| Basic Information | |
|---|---|
| Family ID | F019500 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 229 |
| Average Sequence Length | 50 residues |
| Representative Sequence | IHWNVNASPVNYETATFTVNGVTAQQQLGAYEPLNTTNEFVVKLGFRF |
| Number of Associated Samples | 164 |
| Number of Associated Scaffolds | 229 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.18 % |
| % of genes near scaffold ends (potentially truncated) | 95.63 % |
| % of genes from short scaffolds (< 2000 bps) | 95.20 % |
| Associated GOLD sequencing projects | 140 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.476 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere (8.734 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.231 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (64.629 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 25.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 229 Family Scaffolds |
|---|---|---|
| PF00069 | Pkinase | 3.49 |
| PF00400 | WD40 | 3.06 |
| PF03641 | Lysine_decarbox | 2.18 |
| PF01364 | Peptidase_C25 | 1.75 |
| PF04972 | BON | 1.75 |
| PF02867 | Ribonuc_red_lgC | 1.31 |
| PF07366 | SnoaL | 1.31 |
| PF07995 | GSDH | 1.31 |
| PF12680 | SnoaL_2 | 1.31 |
| PF00190 | Cupin_1 | 1.31 |
| PF10009 | DUF2252 | 0.87 |
| PF13924 | Lipocalin_5 | 0.87 |
| PF12867 | DinB_2 | 0.87 |
| PF13442 | Cytochrome_CBB3 | 0.87 |
| PF07690 | MFS_1 | 0.87 |
| PF12704 | MacB_PCD | 0.87 |
| PF02687 | FtsX | 0.87 |
| PF02518 | HATPase_c | 0.87 |
| PF08450 | SGL | 0.87 |
| PF11746 | DUF3303 | 0.87 |
| PF03449 | GreA_GreB_N | 0.87 |
| PF07228 | SpoIIE | 0.87 |
| PF12796 | Ank_2 | 0.87 |
| PF14031 | D-ser_dehydrat | 0.87 |
| PF13302 | Acetyltransf_3 | 0.87 |
| PF13360 | PQQ_2 | 0.87 |
| PF13620 | CarboxypepD_reg | 0.44 |
| PF00135 | COesterase | 0.44 |
| PF13594 | Obsolete Pfam Family | 0.44 |
| PF04264 | YceI | 0.44 |
| PF08327 | AHSA1 | 0.44 |
| PF07929 | PRiA4_ORF3 | 0.44 |
| PF01590 | GAF | 0.44 |
| PF01312 | Bac_export_2 | 0.44 |
| PF13460 | NAD_binding_10 | 0.44 |
| PF02776 | TPP_enzyme_N | 0.44 |
| PF03551 | PadR | 0.44 |
| PF07676 | PD40 | 0.44 |
| PF12893 | Lumazine_bd_2 | 0.44 |
| PF11218 | DUF3011 | 0.44 |
| PF12697 | Abhydrolase_6 | 0.44 |
| PF00326 | Peptidase_S9 | 0.44 |
| PF03466 | LysR_substrate | 0.44 |
| PF06114 | Peptidase_M78 | 0.44 |
| PF01979 | Amidohydro_1 | 0.44 |
| PF00106 | adh_short | 0.44 |
| PF00912 | Transgly | 0.44 |
| PF00196 | GerE | 0.44 |
| PF04199 | Cyclase | 0.44 |
| PF13847 | Methyltransf_31 | 0.44 |
| PF03795 | YCII | 0.44 |
| PF09903 | DUF2130 | 0.44 |
| PF00581 | Rhodanese | 0.44 |
| PF08281 | Sigma70_r4_2 | 0.44 |
| PF01326 | PPDK_N | 0.44 |
| PF09278 | MerR-DNA-bind | 0.44 |
| PF00282 | Pyridoxal_deC | 0.44 |
| PF00571 | CBS | 0.44 |
| PF00903 | Glyoxalase | 0.44 |
| PF05598 | DUF772 | 0.44 |
| PF01713 | Smr | 0.44 |
| PF05721 | PhyH | 0.44 |
| PF01738 | DLH | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 229 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 13.97 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 2.18 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 1.31 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 1.31 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.87 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.87 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.87 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.44 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.44 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.44 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.44 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.44 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.44 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.44 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.44 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.44 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.44 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.48 % |
| Unclassified | root | N/A | 20.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2038011000|ACOD_FV90NF401C6Z53 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 2162886011|MRS1b_contig_5857007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1139 | Open in IMG/M |
| 2162886012|MBSR1b_contig_7563710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1527 | Open in IMG/M |
| 2170459003|FZN2CUW02HE1L3 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 2170459014|G1P06HT01EAR8Q | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11048997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101269921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300000890|JGI11643J12802_10029548 | Not Available | 671 | Open in IMG/M |
| 3300000955|JGI1027J12803_101263194 | Not Available | 539 | Open in IMG/M |
| 3300000955|JGI1027J12803_107297162 | Not Available | 701 | Open in IMG/M |
| 3300004114|Ga0062593_100510420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1117 | Open in IMG/M |
| 3300004153|Ga0063455_100977922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → unclassified Pseudomonadaceae → Pseudomonadaceae bacterium | 610 | Open in IMG/M |
| 3300004463|Ga0063356_100379323 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
| 3300004463|Ga0063356_102920760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 736 | Open in IMG/M |
| 3300004479|Ga0062595_101365656 | Not Available | 643 | Open in IMG/M |
| 3300004643|Ga0062591_100326426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1225 | Open in IMG/M |
| 3300004643|Ga0062591_100691449 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300005172|Ga0066683_10909431 | Not Available | 504 | Open in IMG/M |
| 3300005289|Ga0065704_10705812 | Not Available | 559 | Open in IMG/M |
| 3300005293|Ga0065715_10359492 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300005294|Ga0065705_11107075 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005328|Ga0070676_10224022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1243 | Open in IMG/M |
| 3300005328|Ga0070676_11388229 | Not Available | 538 | Open in IMG/M |
| 3300005329|Ga0070683_100564316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300005333|Ga0070677_10289756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium | 828 | Open in IMG/M |
| 3300005333|Ga0070677_10508988 | Not Available | 654 | Open in IMG/M |
| 3300005334|Ga0068869_100205118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis → Sulfobacillus | 1556 | Open in IMG/M |
| 3300005334|Ga0068869_101248598 | Not Available | 654 | Open in IMG/M |
| 3300005334|Ga0068869_101937243 | Not Available | 528 | Open in IMG/M |
| 3300005340|Ga0070689_100614823 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300005341|Ga0070691_10656641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300005341|Ga0070691_10680432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300005347|Ga0070668_100318219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1309 | Open in IMG/M |
| 3300005354|Ga0070675_100360263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1291 | Open in IMG/M |
| 3300005354|Ga0070675_102227042 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005355|Ga0070671_100258446 | Not Available | 1480 | Open in IMG/M |
| 3300005356|Ga0070674_100844084 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300005356|Ga0070674_101710051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300005356|Ga0070674_101823109 | Not Available | 552 | Open in IMG/M |
| 3300005364|Ga0070673_101367134 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005365|Ga0070688_100281818 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300005365|Ga0070688_101518399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300005367|Ga0070667_101278975 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005367|Ga0070667_101442203 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005438|Ga0070701_10805013 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005438|Ga0070701_10910360 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005441|Ga0070700_100054453 | All Organisms → cellular organisms → Bacteria | 2500 | Open in IMG/M |
| 3300005444|Ga0070694_101798021 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005456|Ga0070678_100259344 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300005456|Ga0070678_100884073 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300005456|Ga0070678_101378567 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005456|Ga0070678_101901452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300005457|Ga0070662_100799920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300005466|Ga0070685_10445079 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300005466|Ga0070685_11257006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300005526|Ga0073909_10518449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300005536|Ga0070697_100096574 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
| 3300005543|Ga0070672_100878480 | Not Available | 791 | Open in IMG/M |
| 3300005546|Ga0070696_100285640 | Not Available | 1259 | Open in IMG/M |
| 3300005546|Ga0070696_101432000 | All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → unclassified Caldithrix → Caldithrix sp. | 590 | Open in IMG/M |
| 3300005548|Ga0070665_100665698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300005549|Ga0070704_101516462 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005564|Ga0070664_100822177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 869 | Open in IMG/M |
| 3300005564|Ga0070664_101692076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300005615|Ga0070702_101341402 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005617|Ga0068859_100795123 | Not Available | 1034 | Open in IMG/M |
| 3300005618|Ga0068864_100634079 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300005618|Ga0068864_101045069 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300005618|Ga0068864_101907945 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005713|Ga0066905_100446831 | Not Available | 1062 | Open in IMG/M |
| 3300005713|Ga0066905_101681141 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005764|Ga0066903_101445157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 1295 | Open in IMG/M |
| 3300005764|Ga0066903_105327601 | Not Available | 680 | Open in IMG/M |
| 3300005764|Ga0066903_108485212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 524 | Open in IMG/M |
| 3300005841|Ga0068863_100050459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3943 | Open in IMG/M |
| 3300006046|Ga0066652_100240766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1579 | Open in IMG/M |
| 3300006049|Ga0075417_10246987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300006196|Ga0075422_10127254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300006237|Ga0097621_100525075 | Not Available | 1075 | Open in IMG/M |
| 3300006358|Ga0068871_100922960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300006358|Ga0068871_101798311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300006580|Ga0074049_12773749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14 | 522 | Open in IMG/M |
| 3300006852|Ga0075433_11119799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300006854|Ga0075425_101984331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300006880|Ga0075429_100790048 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300006880|Ga0075429_101530580 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006914|Ga0075436_100266732 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300009098|Ga0105245_10764831 | Not Available | 1002 | Open in IMG/M |
| 3300009148|Ga0105243_12018842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300009156|Ga0111538_10242830 | All Organisms → cellular organisms → Bacteria | 2281 | Open in IMG/M |
| 3300009162|Ga0075423_10129985 | All Organisms → cellular organisms → Bacteria | 2643 | Open in IMG/M |
| 3300009162|Ga0075423_12895034 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009177|Ga0105248_11107661 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300009177|Ga0105248_12159276 | Not Available | 633 | Open in IMG/M |
| 3300009551|Ga0105238_10085505 | All Organisms → cellular organisms → Bacteria | 3142 | Open in IMG/M |
| 3300010043|Ga0126380_11456860 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300010045|Ga0126311_11905684 | Not Available | 505 | Open in IMG/M |
| 3300010329|Ga0134111_10147272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 930 | Open in IMG/M |
| 3300010359|Ga0126376_13056760 | Not Available | 517 | Open in IMG/M |
| 3300010366|Ga0126379_12912776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300010366|Ga0126379_13527382 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010371|Ga0134125_12428633 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300010396|Ga0134126_11607522 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300010397|Ga0134124_11532266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300010398|Ga0126383_10901221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300010399|Ga0134127_10242918 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300010403|Ga0134123_12667555 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300011119|Ga0105246_11201367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium | 698 | Open in IMG/M |
| 3300011119|Ga0105246_11433559 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300011269|Ga0137392_10875448 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300011437|Ga0137429_1169460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300012021|Ga0120192_10157517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 500 | Open in IMG/M |
| 3300012212|Ga0150985_105712220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300012212|Ga0150985_106908859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012212|Ga0150985_114914461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300012212|Ga0150985_118710050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella | 810 | Open in IMG/M |
| 3300012212|Ga0150985_119359546 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300012469|Ga0150984_109309309 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300012469|Ga0150984_120168447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300012478|Ga0157328_1006663 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012895|Ga0157309_10177849 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300012899|Ga0157299_10267258 | Not Available | 550 | Open in IMG/M |
| 3300012904|Ga0157282_10021031 | Not Available | 1345 | Open in IMG/M |
| 3300012908|Ga0157286_10104768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300012908|Ga0157286_10392469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300012951|Ga0164300_10900239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
| 3300012958|Ga0164299_10410762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 873 | Open in IMG/M |
| 3300012961|Ga0164302_10094653 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300012961|Ga0164302_10979812 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300012971|Ga0126369_13621660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300012986|Ga0164304_10134543 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300012989|Ga0164305_11920966 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300013297|Ga0157378_10272521 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300013306|Ga0163162_10853115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1026 | Open in IMG/M |
| 3300013306|Ga0163162_12512406 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300013308|Ga0157375_10368516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1603 | Open in IMG/M |
| 3300013308|Ga0157375_13152542 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300014325|Ga0163163_10050561 | All Organisms → cellular organisms → Bacteria | 4093 | Open in IMG/M |
| 3300014745|Ga0157377_11424084 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300014878|Ga0180065_1081781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300014969|Ga0157376_11801631 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300014969|Ga0157376_12898515 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300015258|Ga0180093_1012928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1640 | Open in IMG/M |
| 3300015371|Ga0132258_10427959 | All Organisms → cellular organisms → Bacteria | 3295 | Open in IMG/M |
| 3300015371|Ga0132258_10444789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3230 | Open in IMG/M |
| 3300015372|Ga0132256_101387089 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300015372|Ga0132256_101537238 | Not Available | 776 | Open in IMG/M |
| 3300015373|Ga0132257_100228223 | All Organisms → cellular organisms → Bacteria | 2216 | Open in IMG/M |
| 3300015373|Ga0132257_100336729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1821 | Open in IMG/M |
| 3300015373|Ga0132257_102612318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 657 | Open in IMG/M |
| 3300015374|Ga0132255_101162941 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300015374|Ga0132255_102250618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300015374|Ga0132255_103246981 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300015374|Ga0132255_103416796 | Not Available | 676 | Open in IMG/M |
| 3300015374|Ga0132255_104326346 | Not Available | 602 | Open in IMG/M |
| 3300015374|Ga0132255_104957407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 564 | Open in IMG/M |
| 3300016387|Ga0182040_11490740 | Not Available | 574 | Open in IMG/M |
| 3300017792|Ga0163161_11528205 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300017997|Ga0184610_1190738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300018029|Ga0187787_10420144 | Not Available | 532 | Open in IMG/M |
| 3300018058|Ga0187766_10393474 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300018064|Ga0187773_11068104 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300018089|Ga0187774_11000905 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300019257|Ga0180115_1047551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300019361|Ga0173482_10600272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300021082|Ga0210380_10252652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300021445|Ga0182009_10070846 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300021445|Ga0182009_10520128 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300024055|Ga0247794_10294537 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300025885|Ga0207653_10131748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300025893|Ga0207682_10332444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium | 714 | Open in IMG/M |
| 3300025893|Ga0207682_10496056 | Not Available | 578 | Open in IMG/M |
| 3300025903|Ga0207680_11301768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium | 517 | Open in IMG/M |
| 3300025907|Ga0207645_10752141 | Not Available | 663 | Open in IMG/M |
| 3300025917|Ga0207660_11519656 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300025918|Ga0207662_10218566 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300025920|Ga0207649_10149784 | Not Available | 1606 | Open in IMG/M |
| 3300025920|Ga0207649_10784899 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300025923|Ga0207681_10286258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1299 | Open in IMG/M |
| 3300025926|Ga0207659_11217773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300025926|Ga0207659_11823582 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300025927|Ga0207687_11427120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300025935|Ga0207709_11353555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300025936|Ga0207670_10951093 | Not Available | 721 | Open in IMG/M |
| 3300025936|Ga0207670_11943105 | Not Available | 500 | Open in IMG/M |
| 3300025937|Ga0207669_10336243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
| 3300025937|Ga0207669_10560840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300025937|Ga0207669_10774125 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300025938|Ga0207704_11782249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300025940|Ga0207691_10596426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
| 3300025940|Ga0207691_11185905 | Not Available | 633 | Open in IMG/M |
| 3300025942|Ga0207689_10222340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis → Sulfobacillus | 1560 | Open in IMG/M |
| 3300025942|Ga0207689_10769826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium | 812 | Open in IMG/M |
| 3300025945|Ga0207679_12167882 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300025960|Ga0207651_11171694 | Not Available | 689 | Open in IMG/M |
| 3300025972|Ga0207668_10876849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300025981|Ga0207640_10750250 | Not Available | 841 | Open in IMG/M |
| 3300025981|Ga0207640_12064091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300025985|Ga0210117_1074408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300025986|Ga0207658_10956096 | Not Available | 781 | Open in IMG/M |
| 3300026088|Ga0207641_10361674 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300026095|Ga0207676_11118059 | Not Available | 779 | Open in IMG/M |
| 3300026095|Ga0207676_11459378 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300026121|Ga0207683_11001703 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300026121|Ga0207683_11066408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300026121|Ga0207683_11381540 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300027821|Ga0209811_10204359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300028379|Ga0268266_10881990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300028379|Ga0268266_11030567 | Not Available | 796 | Open in IMG/M |
| 3300028379|Ga0268266_11192330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300028592|Ga0247822_11438915 | Not Available | 581 | Open in IMG/M |
| 3300028608|Ga0247819_10323948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 870 | Open in IMG/M |
| 3300028792|Ga0307504_10199640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300031170|Ga0307498_10271848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 623 | Open in IMG/M |
| 3300031231|Ga0170824_117595165 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031716|Ga0310813_10890988 | Not Available | 806 | Open in IMG/M |
| 3300031720|Ga0307469_12453135 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031781|Ga0318547_11006744 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031910|Ga0306923_12397703 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300031913|Ga0310891_10393346 | Not Available | 504 | Open in IMG/M |
| 3300031939|Ga0308174_10453974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1253 | 1041 | Open in IMG/M |
| 3300032013|Ga0310906_10404121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300032017|Ga0310899_10178683 | Not Available | 925 | Open in IMG/M |
| 3300032075|Ga0310890_11333794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300032144|Ga0315910_11551730 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300032180|Ga0307471_104353303 | Not Available | 500 | Open in IMG/M |
| 3300032205|Ga0307472_101523964 | Not Available | 654 | Open in IMG/M |
| 3300033433|Ga0326726_10333141 | Not Available | 1429 | Open in IMG/M |
| 3300034148|Ga0364927_0005197 | All Organisms → cellular organisms → Bacteria | 2537 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 8.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.37% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.06% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 3.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.18% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.75% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.31% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.87% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.87% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.44% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.44% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.44% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.44% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.44% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.44% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.44% |
| Fungus Garden | Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.44% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2038011000 | Fungus garden microbial communities from Atta colombica in Panama - from dump top | Host-Associated | Open in IMG/M |
| 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ACODT_10400310 | 2038011000 | Fungus Garden | EPEYIHWNVNASPVNFETATFTVNSITVQEQLGAYEPLNRTNEFTVKFGVHF |
| MRS1b_0819.00001310 | 2162886011 | Miscanthus Rhizosphere | RQWSVEPEYVHWNVSSSAVNDETATFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF |
| MBSR1b_0915.00001390 | 2162886012 | Miscanthus Rhizosphere | PVNYETATFTVHNITVEQQLGAYEPLNRTDEFLMRVGFRF |
| E4A_05339660 | 2170459003 | Grass Soil | VHWNVNASPLNYETATFTVNGVTAAEQLGAYEPVNNTNEFGVKLGFHF |
| 2PV_02864220 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | VNNETVTFTVNRITARQQLGFYEPFNTTNEFGVKLGFKF |
| ICChiseqgaiiFebDRAFT_110489971 | 3300000363 | Soil | EYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF* |
| INPhiseqgaiiFebDRAFT_1012699211 | 3300000364 | Soil | PVNSETATFTVNNVTARQQVGFYEPLNTTNEFLVKLGXHF* |
| JGI11643J12802_100295483 | 3300000890 | Soil | RQWSVEPEYIHWNVSASDVNVETATFTVNGITARQQLGAYEPVNHTNEFNVKLGFRF* |
| JGI1027J12803_1012631942 | 3300000955 | Soil | NISSSPVNYEIATFTVNSVTVREQLGAYEPFNVTNEFGVRLGFHF* |
| JGI1027J12803_1072971621 | 3300000955 | Soil | SASPVNYETATFTVNGVTVQQQLGAYEPLNSTNEFVVKVGFHF* |
| Ga0062593_1005104201 | 3300004114 | Soil | VNYETATFTVNGITAKQDLGAYEPDNSTNEFGVRFGFRIP* |
| Ga0063455_1009779221 | 3300004153 | Soil | LNRHWSVEPSYIHWNVSASAVRESTVTFTVNGIRADQQLGAYEPDNATDEWSVNLGFHF* |
| Ga0063356_1003793234 | 3300004463 | Arabidopsis Thaliana Rhizosphere | IHWKVSDSPVNYETATFTVNDITAREQRGFYEPMNTTNEFAVKLGFHF* |
| Ga0063356_1029207601 | 3300004463 | Arabidopsis Thaliana Rhizosphere | WSVEPGYIHWNVSASNVDYSTATFTVNGITARQQLGAYEPDNATNEYFVNLGFHF* |
| Ga0062595_1013656561 | 3300004479 | Soil | PVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF* |
| Ga0062591_1003264263 | 3300004643 | Soil | HWKVSDSPVNYETATFTVNDITAREQRGFYEPMNTTNEFAVKLGFHF* |
| Ga0062591_1006914492 | 3300004643 | Soil | ASPVNYETAAYTVNRITAQESLGAYEPLNRTNEFTVKLGFRF* |
| Ga0066683_109094311 | 3300005172 | Soil | YQATRHWSLEPSYVHWNVSASPVNYSTAAFTVNNVTAQQRLGFYEPLNTTNELGVKLGFHF* |
| Ga0065704_107058121 | 3300005289 | Switchgrass Rhizosphere | AKYQMTRQWSVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF* |
| Ga0065715_103594921 | 3300005293 | Miscanthus Rhizosphere | WSVAPEYIHWNVTASPVNYETAAYTVNRITAQESLGAYEPLNRTNEFTVKLGFRF* |
| Ga0065705_111070751 | 3300005294 | Switchgrass Rhizosphere | KYQMTRQWSVEPEYIHWNVSASPVNYEAATFTVNGITVQEQVGAYEPLNRTNEFVVKLGFRFARRQ* |
| Ga0070676_102240221 | 3300005328 | Miscanthus Rhizosphere | PEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF* |
| Ga0070676_113882291 | 3300005328 | Miscanthus Rhizosphere | PEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGYRF* |
| Ga0070683_1005643162 | 3300005329 | Corn Rhizosphere | PEYTHWNVDASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLMRVGFRF* |
| Ga0070677_102897561 | 3300005333 | Miscanthus Rhizosphere | GWALRAGAKYQMTRQWSVEPEYIHWNVNASPVNYETATFTVNRITARQQVGAYEPLNRTNEFVVKLGFHF* |
| Ga0070677_105089882 | 3300005333 | Miscanthus Rhizosphere | SGWALRARAKYQITRKWSVEPEYVHWSVGASPVSYETATFTVNRITAQQQVGAYEPLNSTNEFVVKLGFHF* |
| Ga0068869_1002051182 | 3300005334 | Miscanthus Rhizosphere | YSVTRHWSVEPSYIHWSVSSSPVNFEIAEYTVNNITADEQLGAYEPVNHTNEFFVKLGFHF* |
| Ga0068869_1012485982 | 3300005334 | Miscanthus Rhizosphere | VEPEYIHWNVNASPVNYETATFTVNRITARQQVGAYEPLNRTNEFVVKLGFHF* |
| Ga0068869_1019372432 | 3300005334 | Miscanthus Rhizosphere | SSAVNDETATFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF* |
| Ga0070689_1006148232 | 3300005340 | Switchgrass Rhizosphere | TTYVRWSVDASPVSVETVSFTVNGITAQEQFGAVEPLNSTNEFAVKLGFHF* |
| Ga0070691_106566412 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VSASPVSDETATFTVNGITAREQLGAFEPLNTTREFGIKLGFHVG* |
| Ga0070691_106804321 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | GYIHWKVSASPVNYETATFTVNSITVRQQFGAYEPLNTTDEFVLKLGFRF* |
| Ga0070668_1003182191 | 3300005347 | Switchgrass Rhizosphere | WALRARAKYQMTSRWSVEPEYIHWNVSDSPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLMRVGFRF* |
| Ga0070675_1003602632 | 3300005354 | Miscanthus Rhizosphere | YIHWNVSSSPVNYETGTFTVHGITAQQPLGAYEPLNRTDEFTVKLGFHF* |
| Ga0070675_1022270422 | 3300005354 | Miscanthus Rhizosphere | VEPAYIHWNVNASPVNYETATFTVNGVTAQEQLGAYEPVNRTNEFVVKLGFHF* |
| Ga0070671_1002584462 | 3300005355 | Switchgrass Rhizosphere | VSASPVNYETATFTVNNITAQEQLGAYEPDNNTNEFGVRFGFRF* |
| Ga0070674_1008440841 | 3300005356 | Miscanthus Rhizosphere | LRASAKYQVTRRWSVEPAYIYWHVSASTVNYGTATFTVNNVTVVQQVGAYEPVNVTHEFVVRLGFHL* |
| Ga0070674_1017100512 | 3300005356 | Miscanthus Rhizosphere | VELQYIHWNVNASAVNYETATFTVNGVTARQQLGAYEPLNRTNELVAKVGFRL* |
| Ga0070674_1018231091 | 3300005356 | Miscanthus Rhizosphere | PEYIHWNVSSSPVNYETGTFTVHGITAQQPLGAYEPLNRTDEFTVKLGFHF* |
| Ga0070673_1013671341 | 3300005364 | Switchgrass Rhizosphere | ARAKYQMTRQWSVEPEYVHWNVSSSAVNDETATFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF* |
| Ga0070688_1002818181 | 3300005365 | Switchgrass Rhizosphere | PTYVRWSVDASPVSVETVSFTVNGITAQEQFGAVEPLNSTNEFAVKLGFHF* |
| Ga0070688_1015183991 | 3300005365 | Switchgrass Rhizosphere | QWWVEPEYTHWNVDASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLMRVGFRF* |
| Ga0070667_1012789752 | 3300005367 | Switchgrass Rhizosphere | VSASPVNYETATFTVNHVTVQEQFGAYEPANVTHEFVVKLGLHL* |
| Ga0070667_1014422032 | 3300005367 | Switchgrass Rhizosphere | RASAKYQVTRRWSVEPAYIYWHVSASTVNYGTATFTVNNVTVVQQVGAYEPVNVTHEFVVRLGFHL* |
| Ga0070701_108050131 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRHWSVEPSFIHWSIDASPVSDETATFTVNGITVDQQLGAYEPVNTTNEFAVKLGFHF* |
| Ga0070701_109103602 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | KYQMTRQWSVEPEYIHWNVSASNVNEETATFTVNGITVRQQLGAYEPLNSTNEFTVKLGFRF* |
| Ga0070700_1000544531 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | SKRWSVELQYIHWNVNASAVNYETATFTVNGVTARQQLGAYEPLNRTNELVAKVGFRL* |
| Ga0070694_1017980211 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | HWNVSASPVNYETATFTVNRITAQEQFGAYEPLNTTNEFTVRLGLHF* |
| Ga0070678_1002593443 | 3300005456 | Miscanthus Rhizosphere | VEPEYIHWNVSASPVSYETATFTVNGVTARQQLGAYEPLNTTNEFVVKLGFRF* |
| Ga0070678_1008840732 | 3300005456 | Miscanthus Rhizosphere | ASNVSETTATFTVNGIPAREQLGAYEPDNDTNEFFLNLGFHF* |
| Ga0070678_1013785672 | 3300005456 | Miscanthus Rhizosphere | SPVSPITATFTVNGITASEQLGAVEPVNFTNEFGVKFGFRFK* |
| Ga0070678_1019014521 | 3300005456 | Miscanthus Rhizosphere | WAVRAGGTYQVSRRWSIEPSFIHWDVDDSPVRYMTATFSVNGVTARQELGAVEPDNVTNEVSVRLGFHF* |
| Ga0070662_1007999202 | 3300005457 | Corn Rhizosphere | DSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGYRF* |
| Ga0070685_104450791 | 3300005466 | Switchgrass Rhizosphere | MTRQWSVEPEYVHWNVSSSAVNDETATFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF* |
| Ga0070685_112570061 | 3300005466 | Switchgrass Rhizosphere | KYQMTRQWSVEPQYIHWNVSDSPVSYETATYTVNGITAQEQLGAYEPLNRTNEFVVKIGLRF* |
| Ga0073909_105184492 | 3300005526 | Surface Soil | YWRVRASPVSYETATFTVNHITASEQLGAYEPLNVTREFGVKLGFHF* |
| Ga0070697_1000965741 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ASPVSYETATYTVNRITASEQLGAYEPLNVTREFGVKLGFHF* |
| Ga0070672_1008784802 | 3300005543 | Miscanthus Rhizosphere | PVSHETATFTVNSVTVRQQFGAYEPLNRTNEFVVKLGFRF* |
| Ga0070696_1002856403 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ASPVNYETATFTVRGVTAQEQLGAYEPVNRTNEFVVKLGFRF* |
| Ga0070696_1014320002 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PYYVQWRVSASPVSYETATYTVNRITASEQLGAYEPLNVTREFGVKLGFHF* |
| Ga0070665_1006656982 | 3300005548 | Switchgrass Rhizosphere | DASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLIRVGFRF* |
| Ga0070704_1015164621 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | KYQMTRQWSVEPEYIHWNVSASNVNEETATVTVNGITVRQQLGAYEPLNSTNEFTVKLGFRF* |
| Ga0070664_1008221771 | 3300005564 | Corn Rhizosphere | YETLTFTVNNITAREQRGAYEPDNNTHEFGVKVGLHF* |
| Ga0070664_1016920762 | 3300005564 | Corn Rhizosphere | THWNVDASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLMRVGFRF* |
| Ga0070702_1013414021 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | NVNEETATFTVNGITVRQQLGAYEPLNSTNEFTVKLGFRF* |
| Ga0068859_1007951231 | 3300005617 | Switchgrass Rhizosphere | PVNYQTATFTVNRVTAHQQLGAYEPWNATNEFGVRLGLHF* |
| Ga0068864_1006340792 | 3300005618 | Switchgrass Rhizosphere | ATFTVNSVRAKEQLGAYEPLNMTNEFGVKLGLHF* |
| Ga0068864_1010450691 | 3300005618 | Switchgrass Rhizosphere | KYQMTRQWSVEPEYVHWNVSSSAVNDETATFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF* |
| Ga0068864_1019079452 | 3300005618 | Switchgrass Rhizosphere | ETATFTVNNATAQEQLGAYEPVNLTSEFGVRLGFHF* |
| Ga0066905_1004468313 | 3300005713 | Tropical Forest Soil | ETATFTVNGITVQQQLGFYEPLNRTNEFVVRIGFRFSRP* |
| Ga0066905_1016811412 | 3300005713 | Tropical Forest Soil | PYYLHWHVSDSPVSYETVSFTVDRITAEQQLGAYEPLNVTREFGVKLGFHF* |
| Ga0066903_1014451571 | 3300005764 | Tropical Forest Soil | YEVATFTVNNVTAQEQLGAYEPNNSTSEFGVRLGFHF* |
| Ga0066903_1053276011 | 3300005764 | Tropical Forest Soil | SLEPSYIYWHVGASAVHEETATFTVNGVTAHEALGAFEPDNVTHEFDVKLGFTF* |
| Ga0066903_1084852122 | 3300005764 | Tropical Forest Soil | WSVEPEYIHWNVSASPVSYGTVAFTVNGITAQEQLGAYEPFNRTEEFVVKIGVRF* |
| Ga0068863_1000504597 | 3300005841 | Switchgrass Rhizosphere | SDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF* |
| Ga0066652_1002407663 | 3300006046 | Soil | HSGWAVRASAKYQLTRRWSVEPEYIHWNVSDSPVNYQTATFTVNGITVEEQLGAYEPLNHTNEFVVNLGFRF* |
| Ga0075417_102469871 | 3300006049 | Populus Rhizosphere | YPLTRHWSVEPSYIHWSVSASPVNFESVAFTVNNITAEEDLGAYEPVNHTNEFFVRLGFHF* |
| Ga0075422_101272542 | 3300006196 | Populus Rhizosphere | EPEYIHWNVSASPVNFETATFTVNGISVRQQLGFYEPLNTTNEFVMKLGFRF* |
| Ga0097621_1005250754 | 3300006237 | Miscanthus Rhizosphere | ARAKYQMTRQWSVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF* |
| Ga0068871_1009229601 | 3300006358 | Miscanthus Rhizosphere | VNYETATFTVNDVTAQEQLGAYEPLNVTSEFGVRLGFHF* |
| Ga0068871_1017983112 | 3300006358 | Miscanthus Rhizosphere | TVNDSPVNDETVTFTVHNVTADEQLGFYEPHNVTNEFGVKLGVHFK* |
| Ga0074049_127737492 | 3300006580 | Soil | TATFTVNNATALEQLGAYEPVNVTSEFGVRLAFHF* |
| Ga0075433_111197991 | 3300006852 | Populus Rhizosphere | PSYIHWSIDASPVSDETATFTVNGITVDQQLGAYEPVNTTNEFAVKLGFHF* |
| Ga0075425_1019843312 | 3300006854 | Populus Rhizosphere | VNYETASFTVNRITVQEQLGAYEPLNRTNEFVVKLGFRFQAFR* |
| Ga0075429_1007900482 | 3300006880 | Populus Rhizosphere | VNFETVAFTVNNVTAQEQWGAYEPLNTTNEFVVKLGFHF* |
| Ga0075429_1015305801 | 3300006880 | Populus Rhizosphere | IHWNVNASPVNYETATFTVNGVTAQQQLGAYEPLNTTNEFVVKLGFRF* |
| Ga0075436_1002667321 | 3300006914 | Populus Rhizosphere | VRWHVSSSPVNYETATFTVDSVTAQEQLGAYEPVNVTSEFGVRLGFH |
| Ga0105245_107648311 | 3300009098 | Miscanthus Rhizosphere | YFVHWTVSASPVNYETATFTVNNITAQEQLGAYEPDNNTNEFGVRFGFRF* |
| Ga0105243_120188422 | 3300009148 | Miscanthus Rhizosphere | ASPVNYETATFTVNGITARQQLGAYEPLNRTNEFVGRLGFRF* |
| Ga0111538_102428301 | 3300009156 | Populus Rhizosphere | IDSPVNYETATFTVHGITARQQVGAYEPLNKTDEFVVKLGVRF* |
| Ga0075423_101299851 | 3300009162 | Populus Rhizosphere | VHWNVSSSPVNYETATFTVNNVTALEQLGAYEPFNSTNEFGVRLGLHF* |
| Ga0075423_128950341 | 3300009162 | Populus Rhizosphere | SAKYQVARNWSVEPAYIHWNVNASPVNYETATFTVNGVTAQEQLGAYEPVNRTNEFVVKLGFHF* |
| Ga0105248_111076611 | 3300009177 | Switchgrass Rhizosphere | QETATFTVNNVRAKEQLGAYEPLNMTNEFGVKLGLHF* |
| Ga0105248_121592761 | 3300009177 | Switchgrass Rhizosphere | GAKYQMTRHWSVAPEYIHWNVSASPVNYETATFTVKSITVRQQLGAYEPLNRTNEFVVRLGFRF* |
| Ga0105238_100855051 | 3300009551 | Corn Rhizosphere | QLTRHWSVAPEYIHWNVSSSPVNYETATFTVNNITVDQQLGAYEPLNTTNELGVKLGFRF |
| Ga0126380_114568602 | 3300010043 | Tropical Forest Soil | RASAKYQITRLWWLEPEYIHWNVTASPVNYETATFTVNRITAHQQLGFYEPLNTTNEFVVKLGFRF* |
| Ga0126311_119056842 | 3300010045 | Serpentine Soil | MSRRWSVEGSFIHWDVGASPVRELTATFTVNGITAQQQLGALEPDNTTNEVSMGLGFHF* |
| Ga0134111_101472724 | 3300010329 | Grasslands Soil | EPYYLHWHVSASPVSDETATFTVNGITAREQLGAYEPVNFTREFGVQLGFHF* |
| Ga0126376_130567601 | 3300010359 | Tropical Forest Soil | NASAVNTGTVTFTVNNVTARELLGAYEPFNVTNEFGVKLGLHF* |
| Ga0126379_129127761 | 3300010366 | Tropical Forest Soil | WSVEPYYVHWTVSASSVNYETATFTVNGVTAQEQLGAYEPLNTTNEFGVKLGFHF* |
| Ga0126379_135273822 | 3300010366 | Tropical Forest Soil | ELSIEPEYIHWNVSASPVNDETATFTVGGITTVQQLGAYEPLNRTNEFTVKLGVRF* |
| Ga0134125_124286332 | 3300010371 | Terrestrial Soil | RARGKYQMTRQWSVEPEYIHWNVSASNVNEETATVTVNGITVRQQLGAYEPLNSTNEFTVKLGFRF* |
| Ga0134126_116075222 | 3300010396 | Terrestrial Soil | EMVTFTVNGVSASEQLGAYEPVNHTSEFGVSLGFHF* |
| Ga0134124_115322661 | 3300010397 | Terrestrial Soil | FIHWSIDASPVSDETATFTVNGITVDQQLGAYEPVNTTNEFAVKLGFHF* |
| Ga0126383_109012211 | 3300010398 | Tropical Forest Soil | SAKYQVTRNWSVEPYYVHWTVSASSVNYETATFTVNGVTAQEQLGAYEPLNTTNEFGVKLGFHF* |
| Ga0134127_102429181 | 3300010399 | Terrestrial Soil | PVSYETATFTVNGVTARQQLGAYEPLNTTNEFVVKLGFRF* |
| Ga0134123_126675552 | 3300010403 | Terrestrial Soil | VSPITATFTVNGITASEQLGAVEPVNFTNEFGVKFGFRFK* |
| Ga0105246_112013672 | 3300011119 | Miscanthus Rhizosphere | MTRQWSVEPEYIHWNVNASPVNYETATFTVNRITARQQVGAYEPLNRTNEFVVKLGFHF* |
| Ga0105246_114335591 | 3300011119 | Miscanthus Rhizosphere | RRFWVEPAYIHWKVSASPVAYETATFTVNGVTAQEQFGAVEPLNTTNEFVVKFGFRF* |
| Ga0137392_108754482 | 3300011269 | Vadose Zone Soil | VNDETVAFTVNNVTAHEQLGFYEPWNVTNEFGVKLGLHFK* |
| Ga0137429_11694601 | 3300011437 | Soil | HWNVSASPVNYETSTFTVNGDTVRQQLGAYEPLNTTNEFVVKIGLRF* |
| Ga0120192_101575172 | 3300012021 | Terrestrial | ATFTVNGISARQQVGAYEPENVTHEWFVNLGFHF* |
| Ga0150985_1057122201 | 3300012212 | Avena Fatua Rhizosphere | ATFTVNRVTAQQQLGYYEPLNATNEFVVKLGFHF* |
| Ga0150985_1069088592 | 3300012212 | Avena Fatua Rhizosphere | VGRQVFPVESETVTFTVSDVSAREQLGFYEPFIVTSEIGVRLGFHF* |
| Ga0150985_1149144613 | 3300012212 | Avena Fatua Rhizosphere | VSDSPVNYETVTFTVNRITAQEQLGYYEPFNVTNEFGLKLGFHF* |
| Ga0150985_1187100501 | 3300012212 | Avena Fatua Rhizosphere | YETATFTVNGITVEEQLGAYEPLNKTDEFVLKLGVRF* |
| Ga0150985_1193595462 | 3300012212 | Avena Fatua Rhizosphere | VEPAYIHWNVSASPVSFETATFTVNRITAQQQFGAIEPLNSTNEFAVKLGFRF* |
| Ga0150984_1093093093 | 3300012469 | Avena Fatua Rhizosphere | WGAEYTHGNVSASPVNDETATFTVNHITVDQQLGAYEPLNTTNELVVKLGFRF* |
| Ga0150984_1201684472 | 3300012469 | Avena Fatua Rhizosphere | YQFGRQWWVEPEYTHWNVDASPVNYETATFTVNNITVQQQLGAYEPLNRTDEFLMRVGFRF* |
| Ga0157328_10066631 | 3300012478 | Arabidopsis Rhizosphere | TATLTVNNATAQEQLGAYEPVNVTSEFGVRLGFHF* |
| Ga0157309_101778491 | 3300012895 | Soil | IATFTVNDVTVQQQFGAYEPLNMTHEFVVRLGFHL* |
| Ga0157299_102672582 | 3300012899 | Soil | VNFETATLTVNGITARQRLGAYEPVNHTNEFNVKLGFRF* |
| Ga0157282_100210311 | 3300012904 | Soil | MTRQWSVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF* |
| Ga0157286_101047681 | 3300012908 | Soil | VSDSPVSYETATYTVNGITAQEQLGAYEPLNRTNEFVVKIGLRF* |
| Ga0157286_103924692 | 3300012908 | Soil | YVHWNVSASPVNYETATFTVSGIRARQQWGAYEPLNKTNEFVVRLGFRF* |
| Ga0164300_109002392 | 3300012951 | Soil | PVNYETATFTVNGITAQEQFGAYEPVNVTHEFVLRLGFHL* |
| Ga0164299_104107621 | 3300012958 | Soil | VSASPVNYETATFTVTNVTAQEQLGAYEPLNLTHEFVVNFGFHF* |
| Ga0164302_100946531 | 3300012961 | Soil | NRWSVEPSYVHWRVSASNVSETTATFTVNGITAREQLGAYEPDNDTNEFFLNLGFHF* |
| Ga0164302_109798121 | 3300012961 | Soil | VSYETATFTVNGVTARQQLGAYEPLNTTNEFVVKLGFRF* |
| Ga0126369_136216601 | 3300012971 | Tropical Forest Soil | YETATFTVNGITAQEQLGAVEPLNNTNEFAIKLGFHF* |
| Ga0164304_101345432 | 3300012986 | Soil | SAKYEFTNRWSVEPSYLHWRVSASNVSETTATFTVNGITAREQLGAYEPDNDTNEFFLNLGFHF* |
| Ga0164305_119209661 | 3300012989 | Soil | PVSPIMATFTVNGITAQEQLGAVEPVNFTNEFGVKFGVRFK* |
| Ga0157378_102725211 | 3300013297 | Miscanthus Rhizosphere | ETASFTVNRITAEQQVGAYEPLNVTHEFGLKLGVHF* |
| Ga0163162_108531152 | 3300013306 | Switchgrass Rhizosphere | KYQMARRWSVEPGYIHWNVSASNVDYTTATFTVNGITARQQLGAYEPDNATNEYFVNLGFHF* |
| Ga0163162_125124062 | 3300013306 | Switchgrass Rhizosphere | VSETTATFTVNGIPAREQLGAYEPDNDTNEFFLNLGFHF* |
| Ga0157375_103685163 | 3300013308 | Miscanthus Rhizosphere | LRASARFQIARHWSAEPEYIHWNVSSSPVNYETGTFTVHGITAQQPLGAYEPLNRTDEFTVKLGFHF* |
| Ga0157375_131525421 | 3300013308 | Miscanthus Rhizosphere | RFWVEPAYIHWKVSASPVAYETATFTVNGVTAQEQFGAVEPLNTTNEFVVKFGFRF* |
| Ga0163163_100505614 | 3300014325 | Switchgrass Rhizosphere | IRASAKYQLSRRFFVEPAYIYWKVSASPVSYETASFTVNGITAQEQFGAVEPFNSTNEFAVKLSFHF* |
| Ga0157377_114240841 | 3300014745 | Miscanthus Rhizosphere | EIATFTVNGITAQEQFGAYEPRNVTNEFGVKLGIRF* |
| Ga0180065_10817812 | 3300014878 | Soil | PVNYETATFTVNCITVRQQLGAYGPLNTTNEFVVKIGLRF* |
| Ga0157376_118016311 | 3300014969 | Miscanthus Rhizosphere | VNYETATFTVNNATAQEQLGAYEPVNVTSEFGVRLGFHF* |
| Ga0157376_128985151 | 3300014969 | Miscanthus Rhizosphere | VSLETATFTVNGITAQEQLGAVEPLNNTNEFAVKLGFHF* |
| Ga0180093_10129281 | 3300015258 | Soil | IHWNVIASPVNYETSTFTVNGDTVRQQLGAYEPLNTTNEFVVKIGLRF* |
| Ga0132258_104279595 | 3300015371 | Arabidopsis Rhizosphere | PVNYETATFTVNNITAQEQMGAYEPHNITSEFGVRLHLHF* |
| Ga0132258_104447893 | 3300015371 | Arabidopsis Rhizosphere | NVGASPVNYETATFTVNSITAQEQLGAYEPLNTTNEFVVKLGFRFARRR* |
| Ga0132256_1013870892 | 3300015372 | Arabidopsis Rhizosphere | LEPSFVHWSIDASPVNYETVAFTVNNVTAHQQLGAYEPVNTTNEFAMKLGYRF* |
| Ga0132256_1015372382 | 3300015372 | Arabidopsis Rhizosphere | YQTATFTVNGITVEEQLGAYEPLNPTNEFVVNLGFRF* |
| Ga0132257_1002282231 | 3300015373 | Arabidopsis Rhizosphere | WHVGASPVSYEMASFTVNRVTAEQQIGAYEPLNVTREFGVKLGFHF* |
| Ga0132257_1003367292 | 3300015373 | Arabidopsis Rhizosphere | ATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF* |
| Ga0132257_1026123182 | 3300015373 | Arabidopsis Rhizosphere | AKYQVTRQWSVEPEFIHWNISASPVNYETATFTLDGITARQQLGAYEPVNRTNEFVVKLGFHF* |
| Ga0132255_1011629412 | 3300015374 | Arabidopsis Rhizosphere | RASAKYQLTRHWSVEPAYTHWNVSASPVNYETAAFTVNGVTVQEQFGAYEPLNSTNEFVVKLGFRF* |
| Ga0132255_1022506182 | 3300015374 | Arabidopsis Rhizosphere | IHWSVGASNVDDTTATFTVNGITARQQLGAYEPDNVTNEFSVNLGFHF* |
| Ga0132255_1032469811 | 3300015374 | Arabidopsis Rhizosphere | EPAYTHWNVSASPVNYQTATFTVNGVTAQEQFGAYEPLNSTNEFVVKLGFHF* |
| Ga0132255_1034167961 | 3300015374 | Arabidopsis Rhizosphere | NVSSSPVNYETATFTVHSITAQEQRGFYEPLNRTNEFVVKLGFRF* |
| Ga0132255_1043263461 | 3300015374 | Arabidopsis Rhizosphere | SDSPVNYETATFTVNSITARQQLGAYEPVNRTDEVFVKLGFRF* |
| Ga0132255_1049574071 | 3300015374 | Arabidopsis Rhizosphere | VNYETATFTVNRITAQQQVGAYEPLNRTNEFVVKLGFRF* |
| Ga0182040_114907401 | 3300016387 | Soil | RNWSVEPYYIHWSVSASPVNYETAMFTINDVTAQEQLGAYEPVNTTNEFGVKLGFHF |
| Ga0163161_115282051 | 3300017792 | Switchgrass Rhizosphere | RVSASNVSETTATFTVNGITAREQLGAYEPDNDTNEFFLNLGFHF |
| Ga0184610_11907381 | 3300017997 | Groundwater Sediment | KYRMTRRWSVEPDCIHWNVSASPVNYETATFTVNGNTARQQLGAYEPLNTTNEFVVKIGLRF |
| Ga0187787_104201442 | 3300018029 | Tropical Peatland | TGRWSVEPEFIHWNVSASPVNYETATFTVHGITAQQQLGAYEPLNTTNEFLVKLGFRF |
| Ga0187766_103934742 | 3300018058 | Tropical Peatland | VNASPVNTGTVAFTVNNVTAHELLGAYEPFNVTNEFGVKLGLHF |
| Ga0187773_110681042 | 3300018064 | Tropical Peatland | YQVTKSWSVEPYFVHWSVSDSPLSYETATFTVNNVTAQQQLGAYEPMNTTNEFGVKLGVH |
| Ga0187774_110009051 | 3300018089 | Tropical Peatland | FIHWNVSASQVNYETATFTVHGITAQQQLGAYEPLNTTNEFVVKLGFRF |
| Ga0180115_10475512 | 3300019257 | Groundwater Sediment | SPVNYETSTFTVNGDTVRQQLGAYEPLNTTNEFVVKIGLRF |
| Ga0173482_106002722 | 3300019361 | Soil | SLTDSQDTRETVKFTVSRVTASEQLGAYEPVNVTNEFGVTLGFHF |
| Ga0210380_102526522 | 3300021082 | Groundwater Sediment | TLRASAKYQITRQWAIEPYYVHWNVADSPVSVGTASFTVNGVTAQQQVGFYEPHNFTNEFGVKLGFRF |
| Ga0182009_100708461 | 3300021445 | Soil | YELTRGWSVEPYYVHWRVSASPVSYETATYTVNRITASEQLGAYEPLNVSREFGVKLGVH |
| Ga0182009_105201281 | 3300021445 | Soil | KYQLTRHWSVEPSYIHWNVSASPVRSSTVTFTVNGISADQPFGAYEPVNTTNEWTVALGFYF |
| Ga0247794_102945372 | 3300024055 | Soil | GWGIRASAKYQLSRRFSVEPTYVRWSVDASPVSVETVSFTVNGITAQEQFGAVEPLNSTNEFAVKLGFHF |
| Ga0207653_101317481 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | AKYQMTRHWSVEPGYIHWNVSASPVNYETATFTVNSITVRQQFGAYEPLNTTDEFVLELGFRF |
| Ga0207682_103324441 | 3300025893 | Miscanthus Rhizosphere | RAGAKYQMTRQWSVEPEYIHWNVNASPVNYETATFTVNRITARQQVGAYEPLNRTNEFVVKLGFHF |
| Ga0207682_104960561 | 3300025893 | Miscanthus Rhizosphere | ASPVSYETATFTVNRITAQQQVGAYEPLNSTNEFVVKLGFHF |
| Ga0207680_113017681 | 3300025903 | Switchgrass Rhizosphere | KYQMTRKWSVEPEYIHWNVSASPVSYETATFTVNRITARQQVGAYEPLNRTNEFVVKLGFHF |
| Ga0207645_107521412 | 3300025907 | Miscanthus Rhizosphere | VSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGYRF |
| Ga0207660_115196561 | 3300025917 | Corn Rhizosphere | YYLHWHVSDSPVSYETVSFTVNRITAEQQLGAYEPLNVTREFGVKLGFHF |
| Ga0207662_102185662 | 3300025918 | Switchgrass Rhizosphere | RAKYQMTRKWSVEPEYIHWNVSASPVSYETATFTVNRITAQQQVGAYEPLNSTNEFAVKLGFHF |
| Ga0207649_101497845 | 3300025920 | Corn Rhizosphere | RARAKYQMTRQWSVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF |
| Ga0207649_107848992 | 3300025920 | Corn Rhizosphere | PVNTQIATFTVNNVTVQQQFGAYEPLNMTHEFLVRLGFHL |
| Ga0207681_102862581 | 3300025923 | Switchgrass Rhizosphere | IHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF |
| Ga0207659_112177731 | 3300025926 | Miscanthus Rhizosphere | DSPVKYETATFTVNNVTAQEQLGAYEPHNTTNEFGVRLGFHF |
| Ga0207659_118235821 | 3300025926 | Miscanthus Rhizosphere | TATFTVNGVTAQQPFGAYEPRNVTNEFGVKLGIRF |
| Ga0207687_114271201 | 3300025927 | Miscanthus Rhizosphere | NFEIAEYTVNNISADEQLGAYEPVNHTNEFFVKLGFHF |
| Ga0207709_113535551 | 3300025935 | Miscanthus Rhizosphere | ASPVNYETATFTVNGITARQQLGAYEPLNRTNEFVGRLGFRF |
| Ga0207670_109510932 | 3300025936 | Switchgrass Rhizosphere | VNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF |
| Ga0207670_119431051 | 3300025936 | Switchgrass Rhizosphere | LRARAKYQMTRKWSVEPEYIHWNVSASPVSYETATFTVNRITAQQQVGAYEPLNSTNEFVVKLGFHF |
| Ga0207669_103362432 | 3300025937 | Miscanthus Rhizosphere | WWVEPEYTHWNVDASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLIRVGFRF |
| Ga0207669_105608402 | 3300025937 | Miscanthus Rhizosphere | SRRWSVELQYIHWNVNASAVNYETATFTVNGVTARQQLGAYEPLNRTNELVAKVGFRL |
| Ga0207669_107741251 | 3300025937 | Miscanthus Rhizosphere | LRASAKYQVTRRWSVEPAYIYWHVSASTVNYGTATFTVNNVTVVQQVGAYEPVNVTHEFVVRLGFHL |
| Ga0207704_117822491 | 3300025938 | Miscanthus Rhizosphere | VEPEYIHWNVSASPVSYETATFTVNGVTARQQLGAYEPLNTTNEFVVKLGFRF |
| Ga0207691_105964261 | 3300025940 | Miscanthus Rhizosphere | PEYTHWNVDASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLMRVGFRF |
| Ga0207691_111859052 | 3300025940 | Miscanthus Rhizosphere | SPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGYRF |
| Ga0207689_102223401 | 3300025942 | Miscanthus Rhizosphere | YSVTRHWSVEPSYIHWSVSSSPVNFEIAEYTVNNITADEQLGAYEPVNHTNEFFVKLGFH |
| Ga0207689_107698262 | 3300025942 | Miscanthus Rhizosphere | SVEPEYIHWNVNASPVNYETATFTVNRITARQQVGAYEPLNRTNEFVVKLGFHF |
| Ga0207679_121678822 | 3300025945 | Corn Rhizosphere | GWALRGRGKYQMTRRWSVEPEYIHWNVSASPVSYETATFTVNGVTARQQLGAYEPLNTTNEFVVKLGFRF |
| Ga0207651_111716942 | 3300025960 | Switchgrass Rhizosphere | VEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGYRF |
| Ga0207668_108768491 | 3300025972 | Switchgrass Rhizosphere | PVNHETATFTVNSITVRQQLGAYEPLNRTNEFIVRLGFRL |
| Ga0207640_107502501 | 3300025981 | Corn Rhizosphere | YIHWTVGASPVNYETATFTVRGVTAQEQLGAYEPVNRTNEFVVKLGFRF |
| Ga0207640_120640912 | 3300025981 | Corn Rhizosphere | WKISASPVNYETATFTVNSITVRQQFGAYEPLNRTDEFLMRVGFRF |
| Ga0210117_10744082 | 3300025985 | Natural And Restored Wetlands | FVTFTVNGIQAREQLGAYEPLNTTREAGVKVVFRF |
| Ga0207658_109560961 | 3300025986 | Switchgrass Rhizosphere | PEYIHWTVGASPVNYETATFTVRGVTAQEQLGAYEPVNRTNEFVVKLGFRF |
| Ga0207641_103616743 | 3300026088 | Switchgrass Rhizosphere | VEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF |
| Ga0207676_111180591 | 3300026095 | Switchgrass Rhizosphere | WNVSSSAVNDETAMFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF |
| Ga0207676_114593781 | 3300026095 | Switchgrass Rhizosphere | YLHWRVSASNVSETTATFTVNGIPASEQLGAYEPDNDTNEFFLNLGFHF |
| Ga0207683_110017031 | 3300026121 | Miscanthus Rhizosphere | ASNVSETTATFTVNGIPAREQLGAYEPDNDTNEFFLNLGFHF |
| Ga0207683_110664081 | 3300026121 | Miscanthus Rhizosphere | TRRWSVEPEYIHWNVSASPVSYETATFTVNGVTARQQLGAYEPLNTTNEFVVKLGFRF |
| Ga0207683_113815402 | 3300026121 | Miscanthus Rhizosphere | PDTRETVKFTVSRVTASEQLGAYEPVNVTNEFGVTLGFHF |
| Ga0209811_102043592 | 3300027821 | Surface Soil | YWRVRASPVSYETATFTVNHITASEQLGAYEPLNVTREFGVKLGFHF |
| Ga0268266_108819901 | 3300028379 | Switchgrass Rhizosphere | DASPVNYETATFTVHNITVEQQLGAYEPLNRTDEFLIRVGFRF |
| Ga0268266_110305673 | 3300028379 | Switchgrass Rhizosphere | RQWSVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF |
| Ga0268266_111923301 | 3300028379 | Switchgrass Rhizosphere | ETGTFTVHGITAQQPLGAYEPLNRTDEFTVKLGFHF |
| Ga0247822_114389151 | 3300028592 | Soil | PVNYETATFTVNTMTAREQLGAYEPVNVTSEFGVRLGVHF |
| Ga0247819_103239481 | 3300028608 | Soil | TAAYTFNTMTAREQLGAYEPVNVTSEFGVRLGVHF |
| Ga0307504_101996402 | 3300028792 | Soil | SYETATYTVNHITASEQLGAYEPLNMTREFGVKLGFHF |
| Ga0307498_102718482 | 3300031170 | Soil | SSSPVNYETATFTVNNVTAREQLGAYEPVNVTNEFGVRLGVHF |
| Ga0170824_1175951652 | 3300031231 | Forest Soil | RFSVEPAYIYWKVSASPVSIETATFTVNGITAQEQLGAVEPLNSTNEFAVKLGFHF |
| Ga0310813_108909882 | 3300031716 | Soil | RWSIEPSYIHWSVDASPVNYETATFSVNGVTARQQLGAYEPVNATDEFAVKLGFRF |
| Ga0307469_124531352 | 3300031720 | Hardwood Forest Soil | GWGLRTSAKYQMTKQWSLEPEYIHWNVGSSPVNYETASFTVNRITVQEQLGAYEPLNRTNEFVVKLGFRFKAFR |
| Ga0318547_110067441 | 3300031781 | Soil | IHWNVSTSPVNYETATFTVNGITVQEQLGAYEPLNTTNEFVVKLGLRF |
| Ga0306923_123977031 | 3300031910 | Soil | SSPVNYETVAFTVNGITAHEQLGAYEPNNNTNEFGLKLGFHF |
| Ga0310891_103933462 | 3300031913 | Soil | RAKYQMTRQWSVEPEYIHWSVSDSPVNYETATFTVNSITARQQLGAYEPVNRTDEFFVKLGFRF |
| Ga0308174_104539741 | 3300031939 | Soil | VQSSAVESETVAFTVNHVTAREQLGAYEPHNITNEIGVRLGLHF |
| Ga0310906_104041212 | 3300032013 | Soil | QTSGWALRARAKYQMTRQWSVEPEYVHWNVSSSAVNDETATFTVNGITVQQQLGAYEPLNHTNEFNVKLGFRF |
| Ga0310899_101786831 | 3300032017 | Soil | APEFIHWNVSASPVSHETATFTVNSVTVRQQFGAYEPLNRTNEFVVKLGFRF |
| Ga0310890_113337942 | 3300032075 | Soil | KYQITRRWSVEPQYIHWNVGASPVNYETATFTVNGITARQQLGAYEPLNRTNEFVGRLGFRF |
| Ga0315910_115517301 | 3300032144 | Soil | TIEGLDDVSFTQSKGWAARFGAKYQLTRQWSVEPLYVHWHVDDSTVEPVIATFTVNNITVQQQFGAVEPVNHTNEFVVKFGFRFR |
| Ga0307471_1043533031 | 3300032180 | Hardwood Forest Soil | SPVSDETATYTVRGVTATERLGAYEPLNHTNEAGVKLGFHF |
| Ga0307472_1015239641 | 3300032205 | Hardwood Forest Soil | ISASPVNDEAATFTVNSITVQQQLGAYEPLNRTNEFTVKLGFHF |
| Ga0326726_103331411 | 3300033433 | Peat Soil | NYETTTFTVNGITARQQLGFYEPVNKTNEFVVKLGFRF |
| Ga0364927_0005197_2341_2520 | 3300034148 | Sediment | MTRRWSLEPEYIHWNVSASPVNFETATFTVNRISVRQQLGFYEPLNTTNEFVMKLGFRF |
| ⦗Top⦘ |