
| Ga0335085_117669931 | 3300032770 | Soil | MRTATTSNVRERISVFAVAIFVLVLVVGGAFAAGYLIGRILL |
| Ga0335082_101689934 | 3300032782 | Soil | MAQFGDKLSVFAFAAFFLAVFVGLAFAVGYLIGKLLL |
| Ga0335081_109613502 | 3300032892 | Soil | VRATTHNVGEKLGVFAVAALVLVVVVGGAFAAGYLIGRVLL |
| Ga0335069_105764162 | 3300032893 | Soil | MATTSNVREKISVFAVAIFVLVVVVGGAFAAGYLIGRILL |
| Ga0334722_100409385 | 3300033233 | Sediment | MRATTHSVSERLGVFAFAAVVLVVIVGGAFAAGYLIGRILL |
| ⦗Top⦘ |