| Basic Information | |
|---|---|
| Family ID | F018972 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 232 |
| Average Sequence Length | 47 residues |
| Representative Sequence | LAREDVLIAAPHMSFFPPLGRLRKEGSGYSWVPVVFTDQWDER |
| Number of Associated Samples | 153 |
| Number of Associated Scaffolds | 232 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.86 % |
| % of genes near scaffold ends (potentially truncated) | 99.14 % |
| % of genes from short scaffolds (< 2000 bps) | 93.53 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.707 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.914 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.621 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.293 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.94% Coil/Unstructured: 76.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 232 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 55.17 |
| PF02826 | 2-Hacid_dh_C | 6.90 |
| PF00389 | 2-Hacid_dh | 5.60 |
| PF08240 | ADH_N | 1.29 |
| PF00561 | Abhydrolase_1 | 1.29 |
| PF13561 | adh_short_C2 | 0.86 |
| PF07045 | DUF1330 | 0.86 |
| PF00106 | adh_short | 0.43 |
| PF13683 | rve_3 | 0.43 |
| PF11154 | DUF2934 | 0.43 |
| PF00107 | ADH_zinc_N | 0.43 |
| PF13581 | HATPase_c_2 | 0.43 |
| PF00903 | Glyoxalase | 0.43 |
| PF07394 | DUF1501 | 0.43 |
| PF05977 | MFS_3 | 0.43 |
| PF16925 | TetR_C_13 | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 232 Family Scaffolds |
|---|---|---|---|
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.86 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.71 % |
| Unclassified | root | N/A | 1.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_11887284 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300001181|JGI12663J13571_100525 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300001471|JGI12712J15308_10159390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300001545|JGI12630J15595_10020606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1393 | Open in IMG/M |
| 3300001593|JGI12635J15846_10435912 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300001867|JGI12627J18819_10144712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 970 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100451739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1162 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100536016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1048 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101773568 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300002914|JGI25617J43924_10353444 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005176|Ga0066679_10734068 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005294|Ga0065705_10060047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
| 3300005345|Ga0070692_10429206 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300005440|Ga0070705_101375116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300005445|Ga0070708_102000304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300005446|Ga0066686_10760432 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005467|Ga0070706_100230078 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300005467|Ga0070706_100474562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1164 | Open in IMG/M |
| 3300005468|Ga0070707_101846619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 572 | Open in IMG/M |
| 3300005468|Ga0070707_102112874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 531 | Open in IMG/M |
| 3300005468|Ga0070707_102233651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300005471|Ga0070698_100091560 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
| 3300005471|Ga0070698_101628882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300005518|Ga0070699_100209757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1734 | Open in IMG/M |
| 3300005518|Ga0070699_101724661 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005518|Ga0070699_102095701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 517 | Open in IMG/M |
| 3300005546|Ga0070696_100308854 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300005552|Ga0066701_10256983 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300005569|Ga0066705_10768891 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005615|Ga0070702_100837452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 715 | Open in IMG/M |
| 3300005617|Ga0068859_101941866 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005921|Ga0070766_10980381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300005921|Ga0070766_11140119 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006028|Ga0070717_11859737 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300006176|Ga0070765_100136130 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
| 3300006806|Ga0079220_11908940 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006844|Ga0075428_100444134 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300006854|Ga0075425_100615865 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300006871|Ga0075434_100704167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1027 | Open in IMG/M |
| 3300006871|Ga0075434_101676799 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006893|Ga0073928_11232600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 503 | Open in IMG/M |
| 3300006904|Ga0075424_102269369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300006914|Ga0075436_101423868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 525 | Open in IMG/M |
| 3300007255|Ga0099791_10357417 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300007255|Ga0099791_10438587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300007258|Ga0099793_10095593 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300007258|Ga0099793_10508618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300007265|Ga0099794_10517589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300007788|Ga0099795_10595052 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009012|Ga0066710_102260199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300009038|Ga0099829_10341814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1231 | Open in IMG/M |
| 3300009088|Ga0099830_10619751 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300009088|Ga0099830_11356645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300009089|Ga0099828_11643811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium xenopi → Mycobacterium xenopi 3993 | 565 | Open in IMG/M |
| 3300009090|Ga0099827_10342568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 1270 | Open in IMG/M |
| 3300009090|Ga0099827_10472645 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300009090|Ga0099827_10479998 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300009090|Ga0099827_11049029 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300009090|Ga0099827_11076433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300009090|Ga0099827_11077011 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300009094|Ga0111539_11571083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300009143|Ga0099792_10105281 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
| 3300009143|Ga0099792_10126949 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300009143|Ga0099792_10167483 | Not Available | 1225 | Open in IMG/M |
| 3300009156|Ga0111538_10286240 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
| 3300009162|Ga0075423_13012019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300010159|Ga0099796_10419586 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300011271|Ga0137393_10137100 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300011271|Ga0137393_10474601 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300011271|Ga0137393_10833285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300011271|Ga0137393_10987152 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300011271|Ga0137393_11346868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300012096|Ga0137389_10456229 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300012096|Ga0137389_11278705 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012096|Ga0137389_11358722 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012096|Ga0137389_11458953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300012199|Ga0137383_11237036 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012200|Ga0137382_10993525 | Not Available | 603 | Open in IMG/M |
| 3300012202|Ga0137363_10891682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300012202|Ga0137363_11379865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 594 | Open in IMG/M |
| 3300012203|Ga0137399_10331358 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300012203|Ga0137399_11434240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300012205|Ga0137362_10523268 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300012205|Ga0137362_11476726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 566 | Open in IMG/M |
| 3300012205|Ga0137362_11651217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300012361|Ga0137360_11702761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300012361|Ga0137360_11895027 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012362|Ga0137361_11142328 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300012362|Ga0137361_11949581 | Not Available | 503 | Open in IMG/M |
| 3300012363|Ga0137390_10723192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 957 | Open in IMG/M |
| 3300012363|Ga0137390_12021354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium xenopi → Mycobacterium xenopi 3993 | 501 | Open in IMG/M |
| 3300012379|Ga0134058_1115702 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300012510|Ga0157316_1085075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300012582|Ga0137358_10055496 | All Organisms → cellular organisms → Bacteria | 2645 | Open in IMG/M |
| 3300012582|Ga0137358_10613006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300012683|Ga0137398_10046878 | All Organisms → cellular organisms → Bacteria | 2541 | Open in IMG/M |
| 3300012683|Ga0137398_10447805 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300012685|Ga0137397_11320212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012917|Ga0137395_11020661 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012917|Ga0137395_11189862 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012918|Ga0137396_10239344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1338 | Open in IMG/M |
| 3300012918|Ga0137396_10815120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300012918|Ga0137396_11003970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300012923|Ga0137359_10897973 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300012923|Ga0137359_11330230 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012925|Ga0137419_10316665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1197 | Open in IMG/M |
| 3300012925|Ga0137419_10891328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300012927|Ga0137416_10369400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1208 | Open in IMG/M |
| 3300012927|Ga0137416_11589934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300012929|Ga0137404_12303422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300012930|Ga0137407_11480766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300012930|Ga0137407_11912021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300012944|Ga0137410_10142852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1816 | Open in IMG/M |
| 3300012944|Ga0137410_11344852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300012957|Ga0164303_11206958 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012958|Ga0164299_11012509 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012960|Ga0164301_10876494 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300012961|Ga0164302_10294957 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300015052|Ga0137411_1291055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 1040 | Open in IMG/M |
| 3300015054|Ga0137420_1012607 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300015054|Ga0137420_1029280 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300015241|Ga0137418_10871677 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300015372|Ga0132256_100209239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2001 | Open in IMG/M |
| 3300015372|Ga0132256_102612346 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300019789|Ga0137408_1054295 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300019789|Ga0137408_1259300 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300020034|Ga0193753_10108658 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300020170|Ga0179594_10047644 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300020579|Ga0210407_10382971 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300020579|Ga0210407_11451563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300020580|Ga0210403_10737256 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300020581|Ga0210399_10398162 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300020581|Ga0210399_10646284 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300020581|Ga0210399_11150732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300020581|Ga0210399_11225891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300020581|Ga0210399_11399869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300020583|Ga0210401_10845508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300021086|Ga0179596_10304346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
| 3300021088|Ga0210404_10103992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1437 | Open in IMG/M |
| 3300021088|Ga0210404_10111580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1393 | Open in IMG/M |
| 3300021088|Ga0210404_10254419 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300021088|Ga0210404_10477963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300021168|Ga0210406_10602068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 858 | Open in IMG/M |
| 3300021170|Ga0210400_10116688 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
| 3300021171|Ga0210405_10007242 | All Organisms → cellular organisms → Bacteria | 9775 | Open in IMG/M |
| 3300021178|Ga0210408_11415527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300021405|Ga0210387_10612936 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300021420|Ga0210394_10329254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1341 | Open in IMG/M |
| 3300021432|Ga0210384_10114067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2422 | Open in IMG/M |
| 3300021432|Ga0210384_10938676 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300021474|Ga0210390_11341257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300021475|Ga0210392_11220361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300021477|Ga0210398_10394738 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300021479|Ga0210410_10488388 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300021479|Ga0210410_10994670 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300021479|Ga0210410_11838248 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300021559|Ga0210409_10274105 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300021559|Ga0210409_10527757 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300021559|Ga0210409_11711217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300024330|Ga0137417_1060434 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300025905|Ga0207685_10165376 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300025905|Ga0207685_10272546 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300025910|Ga0207684_10794069 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300025910|Ga0207684_11524856 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300025915|Ga0207693_10391234 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300025927|Ga0207687_10477409 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300026118|Ga0207675_102685359 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300026313|Ga0209761_1243251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
| 3300026317|Ga0209154_1167394 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300026319|Ga0209647_1093770 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300026320|Ga0209131_1390364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300026333|Ga0209158_1058250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1555 | Open in IMG/M |
| 3300026371|Ga0257179_1002972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1425 | Open in IMG/M |
| 3300026446|Ga0257178_1055791 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300026469|Ga0257169_1016406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 1012 | Open in IMG/M |
| 3300026480|Ga0257177_1010317 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300026482|Ga0257172_1070036 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300026482|Ga0257172_1095758 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300026538|Ga0209056_10390429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 869 | Open in IMG/M |
| 3300027512|Ga0209179_1034167 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300027562|Ga0209735_1037212 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300027565|Ga0209219_1126670 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300027583|Ga0209527_1037264 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300027587|Ga0209220_1156738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300027591|Ga0209733_1051418 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300027603|Ga0209331_1155714 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300027629|Ga0209422_1079589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
| 3300027635|Ga0209625_1066428 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300027655|Ga0209388_1071913 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300027660|Ga0209736_1185008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300027674|Ga0209118_1013067 | All Organisms → cellular organisms → Bacteria | 2777 | Open in IMG/M |
| 3300027674|Ga0209118_1066799 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300027674|Ga0209118_1169284 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 598 | Open in IMG/M |
| 3300027674|Ga0209118_1175916 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027678|Ga0209011_1021397 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
| 3300027678|Ga0209011_1042089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1416 | Open in IMG/M |
| 3300027727|Ga0209328_10271956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300027862|Ga0209701_10280045 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300027862|Ga0209701_10433946 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300027903|Ga0209488_10016600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5348 | Open in IMG/M |
| 3300027907|Ga0207428_10968989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300027908|Ga0209006_11265358 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300028047|Ga0209526_10184386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1451 | Open in IMG/M |
| 3300028047|Ga0209526_10677706 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300028047|Ga0209526_10693535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300028047|Ga0209526_10859717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300028536|Ga0137415_10250376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1580 | Open in IMG/M |
| 3300028536|Ga0137415_11364184 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300028906|Ga0308309_10101849 | All Organisms → cellular organisms → Bacteria | 2223 | Open in IMG/M |
| 3300029636|Ga0222749_10369069 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300029636|Ga0222749_10758464 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300030991|Ga0073994_10075358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300031231|Ga0170824_109827766 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300031469|Ga0170819_11470351 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300031474|Ga0170818_111466655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300031715|Ga0307476_10453684 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300031720|Ga0307469_11624960 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031740|Ga0307468_100130658 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300031753|Ga0307477_10467516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 859 | Open in IMG/M |
| 3300031754|Ga0307475_10539108 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300031823|Ga0307478_10691606 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031962|Ga0307479_10021877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6051 | Open in IMG/M |
| 3300031962|Ga0307479_10369366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1418 | Open in IMG/M |
| 3300031962|Ga0307479_10481901 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300031962|Ga0307479_10511276 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300031962|Ga0307479_10810855 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300031962|Ga0307479_11377488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 665 | Open in IMG/M |
| 3300032000|Ga0310903_10083737 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300032174|Ga0307470_10592264 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300032180|Ga0307471_100214044 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300032180|Ga0307471_100285810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1727 | Open in IMG/M |
| 3300033412|Ga0310810_11427587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 34.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 12.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.05% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.43% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001181 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_118872841 | 3300000891 | Soil | AGPHMNFPALGRLHKERSEYSWAPVVFTDQWDKQARSPQQ* |
| JGI12663J13571_1005251 | 3300001181 | Forest Soil | EDVLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDEKQ* |
| JGI12712J15308_101593901 | 3300001471 | Forest Soil | AAPHASLFPALGRLNKDGSGYSWVPVVFTDRWDENAPSPQK* |
| JGI12630J15595_100206061 | 3300001545 | Forest Soil | APHTSLFPALGRLRKDGSGYSWAPVVFTDRWDEKQ* |
| JGI12635J15846_104359121 | 3300001593 | Forest Soil | QLLPKLAGEDVLIAGPHSSVFPPLGHLRKEGSGYRWVPVVFTDRWDER* |
| JGI12627J18819_101447121 | 3300001867 | Forest Soil | MIIAEPHSSVFPPLGRLRKEENGYSWVPVVFTDRWDDQAPSSQK* |
| JGIcombinedJ26739_1004517393 | 3300002245 | Forest Soil | AATRNQLLSKLAREDVLIAAPHTSLFPALGRLRKEGSGYSWAPVVFTDRWDEKQ* |
| JGIcombinedJ26739_1005360162 | 3300002245 | Forest Soil | EDVLIAAPHMSFFPPLGRLRKQGSGYSWAPVVFTDQWVEHAP* |
| JGIcombinedJ26739_1017735681 | 3300002245 | Forest Soil | YEFSLCASSRLRAGARSAAGATRNQLLPKLAREDVWIAGPYMSFPALGRLRKEGSRYSSAPVVFTDQWDKR* |
| JGI25617J43924_103534441 | 3300002914 | Grasslands Soil | RLARENVLIAAPHTSLFPALGRLRKEASGYSWVPVVFTDRWDDR* |
| Ga0066679_107340681 | 3300005176 | Soil | KLAREGVLIATPHTSLFPALGRLREEGSGYSWVPVVFTDQWDER* |
| Ga0065705_100600471 | 3300005294 | Switchgrass Rhizosphere | IAGPHMNFPALGRLHKEGTGYGWAPVVFTDQWSTAALSPQK* |
| Ga0070692_104292062 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LIAGPHMNFPALGRLREQGSGYGWAPVVFTDQWVENAPSPQK* |
| Ga0070705_1013751161 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VLIAGPHMNFPALGRLRKEGSGYSWAPVVFTDQWNSAALSPQK* |
| Ga0070708_1020003041 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EDVLIAGPHMNFPALGRLRKEGSGYSWAPVVFTDQWDTREPSPHE* |
| Ga0066686_107604321 | 3300005446 | Soil | MSSPVEPHTSSFPGLGRLHKEGRGYSWAPVVFTDQWDER* |
| Ga0070706_1002300783 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | REDVLIAAQHTSLFPALGRLHTEGSWYRWVPVVFTDRWDDR* |
| Ga0070706_1004745622 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | REDVLIAGPHMNFPALGRLRKEGSEYSWAPVVFTDQWDKQTPSPGK* |
| Ga0070707_1018466192 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LAREDVLIAAPHMSFFPPLGRLRKEGSGYSWVPVVFTDQWDER* |
| Ga0070707_1021128742 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FDIDQTAAAATRNQLLPKLAGADVLIASPHSSVFPPMGRLRKEGSGYNWVQVVFTDRWDEK* |
| Ga0070707_1022336512 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | REDVLIAGPHMNFPALGRLRKEGSGYSWAPVVFTDQWNKPAPSPHE* |
| Ga0070698_1000915605 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RENVLIAGPHMNFPALGRLRKEGREYSWAPVVFTDQWNTAALSPQK* |
| Ga0070698_1016288821 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | PHMPFPALGRLRKEGSGYSWVPVVFTDRWDEHAPSPQKQ* |
| Ga0070699_1002097571 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RNQLLARLARENVLIATPHTSLFPALGRLYKEGSGYGWVPVVFTDQWAEQVPSLQK* |
| Ga0070699_1017246611 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ATRQQLLPKLASEDVLIAVPHSSFFPPLGRLRKEGSGYSWAPVVFTDQWDER* |
| Ga0070699_1020957011 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ARENVLIATPHTSLFPALGRLHKEGSGYSWVPVVYTDRWDEK* |
| Ga0070696_1003088541 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ENVLIAGPHMNFPALGRLHKEGTGYGWAPVVFTDQWSTAALSPQK* |
| Ga0066701_102569832 | 3300005552 | Soil | RHQLLPKLAREDILIAGPHMNFPAVGRLRQEGSVYRWAPVVFTDQWVENASSLQK* |
| Ga0066705_107688911 | 3300005569 | Soil | EDVLIAVPHSSFFPPLGRLRKEGSGYSWAPVVFTDQWNEK* |
| Ga0070702_1008374522 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | EDVLIAGPHMNFPALGRLHKEGNGYGWAPVVFTDRWNTAALSPQK* |
| Ga0068859_1019418662 | 3300005617 | Switchgrass Rhizosphere | MRQQLLPKLANENVLIAVPHSSFFPPLGRLRKEGNGYSWVPVVFTDRWDER* |
| Ga0070766_109803811 | 3300005921 | Soil | EDVLIATPHSSFFPPLGRLRKEGSGYSWVPVVFTDQWEEK* |
| Ga0070766_111401192 | 3300005921 | Soil | ATRNQLLPKLAGGDVLIASPHSSVFPPLGRLRKEGSGYSWMPVVFTDQRDER* |
| Ga0070717_118597373 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LIAVPHSSFFPPLGRLRKEGSGYSWAPVVFTDQWDDHAPSLGK* |
| Ga0070765_1001361303 | 3300006176 | Soil | VLIAAPHTSLFPALGRLRKDESGYSWVPVVFTDRWDENAPSPQK* |
| Ga0079220_119089401 | 3300006806 | Agricultural Soil | QLLPKLARENALIAVPHSSFFPPLGRLRKEGSGYSWAPVVFTDQWNEK* |
| Ga0075428_1004441341 | 3300006844 | Populus Rhizosphere | RLVRENVLIAGPHMNFPALGRLHKEGTGYGWAPVVFTDQWSTAALSPQK* |
| Ga0075425_1006158651 | 3300006854 | Populus Rhizosphere | LAREDVLIAAPHMSFFPPLGRLRKEGSGYSWAPVVFTDQWDER* |
| Ga0075434_1007041672 | 3300006871 | Populus Rhizosphere | HQLLLKLAREDVLIAGPHMNFPAMGRLRKEGSEYRWAPVVFTDQWDTQAPSPQKW* |
| Ga0075434_1016767992 | 3300006871 | Populus Rhizosphere | DVVIAVPHSSFFPPLGRLRKEGNGYSWAPVVFTDRWDEK* |
| Ga0073928_112326002 | 3300006893 | Iron-Sulfur Acid Spring | LAREDVLIAGPHMNFPALGRLRKEGSEYSWAPVVFTDQWDKQVPSPQK* |
| Ga0075424_1022693691 | 3300006904 | Populus Rhizosphere | NFPALGRLHKEGSGYSWAPVVFTDRWKTAALSPQR* |
| Ga0075436_1014238681 | 3300006914 | Populus Rhizosphere | EDVLIAGPHMNFPAMGRLRKEGSEYRWAPVVFIDQRDTQAPSPQK* |
| Ga0099791_103574171 | 3300007255 | Vadose Zone Soil | AREDVLIAAPHMSFFPPLGRLRKEGSGYGWVPVVFTDQWAER* |
| Ga0099791_104385871 | 3300007255 | Vadose Zone Soil | RLAREDVLIAGPHMNFPALGRLGKEGSEYSWAPVVFTDQWDKHAPSPHK* |
| Ga0099793_100955933 | 3300007258 | Vadose Zone Soil | EDVLIAGPHMNFPALGRLRKERSEYSWAPVVFTDQWDKQARSPQK* |
| Ga0099793_105086182 | 3300007258 | Vadose Zone Soil | VLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENAPSPQK* |
| Ga0099794_105175891 | 3300007265 | Vadose Zone Soil | AAATRNQLLSKLAREDVLIAAPHTSLFPALGRLRKDGSGYNWVPVVFTDRWDEIAPSPQK |
| Ga0099795_105950522 | 3300007788 | Vadose Zone Soil | SREDVLIAGPHMNFPALGRLRKEGSGYSWGPVVFTDQWDKR* |
| Ga0066710_1022601991 | 3300009012 | Grasslands Soil | AATRNQLLSKLAREDVLIAAPHTSLFPAVGRLHKEGSGYSCVPVVFTDRWDENAPSPQK |
| Ga0099829_103418143 | 3300009038 | Vadose Zone Soil | LIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDEKQ* |
| Ga0099830_106197512 | 3300009088 | Vadose Zone Soil | RHQLLSKLAREDVIIAEPHSSVFPPLGRLRKEGGGYSWVPVVFTDRWDER* |
| Ga0099830_113566451 | 3300009088 | Vadose Zone Soil | DVLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENAPSPQK* |
| Ga0099828_116438111 | 3300009089 | Vadose Zone Soil | AAATRHQLLPRLAREHVLIATPHMSFFPPLGRLRREGSGYSWVPVVFTDRWADR* |
| Ga0099827_103425683 | 3300009090 | Vadose Zone Soil | RLAREDVLIATPHMSFFPPLGRLRKQGSGYSWVPVVFTDQWAER* |
| Ga0099827_104726453 | 3300009090 | Vadose Zone Soil | TRLAREDVLIAGPHMNFPALGRLRKERSEYSWAPVVFTDQWDKQARSPQQ* |
| Ga0099827_104799981 | 3300009090 | Vadose Zone Soil | IAGPHMNFPGLGRLRKEGSEYSWAPVVFTDQWDKHAPSPHK* |
| Ga0099827_110490291 | 3300009090 | Vadose Zone Soil | RNQLLSKLARKDVFIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDQWDER* |
| Ga0099827_110764331 | 3300009090 | Vadose Zone Soil | TRLAREDVLIAGPHMNFPALGRLRKERSEYSWAPVVFTDQFDKQARSPQQ* |
| Ga0099827_110770112 | 3300009090 | Vadose Zone Soil | TRQQLLTKLASEDVLIAVPHSSFFPPLGRLRKERSVYSWVPVVFTDQWDQK* |
| Ga0111539_115710831 | 3300009094 | Populus Rhizosphere | RLAREDVLIAVPHMSFFPPLGRLRKEGSGYSWAPVAFTDQWVAHAP* |
| Ga0099792_101052813 | 3300009143 | Vadose Zone Soil | VFIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENR* |
| Ga0099792_101269491 | 3300009143 | Vadose Zone Soil | QLLTKLAREDVLAAGPHMNFPALGRLRKDGSGYSLAPVVFTDRWDEK* |
| Ga0099792_101674831 | 3300009143 | Vadose Zone Soil | DVLIAGPHMNFPALGRLRKEGSGYSWAPVVFTDQWDKNANGRF* |
| Ga0111538_102862401 | 3300009156 | Populus Rhizosphere | SEDILVAGPHMNFPALGRLSKEGSGFSWAPVVFTDQWVENAPSPQK* |
| Ga0075423_130120191 | 3300009162 | Populus Rhizosphere | VLIAGPHMNFPALGRLRKEGSQYSWAPVVFTDQWDMQAPSPQK* |
| Ga0099796_104195861 | 3300010159 | Vadose Zone Soil | NENVLIAVPHSSFFPPLGRLRKEGNGYSWVPVVFTDRWDER* |
| Ga0137393_101371001 | 3300011271 | Vadose Zone Soil | IFDIDQTAAAATRNQLLARLERENVLVATPHTSLFPALGRLHKEGSGYGWVPVVFTDRWDEK* |
| Ga0137393_104746011 | 3300011271 | Vadose Zone Soil | NVLIATPHTSLFPALGRLHKEGSGYSWVPVVFTDQWEEK* |
| Ga0137393_108332851 | 3300011271 | Vadose Zone Soil | QLLSKLAREDVLIAAPHTSLFPALGRLRKDGSGYSWLPVVFTDRWDADR* |
| Ga0137393_109871521 | 3300011271 | Vadose Zone Soil | ARQQLLPKLANENVLIAVPHSSFFPPLGRLRKEGNGYSWVPVVFTDRWDER* |
| Ga0137393_113468681 | 3300011271 | Vadose Zone Soil | KLAREDVLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENAPSPQK* |
| Ga0137389_104562291 | 3300012096 | Vadose Zone Soil | QLLPKLAREDVLIAVPHSSFFPPLGRLRKEGSGYSWVPVVFTDQWEEK* |
| Ga0137389_112787051 | 3300012096 | Vadose Zone Soil | VLIAAPHTSLFPALGRLRKEASGYSWVPVVFTDRWDDR* |
| Ga0137389_113587221 | 3300012096 | Vadose Zone Soil | PKLVREDVLIAVPHSSFFPPLGHLRKEGTGYNWVPVVFTDQWDDR* |
| Ga0137389_114589532 | 3300012096 | Vadose Zone Soil | VLIAVPHSSFFPPLGRLRKEGSGYSWVPVVFTDQWEEK* |
| Ga0137383_112370361 | 3300012199 | Vadose Zone Soil | LPKLVREDVLIAVPHSSFFPPLGHLRKEGSGYNWVPVGFTDQWDDR* |
| Ga0137382_109935252 | 3300012200 | Vadose Zone Soil | DVLIATPHTSFFPALGRLHKEGSGYSWAPVVFTDQWDEHAPSPQK* |
| Ga0137363_108916821 | 3300012202 | Vadose Zone Soil | KLASEDVLIAVPHSSFFPPLGRLRKEGSGYSWVPVVFTDQWEEK* |
| Ga0137363_113798651 | 3300012202 | Vadose Zone Soil | ATRQQLLPKLASKDVLIAVPHSSFFPPLGRLRKEGSGYSWAPVVFTDQWDEHAPSPQK* |
| Ga0137399_103313583 | 3300012203 | Vadose Zone Soil | NQLLSKLAREDVLIAAPHTSLFPALGRLRKDGSGYNWVPVVFTDRWDEIAPSPQK* |
| Ga0137399_114342401 | 3300012203 | Vadose Zone Soil | VLIATPHTSLFPALGRLREEGSGYSWVPVVFTDQWEGR* |
| Ga0137362_105232682 | 3300012205 | Vadose Zone Soil | AATRQQLLPKLATEDVLIAVPHSSFFPPLGRLRKEGNGYSWVPVVFTDRWDER* |
| Ga0137362_114767263 | 3300012205 | Vadose Zone Soil | SFFPPLGRLRKEGSGYSWAPVVFTDQWDEHAPSPQK* |
| Ga0137362_116512171 | 3300012205 | Vadose Zone Soil | RNQLLSKLAREDVLIAAPHTSLFPALGRLRKDGSGFSWVPVVFTDRWDENAPSPQQ* |
| Ga0137360_117027611 | 3300012361 | Vadose Zone Soil | ATRNQLLSKLAREDVLIAAPHTSLFPALGRLRKDGSGFSWVPVVFTDRWDENAPSPQQ* |
| Ga0137360_118950271 | 3300012361 | Vadose Zone Soil | RLAREDVLIAGPHMNFPALGRLHKEESGYSWAPVVFTDQWDKVSKGDKR* |
| Ga0137361_111423281 | 3300012362 | Vadose Zone Soil | LLARLARENVLIATPHTSLFPALGRLRKDGSGYSWAPVVFTDRWDEKQ* |
| Ga0137361_119495811 | 3300012362 | Vadose Zone Soil | ASKDFLIAVPHSSFFPPLGRLRKEGSVYSWVPVVFTDRWEEK* |
| Ga0137390_107231922 | 3300012363 | Vadose Zone Soil | LAKLAREDLLIAGPHMNFPALGRLHKEGSGYSWAPVVFTDQWDER* |
| Ga0137390_120213542 | 3300012363 | Vadose Zone Soil | AAAATRHQLLPRLAREDVLIATPHMSFFPPLGRLRKQGSGYSWAPVVFTDQWAER* |
| Ga0134058_11157021 | 3300012379 | Grasslands Soil | TAAASTRHQLLSKLARENFLIAVPHSSFFPPLGRLRKEGSGYSWAPVVFTDQWYENASSPQK* |
| Ga0157316_10850751 | 3300012510 | Arabidopsis Rhizosphere | VLIAGPHMNFPAMGRLHKEGNGYGWAPVVFTDRWNTAALSPQK* |
| Ga0137358_100554961 | 3300012582 | Vadose Zone Soil | IAGPHSSLFPPLGRLRKEGNGYIWAPVVFTDQWAER* |
| Ga0137358_106130063 | 3300012582 | Vadose Zone Soil | ASEDVLIAAPHSSFFPPLGRLRKEGSVYSWAPVVFTDRWEER* |
| Ga0137398_100468785 | 3300012683 | Vadose Zone Soil | DVLIAGPHSSLFPPLGRLRKEGNGYIWAPVVFTDQWAER* |
| Ga0137398_104478051 | 3300012683 | Vadose Zone Soil | NVLIATPHTSLFPALGRLHKEGSGYSWVPVVFTDRWDKKY* |
| Ga0137397_113202121 | 3300012685 | Vadose Zone Soil | DQTAAAATRNQLLARLARENVLIATPHTSLFPALGRLRKDGSGYNWVPVVFTDRWDENAPSPQK* |
| Ga0137395_110206612 | 3300012917 | Vadose Zone Soil | TRQQLLPKLASEDVLIAVPHSSFFPPLGRLRKEGIGYSWAPVVFTDQWDER* |
| Ga0137395_111898622 | 3300012917 | Vadose Zone Soil | LLPKLAREDVLIAVPHSSFFPPLGRLRKEGSGYSWVPVVFTDQWDQR* |
| Ga0137396_102393443 | 3300012918 | Vadose Zone Soil | AREDVLIAGPHMNFPALGRLRKERSEYSWAPVVFTDQWDKQPRSPQK* |
| Ga0137396_108151201 | 3300012918 | Vadose Zone Soil | LAGEDVWIAGPHSSVFPPLGHLRKEGSGYSWVPVVFTDQWDER* |
| Ga0137396_110039702 | 3300012918 | Vadose Zone Soil | ATRNQLLSKLAREDVLIAAPHTSLFPALGRLRKDGSGYNWVPVVFTDRWDEIAPSPQK* |
| Ga0137359_108979731 | 3300012923 | Vadose Zone Soil | AAATRNQLLARLARENVLIATPHTSLFPALGRLRKDGSGYSWAPVVFTDRWDEKQ* |
| Ga0137359_113302302 | 3300012923 | Vadose Zone Soil | SEDVLIAVPHSSFFPPLGRLRKEGSGYSWVPVVFTDQWDQR* |
| Ga0137419_103166651 | 3300012925 | Vadose Zone Soil | RLARENVLIATPHTSLFPALGRLRKDGSGYSWAPVVFTDRWDEKQ* |
| Ga0137419_108913281 | 3300012925 | Vadose Zone Soil | AAATRNQLLSKLAREDVLIAAPHTSLFPALGRLRTDGSGYSWEPVVFTDRWDENR* |
| Ga0137416_103694001 | 3300012927 | Vadose Zone Soil | ARQDVLIAGPHMNFPALGRLHKEGSRYSWAPVVFTDQWNTAALSPQK* |
| Ga0137416_115899341 | 3300012927 | Vadose Zone Soil | HQLLRKLAREDVLIAAPHMSFFPPLGRLHKEKSGYSWAPVAFTDQWVDK* |
| Ga0137404_123034221 | 3300012929 | Vadose Zone Soil | NQLLARLARENVLIATPHTSLFPALGRLHKEGSGYSWVPVVFTDRWDEK* |
| Ga0137407_114807663 | 3300012930 | Vadose Zone Soil | LIAAPHSSFFPPLGRLRKEGSVYSWVPVVFTDRWEER* |
| Ga0137407_119120211 | 3300012930 | Vadose Zone Soil | LAGGDVLIAGPHSSVFPPLGRLRKEGSGYSWVPVVFTDRWDEHAPSPQTH* |
| Ga0137410_101428521 | 3300012944 | Vadose Zone Soil | KLASEDVLIAGPHMNFPGLGRFHKEGSGYSWAPVVFTDQWNTPAPSPQK* |
| Ga0137410_113448522 | 3300012944 | Vadose Zone Soil | LPRLVSEDIVIAGPHMNFPALGRLRKDGSGYSWAPVVFTDQWDAK* |
| Ga0164303_112069582 | 3300012957 | Soil | AAMRQQLLPKLTNGDVLIAVPHSSFFPPLGRLRKEGNGYSWVPVVFTDRWDER* |
| Ga0164299_110125093 | 3300012958 | Soil | ELLTKLAREDVLIAGPHMNCPALGRLHKEGNGYGWAPVVFTDRWNTAALSSQK* |
| Ga0164301_108764942 | 3300012960 | Soil | DVLIAVPHSSFFPPLGRLRKEGSGYSWVPVVFTDQWGER* |
| Ga0164302_102949571 | 3300012961 | Soil | HMNFPAVGRLRKEGSVYSWAPVVFTDQWVENAPSPQK* |
| Ga0137411_12910552 | 3300015052 | Vadose Zone Soil | IATPHMSFFPPLGRLRKEGSGYSWAPVVFTDQWAER* |
| Ga0137420_10126072 | 3300015054 | Vadose Zone Soil | MLLTKLAGGDVLIAGPHSSVFPPLGRLRKEGNGYIWAPVVFTDQWAER* |
| Ga0137420_10292801 | 3300015054 | Vadose Zone Soil | LTKLAGGDVLIAGPHSSVFPPLGRLRKEGNGYIWAPVVFTDQWAER* |
| Ga0137418_108716772 | 3300015241 | Vadose Zone Soil | IAAPHMSFFPPLGRLRKEGSGYSWAPVVFTDQWAER* |
| Ga0132256_1002092391 | 3300015372 | Arabidopsis Rhizosphere | AREDVLIAGPHMNFPALGRLHKEGNGYGWAPVVFTDRWNTAALSPQK* |
| Ga0132256_1026123462 | 3300015372 | Arabidopsis Rhizosphere | LVAGPHMNFPAVGRLRKEGSVYSWVPVVFTDQWVENAPSPQK* |
| Ga0137408_10542951 | 3300019789 | Vadose Zone Soil | LIATPHTFLFPALGRLHKEGSGYSWVPVVFTDRWDENAPSPQK |
| Ga0137408_12593002 | 3300019789 | Vadose Zone Soil | LIATPHMSVFPALGRLLKEGSGYGWVPVVFTDRWDENAPSPQK |
| Ga0193753_101086583 | 3300020034 | Soil | ALEDVLIAGPHMNFPALGRLHRERNEYSWAPVVFTDQWDKQEPSPQK |
| Ga0179594_100476443 | 3300020170 | Vadose Zone Soil | KLEREDVLIAAPHTSLFPTLGRLRKDGSGYSWVPVVFTDQWDENANGKF |
| Ga0210407_103829711 | 3300020579 | Soil | ELLPKLAAENVLIATPHSSVFPPLGRLRKEGSGYSWVPVVFTDRWDER |
| Ga0210407_114515631 | 3300020579 | Soil | AATRNQLLSKLAGGDVLIAGPHSSVFPPLGRLRKEGSAYSWVPVVFTDRWDEHAPSPQK |
| Ga0210403_107372562 | 3300020580 | Soil | NQLLARLARENVLIATPHTSLFPALGRLRKDGSGYSWAPVVFTDRWDEKQ |
| Ga0210399_103981621 | 3300020581 | Soil | NVLIAVLHSSFFPPLGHLRKEGSGYSWVPVVFTDQWNEK |
| Ga0210399_106462842 | 3300020581 | Soil | ENVLIATPHSSVFPPLGRLRKEGSGYSWVPVVFTDRWDER |
| Ga0210399_111507321 | 3300020581 | Soil | IAGPRASVFPPLGHLRKEGNGYSWVPVVFTDRWDEKQ |
| Ga0210399_112258912 | 3300020581 | Soil | DIDPTAAAATRNQLLPKLADADVLIAGPHSSVFPPLGRLRKDGNGYVWAPVVATDKTAGLVPARGD |
| Ga0210399_113998691 | 3300020581 | Soil | LLPKLASEDVLIAVPHSSFFPPLGRLRKEGTGYSWVPVVFTDQWEEK |
| Ga0210401_108455081 | 3300020583 | Soil | DGLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENAPSPQK |
| Ga0179596_103043461 | 3300021086 | Vadose Zone Soil | ENVLIATPHTSLFPALGRLHKEGSGYSWVPVVFTDRWDENAPSPQK |
| Ga0210404_101039921 | 3300021088 | Soil | TAAAATRNQLLPELAREDVVIAGPHMFPPLGRVRKEGSGYSWAPVVFTDQWAER |
| Ga0210404_101115801 | 3300021088 | Soil | LAGEDVLVAAPHTSLFPALGRLHKEGSGYSWVPVVFTDQWDENH |
| Ga0210404_102544191 | 3300021088 | Soil | RENVLIATPHASLFPALGRLRKDGTGYSWVPVVFTDRWDENAPSPQK |
| Ga0210404_104779631 | 3300021088 | Soil | QLLPKLAGGDVLIAGPHSSVFPPLGRLRKEGSGYSWVPVVFDDQWVAR |
| Ga0210406_106020681 | 3300021168 | Soil | LIATPHTSLFPALGRLHKEGSGYSWVPVVFTDRWDEK |
| Ga0210400_101166883 | 3300021170 | Soil | RDVLIAGPHSSTFPPLGRLRKEGNGYRWVPVVFDDKWVTK |
| Ga0210405_1000724214 | 3300021171 | Soil | QTAAASTRNQLLPKLAGADVLIAVPHSSVFPSLGRLRKEGSGYSWVPVVFTDRWDEQAPSPQK |
| Ga0210408_114155271 | 3300021178 | Soil | NQLLSNLVREDVLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENAPSPQK |
| Ga0210387_106129361 | 3300021405 | Soil | TAATRNQLLSNAREDVLIAAPHTSLFPALGRLRKDGSGYSWAPVVFTDRWDEKQ |
| Ga0210394_103292543 | 3300021420 | Soil | EDVLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDEKQ |
| Ga0210384_101140671 | 3300021432 | Soil | AAAATRNQLLARLARENVLIATPHTSLFPALGRLRKDGSGYSWAPVVFTDRWDEKQ |
| Ga0210384_109386761 | 3300021432 | Soil | DVLIAAPHTSLFPALGRLRKEGSGYRWVPVVFTDQWDER |
| Ga0210390_113412571 | 3300021474 | Soil | AAAATRNQLLPKLAGANVLIAVPHSSVFPPLGRLRKEGSGYTWVPVVFTDRWDEKQ |
| Ga0210392_112203611 | 3300021475 | Soil | QLLSKLAREDVLIATPHTSLFPALGRLREEGSGYGWVPVVFTDQWDDK |
| Ga0210398_103947381 | 3300021477 | Soil | QLLPKLAGGDVLIAGPHSSTFPPLGRLRKEGSGYSWMPVVFTDRWDENAPPPQKQ |
| Ga0210410_104883882 | 3300021479 | Soil | AAATRNQLLPKLAGGDVLIAGPHSSTFPPLGRLRQEGSGYSWMPVVFTDRWDENAPPPQK |
| Ga0210410_109946701 | 3300021479 | Soil | DVLIAAPHSSLFPALGRLRKDGSGYSWVPVVFTDRWDENQ |
| Ga0210410_118382482 | 3300021479 | Soil | KLAREDVLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDEK |
| Ga0210409_102741053 | 3300021559 | Soil | LPSLADRDVLIAGPHSSTFPPLGRLRKEGNGYRWVPVVFDDKWVTK |
| Ga0210409_105277571 | 3300021559 | Soil | RLARENVLIATPHASLFPALGRLRKDGSGYSWVPVVFTDRWDEKQ |
| Ga0210409_117112171 | 3300021559 | Soil | REDVIIAEPHSSVFPPLGRLRKEGSGYSWVPVVFTDRWDENAPSPQK |
| Ga0137417_10604341 | 3300024330 | Vadose Zone Soil | TAAAATRHAAAATRHQLLPKLAREDVWIAAPHMSFFPPLGRLRKEGSGYSWAPVVFTDQWAER |
| Ga0207685_101653762 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | ATRQQLLPKLASEDVLIAVPHSSFFPPLGRLRKEGNGYSWVPVVFTDRWDER |
| Ga0207685_102725462 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LAREDVLIAAPHMSFFPPLGRLRKEGSGYSWAPVIFTDQWTER |
| Ga0207684_107940692 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ARENVLVATPHASLFPALGRLRKDGSGYSWVPVVFTDRWDEKQ |
| Ga0207684_115248561 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RHQLLPRLAREDVLIAAPHMSFFPPLGRVRKEGGRYSWVPVVFTDQWVGK |
| Ga0207693_103912341 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LLSKLAREDVLIAPPHTSLFPALGRLRKDGSRYSWVPVVFTDRWDENAPSPQK |
| Ga0207687_104774091 | 3300025927 | Miscanthus Rhizosphere | LTSLARENVLIAGPHMNFPALGRLRKEGREYSWAPVVFTDQWDER |
| Ga0207675_1026853591 | 3300026118 | Switchgrass Rhizosphere | AAATRQQLLPKLANENALIAVPHSSFFPPLGRLRKEGNGYSWAPVVFTDRWDER |
| Ga0209761_12432512 | 3300026313 | Grasslands Soil | VREDVLIAGPHMNFPALGRLRKEGSGYSWVPVVFTDQWDER |
| Ga0209154_11673942 | 3300026317 | Soil | AREDVFIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENAPSPQK |
| Ga0209647_10937704 | 3300026319 | Grasslands Soil | VLIAVPHSSFFPPLGRLRKEGSGYSWAPVVFTDQWDEHAPSPQK |
| Ga0209131_13903641 | 3300026320 | Grasslands Soil | VLIAGPHMNFPGMGRVHKEGSGYSWAPVVFTDQWDKPAPPPQK |
| Ga0209158_10582501 | 3300026333 | Soil | RNQLLSNLAREDVFIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENR |
| Ga0257179_10029721 | 3300026371 | Soil | DVLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENAPSPQK |
| Ga0257178_10557912 | 3300026446 | Soil | AVPHSSFFPPLGRLRKEGSGYSWVPVVFTDQWDQR |
| Ga0257169_10164061 | 3300026469 | Soil | DVVIAGPHMFPALGRLRKEGNGYIWAPVVFSDQWAER |
| Ga0257177_10103173 | 3300026480 | Soil | RLARENVLIATPHTSLFPALGRLRKDGSGYSWAPVVFTDRWDEKQ |
| Ga0257172_10700362 | 3300026482 | Soil | LLPKLASEDVLIAVPHSSFFPPLGRLRKEGSVYSWVPVVFTDQWDQK |
| Ga0257172_10957582 | 3300026482 | Soil | LPKLASEDVLIAVPHSSFFPPLGRLRKEGSGYSWVPVVFTDQWDQR |
| Ga0209056_103904291 | 3300026538 | Soil | EDVWIAEPHTSSFPGLGRLHKESRGYSWAPVVFTDQWDER |
| Ga0209179_10341671 | 3300027512 | Vadose Zone Soil | LIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENAPSPQK |
| Ga0209735_10372122 | 3300027562 | Forest Soil | AREDVLIATPHSSVFPPLGRLRKEGSGYSWVPVVFTDQWDDK |
| Ga0209219_11266702 | 3300027565 | Forest Soil | QWLSKLAREGVVIATPHTSLFPALGRLREEGSGYSWVPVVFTDRWDER |
| Ga0209527_10372641 | 3300027583 | Forest Soil | SEDVLIAGPHMNFPALGRLRKEGSGYSWAPVVFTDQWVEHAPSPQK |
| Ga0209220_11567381 | 3300027587 | Forest Soil | QLLSKLAREDVLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENR |
| Ga0209733_10514181 | 3300027591 | Forest Soil | RNQLLPKLAGEDVLIAGPHSSVFPPLGHLRKEGSGYRWVPVVFTDRWDER |
| Ga0209331_11557142 | 3300027603 | Forest Soil | AATRHQLLPKLARENALIAVPHSSFFPPLGRLRKEGSGYSWAPVVFTDQWNEK |
| Ga0209422_10795891 | 3300027629 | Forest Soil | EGVLIATPHTSLFPALGRLREEGSGYSWVPVVFSDQWDDK |
| Ga0209625_10664282 | 3300027635 | Forest Soil | NVLIAAPHASLFPALGRLRKDGSGYSWVPVVFTDRWDEKQ |
| Ga0209388_10719132 | 3300027655 | Vadose Zone Soil | ATPHTSLFPALGRLRKDGSGYSWAPVVFTDRWDEKQ |
| Ga0209736_11850081 | 3300027660 | Forest Soil | AAPHTTLFPALGRLRKDGSGYSWVPVVFTDRWDENAPSPQK |
| Ga0209118_10130671 | 3300027674 | Forest Soil | AREDVLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDEKQ |
| Ga0209118_10667992 | 3300027674 | Forest Soil | AREDVLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENAPSPQK |
| Ga0209118_11692843 | 3300027674 | Forest Soil | EDVLIASPHTSLFPALGRVRKDGSGYSWVPVVFTDRWDDR |
| Ga0209118_11759161 | 3300027674 | Forest Soil | RNRLMPKLAREDVVIAGPHILFPSLGRVRKEGSGYTWAPVAFTDQWDKK |
| Ga0209011_10213971 | 3300027678 | Forest Soil | AAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENAPSPQK |
| Ga0209011_10420891 | 3300027678 | Forest Soil | AAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDEKQ |
| Ga0209328_102719561 | 3300027727 | Forest Soil | IAAPHTSLFPALGRLRKDRSGYSWVPVVFTDRWDENAPSPQK |
| Ga0209701_102800451 | 3300027862 | Vadose Zone Soil | RENVLIATPHTSLFPALGRLHKEGSGYSWVPVVFTDRWDEK |
| Ga0209701_104339461 | 3300027862 | Vadose Zone Soil | QLLSKLAREDVIIAEPHSSVFPPLGRLRKEGGGYSWVPVVFTDRWDER |
| Ga0209488_100166001 | 3300027903 | Vadose Zone Soil | EDGLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWNEKQ |
| Ga0207428_109689892 | 3300027907 | Populus Rhizosphere | SLAREDVLIAGPHMNFPALGRLRKEEREYSWAPVVFTDQWNTAALSPQK |
| Ga0209006_112653581 | 3300027908 | Forest Soil | VLIAVPHSSFFPPLGHLRKEGSGYSWAPVVFTDQWNEK |
| Ga0209526_101843863 | 3300028047 | Forest Soil | KLAREDVLIAAPHTSLFPALGRLRKDGSGYSWAPVVFTDRWDEKQ |
| Ga0209526_106777061 | 3300028047 | Forest Soil | DVLIAVPHSSFFPPLGRLRKEGIGYSWVPVVFTDRWDER |
| Ga0209526_106935351 | 3300028047 | Forest Soil | LLSKLAREDVLIAAPHTSLFPALGRLRKEGSGYSWAPVVFTDRWDEKQ |
| Ga0209526_108597172 | 3300028047 | Forest Soil | KLAREDVLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDEKQ |
| Ga0137415_102503761 | 3300028536 | Vadose Zone Soil | ATRNQLLSKLAREDVLIAAPHTSLFPALGRLRKDGSGYNWVPVVFTDRWDEIAPSPQK |
| Ga0137415_113641841 | 3300028536 | Vadose Zone Soil | LPKLAREDVLIAVPHSSFFPPLGRLRKEGSGYSWTPVVFTDQWDEK |
| Ga0308309_101018493 | 3300028906 | Soil | AAARDQLLSKLAREDVIIAEPHSSVFPPLGRLRKEGSGYSWVPVVFTDRWDENAPSPQK |
| Ga0222749_103690691 | 3300029636 | Soil | MNFPALGRLRKEGSGYSWAPVVFTDQWDKPAPSPQQ |
| Ga0222749_107584641 | 3300029636 | Soil | KLVREDVLIAVPHSSFFPPLGRLRKEGSGYSWTPVVFTDQWDQR |
| Ga0073994_100753582 | 3300030991 | Soil | VLIAAPHTSLFPALGRLRKDGSGYSWVPVVFTDRWDENVPSPQK |
| Ga0170824_1098277661 | 3300031231 | Forest Soil | AATRNQLLPKLTSEDVLIAVPNSSFFPPVGHLRKEGSGYSWAPVVFTDQWNEK |
| Ga0170819_114703512 | 3300031469 | Forest Soil | AAAARNQLLPKLARENVLIALPHSSFFPPVGRLRKEGSGYSWVPVVFTDQWDGK |
| Ga0170818_1114666551 | 3300031474 | Forest Soil | IAVPHSSFFPPLGRLRKEGSGYSWVPVVFTDQWEGK |
| Ga0307476_104536842 | 3300031715 | Hardwood Forest Soil | TRRQLLPKLVREDVLIAVPHSSFFPPLGRLRKEGSGYSWAPVVFTDQWNEK |
| Ga0307469_116249601 | 3300031720 | Hardwood Forest Soil | NQLLSKLVREDVLIAVPHSSLFPPLGRLRKEGNGYSWVPVVFTDRWDER |
| Ga0307468_1001306582 | 3300031740 | Hardwood Forest Soil | RRQLLRRLAREDVLIAAPHMSFFPPLGRLRKEGRGYSWAPVVFTDRWVEHAP |
| Ga0307477_104675162 | 3300031753 | Hardwood Forest Soil | AAAAATRNQLLSKLAREDVVIAGPHLKFPALGRLRNEGSSYTWEPVAYTDQWAEK |
| Ga0307475_105391081 | 3300031754 | Hardwood Forest Soil | GGDVVIAGPHSSVFPPLGRLRKEESGYSWVPVVFTDRWDGPAPSSQKH |
| Ga0307478_106916062 | 3300031823 | Hardwood Forest Soil | IDQSAAAATRNQLLPKLASEDVLIAVPHSSVFPPLGRLHKEGSGYTWMPVVFTDLWDEK |
| Ga0307479_100218779 | 3300031962 | Hardwood Forest Soil | ATRNQLLPKLAREGVVIAGPHMFPPLGRVRKEGSGYSWAPVVFTDQWAER |
| Ga0307479_103693661 | 3300031962 | Hardwood Forest Soil | IDQTAAAATRNQLLPKLAGADVLIASPHSSVFPPMGRLRKEGGGYNWVQVVFTDRWDEK |
| Ga0307479_104819013 | 3300031962 | Hardwood Forest Soil | RNQLLARLVRENVLIATPHASLFPALGRLRKDGSGYSWVSVVFTDRWDEKQ |
| Ga0307479_105112762 | 3300031962 | Hardwood Forest Soil | LLPELAREDVLIATPHSSVFPPLGRLRKEGSGYSWVPVVFTDQWDER |
| Ga0307479_108108552 | 3300031962 | Hardwood Forest Soil | AGEDVLIAGPHMNFPGLGRLRKEGCRYTWAPVVFTDQWAESAPSPQK |
| Ga0307479_113774883 | 3300031962 | Hardwood Forest Soil | DQPAAAATRNQLLSKLVREDVLIAVLHSSFFPPLGRLRKEGSGYSWAPVVFTDQWDEHAPSPQK |
| Ga0310903_100837371 | 3300032000 | Soil | NFPALGRLHKEGNGYGWAPVVFTDRWNTAALSPQK |
| Ga0307470_105922641 | 3300032174 | Hardwood Forest Soil | QLLSKLAREGVLIATPHTSLFPALGRLREDGSGYSWVPVVFTDQWDER |
| Ga0307471_1002140444 | 3300032180 | Hardwood Forest Soil | IDQTAAAATRHQLLTRLAREDVLIAGPQMNFPALGRVRKERSMYSWAPVVFTDQSEER |
| Ga0307471_1002858101 | 3300032180 | Hardwood Forest Soil | GREDVLIAGPHSSVFPPLGRLRKEGSGSSWAPVVFTDRWDEKQ |
| Ga0310810_114275871 | 3300033412 | Soil | DRCRDSAAHTSLFPALGRLREDGSGYSWVPVVFTDRWDEKQ |
| ⦗Top⦘ |