| Basic Information | |
|---|---|
| Family ID | F018614 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 234 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEIGAALG |
| Number of Associated Samples | 172 |
| Number of Associated Scaffolds | 234 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 60.94 % |
| % of genes near scaffold ends (potentially truncated) | 17.52 % |
| % of genes from short scaffolds (< 2000 bps) | 99.57 % |
| Associated GOLD sequencing projects | 163 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (94.444 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (31.197 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.376 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (73.504 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.10% β-sheet: 0.00% Coil/Unstructured: 58.90% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 234 Family Scaffolds |
|---|---|---|
| PF00004 | AAA | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.87 % |
| Unclassified | root | N/A | 5.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001263|BBAY83_10275406 | Not Available | 521 | Open in IMG/M |
| 3300001355|JGI20158J14315_10208887 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 552 | Open in IMG/M |
| 3300001828|ACM3_1041376 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 539 | Open in IMG/M |
| 3300002835|B570J40625_100965575 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 731 | Open in IMG/M |
| 3300004788|Ga0007742_10971364 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 548 | Open in IMG/M |
| 3300004789|Ga0007752_10635965 | Not Available | 562 | Open in IMG/M |
| 3300004794|Ga0007751_11212253 | Not Available | 575 | Open in IMG/M |
| 3300004836|Ga0007759_11476373 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 579 | Open in IMG/M |
| 3300005516|Ga0066831_10114428 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 732 | Open in IMG/M |
| 3300006165|Ga0075443_10338789 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 557 | Open in IMG/M |
| 3300006393|Ga0075517_1350382 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 614 | Open in IMG/M |
| 3300006397|Ga0075488_1022683 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 600 | Open in IMG/M |
| 3300006399|Ga0075495_1091098 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 616 | Open in IMG/M |
| 3300006401|Ga0075506_1501503 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 835 | Open in IMG/M |
| 3300006401|Ga0075506_1554072 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 699 | Open in IMG/M |
| 3300006403|Ga0075514_1496314 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1081 | Open in IMG/M |
| 3300006415|Ga0099654_10029086 | Not Available | 502 | Open in IMG/M |
| 3300006415|Ga0099654_10029087 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 593 | Open in IMG/M |
| 3300006419|Ga0075496_1394233 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 603 | Open in IMG/M |
| 3300007513|Ga0105019_1246278 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 824 | Open in IMG/M |
| 3300007516|Ga0105050_10437787 | Not Available | 779 | Open in IMG/M |
| 3300008929|Ga0103732_1017278 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1010 | Open in IMG/M |
| 3300008929|Ga0103732_1030871 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 796 | Open in IMG/M |
| 3300008993|Ga0104258_1048883 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 791 | Open in IMG/M |
| 3300008993|Ga0104258_1066201 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 674 | Open in IMG/M |
| 3300009263|Ga0103872_1037160 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 674 | Open in IMG/M |
| 3300009274|Ga0103878_1023601 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 658 | Open in IMG/M |
| 3300009432|Ga0115005_11120573 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 639 | Open in IMG/M |
| 3300009434|Ga0115562_1153385 | Not Available | 857 | Open in IMG/M |
| 3300009434|Ga0115562_1160518 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 831 | Open in IMG/M |
| 3300009436|Ga0115008_10177428 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1537 | Open in IMG/M |
| 3300009436|Ga0115008_10520125 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 851 | Open in IMG/M |
| 3300009436|Ga0115008_11416666 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 535 | Open in IMG/M |
| 3300009497|Ga0115569_10289425 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 725 | Open in IMG/M |
| 3300009497|Ga0115569_10488705 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 521 | Open in IMG/M |
| 3300009543|Ga0115099_10300108 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 953 | Open in IMG/M |
| 3300009592|Ga0115101_1007195 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 907 | Open in IMG/M |
| 3300009599|Ga0115103_1742561 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 599 | Open in IMG/M |
| 3300009599|Ga0115103_1750998 | Not Available | 569 | Open in IMG/M |
| 3300009606|Ga0115102_10139510 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 819 | Open in IMG/M |
| 3300009606|Ga0115102_10376865 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1180 | Open in IMG/M |
| 3300009606|Ga0115102_10947204 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 753 | Open in IMG/M |
| 3300009608|Ga0115100_10314425 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 806 | Open in IMG/M |
| 3300009608|Ga0115100_10739467 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 672 | Open in IMG/M |
| 3300009608|Ga0115100_10924436 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 1019 | Open in IMG/M |
| 3300009608|Ga0115100_11232445 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 679 | Open in IMG/M |
| 3300009677|Ga0115104_10004005 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1424 | Open in IMG/M |
| 3300009677|Ga0115104_10158427 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 804 | Open in IMG/M |
| 3300009677|Ga0115104_10179970 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 567 | Open in IMG/M |
| 3300009677|Ga0115104_11101054 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 514 | Open in IMG/M |
| 3300009732|Ga0123373_164634 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 542 | Open in IMG/M |
| 3300009785|Ga0115001_10546714 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 711 | Open in IMG/M |
| 3300009790|Ga0115012_11488119 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 581 | Open in IMG/M |
| 3300010354|Ga0129333_10563936 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 992 | Open in IMG/M |
| 3300010970|Ga0137575_10048561 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 673 | Open in IMG/M |
| 3300010981|Ga0138316_11651508 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 528 | Open in IMG/M |
| 3300010987|Ga0138324_10532403 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 584 | Open in IMG/M |
| 3300012415|Ga0138263_1250571 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 669 | Open in IMG/M |
| 3300012417|Ga0138262_1153583 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 625 | Open in IMG/M |
| 3300012419|Ga0138260_11010689 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 514 | Open in IMG/M |
| 3300012470|Ga0129329_1077504 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 565 | Open in IMG/M |
| 3300012516|Ga0129325_1141911 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 707 | Open in IMG/M |
| 3300012520|Ga0129344_1244701 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 716 | Open in IMG/M |
| 3300012520|Ga0129344_1268010 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 675 | Open in IMG/M |
| 3300012524|Ga0129331_1381880 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 876 | Open in IMG/M |
| 3300012714|Ga0157601_1254355 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 532 | Open in IMG/M |
| 3300012920|Ga0160423_10822277 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 624 | Open in IMG/M |
| 3300012962|Ga0129335_1178736 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 559 | Open in IMG/M |
| 3300012967|Ga0129343_1447420 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 663 | Open in IMG/M |
| 3300016746|Ga0182055_1024215 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 707 | Open in IMG/M |
| 3300017782|Ga0181380_1228296 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 620 | Open in IMG/M |
| 3300017788|Ga0169931_10410444 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 997 | Open in IMG/M |
| 3300017952|Ga0181583_10614518 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 653 | Open in IMG/M |
| 3300017967|Ga0181590_11000285 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 545 | Open in IMG/M |
| 3300018575|Ga0193474_1018406 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 509 | Open in IMG/M |
| 3300018601|Ga0188850_1016298 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 690 | Open in IMG/M |
| 3300018607|Ga0188821_1023079 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 575 | Open in IMG/M |
| 3300018649|Ga0192969_1025386 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 955 | Open in IMG/M |
| 3300018649|Ga0192969_1056385 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 525 | Open in IMG/M |
| 3300018674|Ga0193166_1031638 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 516 | Open in IMG/M |
| 3300018684|Ga0192983_1016948 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 946 | Open in IMG/M |
| 3300018684|Ga0192983_1053031 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 557 | Open in IMG/M |
| 3300018692|Ga0192944_1034161 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 737 | Open in IMG/M |
| 3300018692|Ga0192944_1040397 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 676 | Open in IMG/M |
| 3300018725|Ga0193517_1044036 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 813 | Open in IMG/M |
| 3300018730|Ga0192967_1029659 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 901 | Open in IMG/M |
| 3300018730|Ga0192967_1051499 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 689 | Open in IMG/M |
| 3300018765|Ga0193031_1053305 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 675 | Open in IMG/M |
| 3300018800|Ga0193306_1039712 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 726 | Open in IMG/M |
| 3300018832|Ga0194240_1023342 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 593 | Open in IMG/M |
| 3300018838|Ga0193302_1067919 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 594 | Open in IMG/M |
| 3300018842|Ga0193219_1049378 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 646 | Open in IMG/M |
| 3300018846|Ga0193253_1055873 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 975 | Open in IMG/M |
| 3300018846|Ga0193253_1090090 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 727 | Open in IMG/M |
| 3300018846|Ga0193253_1120042 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 592 | Open in IMG/M |
| 3300018874|Ga0192977_1079618 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 661 | Open in IMG/M |
| 3300018885|Ga0193311_10043548 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 649 | Open in IMG/M |
| 3300018899|Ga0193090_1145132 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 519 | Open in IMG/M |
| 3300018974|Ga0192873_10115137 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1150 | Open in IMG/M |
| 3300018974|Ga0192873_10340021 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 626 | Open in IMG/M |
| 3300018976|Ga0193254_10149348 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 533 | Open in IMG/M |
| 3300018980|Ga0192961_10137254 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 746 | Open in IMG/M |
| 3300018982|Ga0192947_10125296 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 857 | Open in IMG/M |
| 3300018989|Ga0193030_10116883 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 838 | Open in IMG/M |
| 3300018989|Ga0193030_10240759 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 594 | Open in IMG/M |
| 3300019001|Ga0193034_10129805 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 600 | Open in IMG/M |
| 3300019010|Ga0193044_10239214 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 563 | Open in IMG/M |
| 3300019027|Ga0192909_10111945 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 721 | Open in IMG/M |
| 3300019027|Ga0192909_10235018 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 559 | Open in IMG/M |
| 3300019031|Ga0193516_10040569 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 1516 | Open in IMG/M |
| 3300019031|Ga0193516_10092878 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1027 | Open in IMG/M |
| 3300019031|Ga0193516_10251921 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 574 | Open in IMG/M |
| 3300019031|Ga0193516_10253790 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 572 | Open in IMG/M |
| 3300019032|Ga0192869_10256810 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 757 | Open in IMG/M |
| 3300019032|Ga0192869_10299778 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 701 | Open in IMG/M |
| 3300019032|Ga0192869_10394585 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 602 | Open in IMG/M |
| 3300019033|Ga0193037_10370927 | Not Available | 506 | Open in IMG/M |
| 3300019036|Ga0192945_10126652 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 816 | Open in IMG/M |
| 3300019036|Ga0192945_10141263 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 774 | Open in IMG/M |
| 3300019036|Ga0192945_10205060 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 632 | Open in IMG/M |
| 3300019039|Ga0193123_10387232 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 547 | Open in IMG/M |
| 3300019045|Ga0193336_10434503 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 618 | Open in IMG/M |
| 3300019048|Ga0192981_10135878 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 972 | Open in IMG/M |
| 3300019050|Ga0192966_10080010 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1091 | Open in IMG/M |
| 3300019050|Ga0192966_10127094 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 894 | Open in IMG/M |
| 3300019051|Ga0192826_10323881 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 561 | Open in IMG/M |
| 3300019051|Ga0192826_10378088 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 511 | Open in IMG/M |
| 3300019051|Ga0192826_10391990 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 500 | Open in IMG/M |
| 3300019095|Ga0188866_1009416 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 957 | Open in IMG/M |
| 3300019095|Ga0188866_1010342 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 924 | Open in IMG/M |
| 3300019095|Ga0188866_1022181 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 667 | Open in IMG/M |
| 3300019095|Ga0188866_1027503 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 596 | Open in IMG/M |
| 3300019108|Ga0192972_1083996 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 561 | Open in IMG/M |
| 3300019117|Ga0193054_1039411 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 711 | Open in IMG/M |
| 3300019131|Ga0193249_1135384 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 537 | Open in IMG/M |
| 3300019149|Ga0188870_10101581 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 689 | Open in IMG/M |
| 3300019149|Ga0188870_10107486 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 665 | Open in IMG/M |
| 3300019149|Ga0188870_10109440 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 657 | Open in IMG/M |
| 3300019150|Ga0194244_10121339 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 510 | Open in IMG/M |
| 3300019150|Ga0194244_10125892 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 503 | Open in IMG/M |
| 3300019282|Ga0182075_1496176 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 503 | Open in IMG/M |
| 3300020595|Ga0206126_10162782 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1056 | Open in IMG/M |
| 3300021091|Ga0194133_10607920 | Not Available | 528 | Open in IMG/M |
| 3300021093|Ga0194123_10474569 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 559 | Open in IMG/M |
| 3300021169|Ga0206687_1092963 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 690 | Open in IMG/M |
| 3300021169|Ga0206687_1773715 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1150 | Open in IMG/M |
| 3300021342|Ga0206691_1114250 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 918 | Open in IMG/M |
| 3300021345|Ga0206688_10647539 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 702 | Open in IMG/M |
| 3300021350|Ga0206692_1777253 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 640 | Open in IMG/M |
| 3300021355|Ga0206690_10661913 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 598 | Open in IMG/M |
| 3300021355|Ga0206690_10740562 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 994 | Open in IMG/M |
| 3300021376|Ga0194130_10440229 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 681 | Open in IMG/M |
| 3300021872|Ga0063132_104360 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 968 | Open in IMG/M |
| 3300021872|Ga0063132_105710 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 682 | Open in IMG/M |
| 3300021872|Ga0063132_107846 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 649 | Open in IMG/M |
| 3300021872|Ga0063132_118611 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 702 | Open in IMG/M |
| 3300021887|Ga0063105_1025700 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 866 | Open in IMG/M |
| 3300021902|Ga0063086_1005731 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 680 | Open in IMG/M |
| 3300021912|Ga0063133_1032868 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 600 | Open in IMG/M |
| 3300021922|Ga0063869_1023876 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 569 | Open in IMG/M |
| 3300021941|Ga0063102_1114083 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 540 | Open in IMG/M |
| 3300021950|Ga0063101_1025327 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 703 | Open in IMG/M |
| 3300021957|Ga0222717_10344080 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 839 | Open in IMG/M |
| 3300021962|Ga0222713_10526258 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 702 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10047813 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1275 | Open in IMG/M |
| 3300023695|Ga0228680_1030771 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 615 | Open in IMG/M |
| 3300023698|Ga0228682_1015379 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 1006 | Open in IMG/M |
| 3300023704|Ga0228684_1073876 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 532 | Open in IMG/M |
| 3300025508|Ga0208148_1049384 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 1046 | Open in IMG/M |
| 3300025620|Ga0209405_1100607 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 831 | Open in IMG/M |
| 3300025880|Ga0209534_10352593 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 655 | Open in IMG/M |
| 3300025890|Ga0209631_10217439 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 973 | Open in IMG/M |
| 3300026182|Ga0208275_1059268 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 755 | Open in IMG/M |
| 3300026447|Ga0247607_1079817 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 578 | Open in IMG/M |
| 3300026465|Ga0247588_1117925 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 532 | Open in IMG/M |
| 3300027194|Ga0208799_1061659 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 506 | Open in IMG/M |
| 3300027248|Ga0208176_1014480 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1086 | Open in IMG/M |
| 3300027780|Ga0209502_10451461 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 515 | Open in IMG/M |
| 3300027899|Ga0209668_10362629 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 942 | Open in IMG/M |
| 3300027971|Ga0209401_1234802 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 666 | Open in IMG/M |
| 3300028106|Ga0247596_1073023 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 771 | Open in IMG/M |
| 3300028106|Ga0247596_1169435 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 500 | Open in IMG/M |
| 3300028134|Ga0256411_1201959 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 629 | Open in IMG/M |
| 3300028137|Ga0256412_1313041 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 577 | Open in IMG/M |
| 3300028233|Ga0256417_1108965 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 746 | Open in IMG/M |
| 3300028282|Ga0256413_1296684 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 570 | Open in IMG/M |
| 3300028282|Ga0256413_1352037 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 515 | Open in IMG/M |
| 3300028290|Ga0247572_1091564 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 747 | Open in IMG/M |
| 3300028333|Ga0247595_1094364 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 507 | Open in IMG/M |
| 3300028575|Ga0304731_10745153 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 683 | Open in IMG/M |
| 3300030671|Ga0307403_10478991 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 672 | Open in IMG/M |
| 3300030671|Ga0307403_10612227 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 591 | Open in IMG/M |
| 3300030709|Ga0307400_10246789 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1126 | Open in IMG/M |
| 3300030709|Ga0307400_10778284 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 592 | Open in IMG/M |
| 3300031062|Ga0073989_13229034 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 589 | Open in IMG/M |
| 3300031062|Ga0073989_13259001 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 610 | Open in IMG/M |
| 3300031580|Ga0308132_1102045 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 589 | Open in IMG/M |
| 3300031638|Ga0302125_10098088 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 963 | Open in IMG/M |
| 3300031710|Ga0307386_10592918 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 586 | Open in IMG/M |
| 3300031717|Ga0307396_10426096 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 636 | Open in IMG/M |
| 3300031717|Ga0307396_10567796 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 545 | Open in IMG/M |
| 3300031725|Ga0307381_10040203 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 1370 | Open in IMG/M |
| 3300031725|Ga0307381_10137828 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 828 | Open in IMG/M |
| 3300031725|Ga0307381_10163035 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 768 | Open in IMG/M |
| 3300031729|Ga0307391_10735886 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 563 | Open in IMG/M |
| 3300031729|Ga0307391_10827104 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 532 | Open in IMG/M |
| 3300031734|Ga0307397_10194889 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 894 | Open in IMG/M |
| 3300031734|Ga0307397_10315510 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 711 | Open in IMG/M |
| 3300031734|Ga0307397_10496775 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 570 | Open in IMG/M |
| 3300031738|Ga0307384_10170765 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 946 | Open in IMG/M |
| 3300031739|Ga0307383_10104974 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 1253 | Open in IMG/M |
| 3300031739|Ga0307383_10458746 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 631 | Open in IMG/M |
| 3300031752|Ga0307404_10490625 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 517 | Open in IMG/M |
| 3300031851|Ga0315320_10762407 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 613 | Open in IMG/M |
| 3300032360|Ga0315334_11254953 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 639 | Open in IMG/M |
| 3300032462|Ga0335396_10491681 | Not Available | 779 | Open in IMG/M |
| 3300032462|Ga0335396_10908244 | Not Available | 520 | Open in IMG/M |
| 3300032463|Ga0314684_10550798 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 674 | Open in IMG/M |
| 3300032470|Ga0314670_10458163 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 667 | Open in IMG/M |
| 3300032491|Ga0314675_10559389 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 562 | Open in IMG/M |
| 3300032615|Ga0314674_10463530 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 656 | Open in IMG/M |
| 3300032707|Ga0314687_10661754 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 581 | Open in IMG/M |
| 3300032709|Ga0314672_1312178 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 585 | Open in IMG/M |
| 3300032713|Ga0314690_10349329 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 734 | Open in IMG/M |
| 3300032713|Ga0314690_10572559 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 556 | Open in IMG/M |
| 3300032724|Ga0314695_1375112 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 540 | Open in IMG/M |
| 3300032725|Ga0314702_1133527 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 916 | Open in IMG/M |
| 3300032727|Ga0314693_10716562 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 538 | Open in IMG/M |
| 3300032744|Ga0314705_10584429 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 595 | Open in IMG/M |
| 3300032745|Ga0314704_10768295 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 513 | Open in IMG/M |
| 3300032747|Ga0314712_10564534 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 528 | Open in IMG/M |
| 3300032751|Ga0314694_10318990 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 665 | Open in IMG/M |
| 3300033572|Ga0307390_10549119 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani | 718 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 31.20% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 20.09% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 6.41% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.41% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.98% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.98% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.99% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.14% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.71% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.28% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.28% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 1.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.85% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.85% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.85% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.85% |
| Surface Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water | 0.85% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.85% |
| Ice Edge, Mcmurdo Sound, Antarctica | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica | 0.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.43% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.43% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.43% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.43% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.43% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.43% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.43% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.43% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.43% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.43% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.43% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001263 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83 | Host-Associated | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001828 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM3, ROCA_DNA076_2.0um_10f | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004788 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004789 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005516 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006393 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006397 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006399 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006415 | Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake community | Environmental | Open in IMG/M |
| 3300006419 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007513 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300008929 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1A | Environmental | Open in IMG/M |
| 3300008993 | Marine microbial communities from eastern North Pacific Ocean - P1 free-living | Environmental | Open in IMG/M |
| 3300009263 | Eukaryotic communities of water from the North Atlantic ocean - ACM27 | Environmental | Open in IMG/M |
| 3300009274 | Eukaryotic communities of water from the North Atlantic ocean - ACM10 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009592 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009732 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300010981 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4) | Environmental | Open in IMG/M |
| 3300010987 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6) | Environmental | Open in IMG/M |
| 3300012415 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012417 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012419 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012470 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012516 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012962 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016746 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018575 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782379-ERR1712162) | Environmental | Open in IMG/M |
| 3300018601 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_3p0_dT | Environmental | Open in IMG/M |
| 3300018607 | Metatranscriptome of freshwater lake microbial communities from Lake Tornetrask, Sweden - GS667_3p0_dT | Environmental | Open in IMG/M |
| 3300018649 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161) | Environmental | Open in IMG/M |
| 3300018674 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006) | Environmental | Open in IMG/M |
| 3300018684 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160) | Environmental | Open in IMG/M |
| 3300018692 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153) | Environmental | Open in IMG/M |
| 3300018725 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230) | Environmental | Open in IMG/M |
| 3300018730 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028) | Environmental | Open in IMG/M |
| 3300018765 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010) | Environmental | Open in IMG/M |
| 3300018800 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172) | Environmental | Open in IMG/M |
| 3300018832 | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031) | Environmental | Open in IMG/M |
| 3300018838 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515) | Environmental | Open in IMG/M |
| 3300018842 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218) | Environmental | Open in IMG/M |
| 3300018846 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503) | Environmental | Open in IMG/M |
| 3300018874 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115) | Environmental | Open in IMG/M |
| 3300018885 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396) | Environmental | Open in IMG/M |
| 3300018899 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133) | Environmental | Open in IMG/M |
| 3300018974 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971) | Environmental | Open in IMG/M |
| 3300018976 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444) | Environmental | Open in IMG/M |
| 3300018980 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127) | Environmental | Open in IMG/M |
| 3300018982 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935) | Environmental | Open in IMG/M |
| 3300018989 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934) | Environmental | Open in IMG/M |
| 3300019001 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007) | Environmental | Open in IMG/M |
| 3300019010 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838) | Environmental | Open in IMG/M |
| 3300019027 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924) | Environmental | Open in IMG/M |
| 3300019031 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939) | Environmental | Open in IMG/M |
| 3300019032 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216) | Environmental | Open in IMG/M |
| 3300019033 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080) | Environmental | Open in IMG/M |
| 3300019036 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086) | Environmental | Open in IMG/M |
| 3300019039 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137) | Environmental | Open in IMG/M |
| 3300019045 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224) | Environmental | Open in IMG/M |
| 3300019048 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166) | Environmental | Open in IMG/M |
| 3300019050 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865) | Environmental | Open in IMG/M |
| 3300019051 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227) | Environmental | Open in IMG/M |
| 3300019095 | Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dT | Environmental | Open in IMG/M |
| 3300019108 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135) | Environmental | Open in IMG/M |
| 3300019117 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912) | Environmental | Open in IMG/M |
| 3300019131 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116) | Environmental | Open in IMG/M |
| 3300019149 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dT | Environmental | Open in IMG/M |
| 3300019150 | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908) | Environmental | Open in IMG/M |
| 3300019282 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021342 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021355 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021872 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021887 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021902 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021912 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021922 | Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021941 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021950 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300023695 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 21R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023698 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023704 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026182 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes) | Environmental | Open in IMG/M |
| 3300026447 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026465 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027194 | Estuarine microbial communities from the Columbia River estuary - metaG S.751 (SPAdes) | Environmental | Open in IMG/M |
| 3300027248 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028106 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028134 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028137 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028233 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028290 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028333 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028575 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030671 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030709 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031062 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031580 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
| 3300031710 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031717 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031725 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031729 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031734 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031738 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031739 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031752 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300032463 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032470 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032491 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032615 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032707 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032709 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032713 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032724 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032725 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032727 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032744 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032745 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032747 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032751 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300033572 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY83_102754062 | 3300001263 | Macroalgal Surface | LAEKLDIELTPELLSLGSNEEISNALIEIALGMGKTEADITSAMG* |
| JGI20158J14315_102088871 | 3300001355 | Pelagic Marine | MTPELMQLGNNEAISNALVEIAVGMGKSEDEITKALGPEE* |
| ACM3_10413762 | 3300001828 | Marine Plankton | MAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKSEAEISA |
| B570J40625_1009655752 | 3300002835 | Freshwater | MTPELMQLGSNEAISNALVEIAVGMGKTEEEIGAALGSD* |
| Ga0007787_104577781 | 3300004240 | Freshwater Lake | ATNLGTPTTPEPMQSGSNEAISNTLTEIAVDMVKPKEEI* |
| Ga0007742_109713642 | 3300004788 | Freshwater Lake | MAEKLGIPMTDDIMQLGTNEAISNALVEIAVGMGKTEEEIGSALGSD*RRKKY |
| Ga0007752_106359651 | 3300004789 | Freshwater Lake | MAEKLGIPMTDDNVTGTNEAISNALVEIAVGMGKTEEEIGAALGQD* |
| Ga0007751_112122532 | 3300004794 | Freshwater Lake | MAEKLGIPMTDDISLGTNEAISNALVEIAVGMGKTEEEIGAALGQD* |
| Ga0007759_114763732 | 3300004836 | Freshwater Lake | MAEKLGIPMTDDIMQLGTNEAISNALVEIAVGMGKTEEEIGSALGSD* |
| Ga0066831_101144282 | 3300005516 | Marine | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKTEEEISSALGAD* |
| Ga0075443_103387891 | 3300006165 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTEAEISASIA* |
| Ga0075517_13503821 | 3300006393 | Aqueous | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEAEIGAALG* |
| Ga0075488_10226831 | 3300006397 | Aqueous | MTPELMQLGTNEAISNALVEIAVGMGKSEGEIEKALD* |
| Ga0075495_10910981 | 3300006399 | Aqueous | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGSD* |
| Ga0075506_15015031 | 3300006401 | Aqueous | MTPELMQLGNNEAISNALVEIAVGMGKSEEEITAALGPE*RSSD* |
| Ga0075506_15540722 | 3300006401 | Aqueous | MTPELMQLGSNEAISNALVEIAVGMGKTEEEISAALGAE*KHKKVNKL* |
| Ga0075514_14963141 | 3300006403 | Aqueous | MTPELMQLGTNEAISNALVEIAVGMGKSEGEIEKALD |
| Ga0099654_100290863 | 3300006415 | Lake | MAEKLGIPMTDDISLGTNEAISNALVEIAVGMGKTEEEIGAALGQVDQKSFLVIY |
| Ga0099654_100290873 | 3300006415 | Lake | MAEKLGIPMTDDIMQLGTNEAISNALVEIAVGMGKSEDEIS* |
| Ga0075496_13942331 | 3300006419 | Aqueous | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGSD*ERE*CKS*SN |
| Ga0105019_12462781 | 3300007513 | Marine | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTEAEIGAALE* |
| Ga0105050_104377873 | 3300007516 | Freshwater | MTPELLSLGSNEAISNALIEIAMGMGKTEDDITAALGSE* |
| Ga0103732_10172782 | 3300008929 | Ice Edge, Mcmurdo Sound, Antarctica | MTPDLMQLGSNEAISNALVEIAVGMGKTEEEIGAALG* |
| Ga0103732_10308711 | 3300008929 | Ice Edge, Mcmurdo Sound, Antarctica | MTPELMQLGSNEAISNALVEIAVGMGKTEEEIGAALG* |
| Ga0104258_10488833 | 3300008993 | Ocean Water | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKSETEISNALGAE* |
| Ga0104258_10662012 | 3300008993 | Ocean Water | MTPELMQLGTNEAISNALVEIAVGMGKSETEISGALGTD* |
| Ga0103872_10371601 | 3300009263 | Surface Ocean Water | MAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKSEAEISAALGAE* |
| Ga0103878_10236012 | 3300009274 | Surface Ocean Water | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTEDEISAALG* |
| Ga0115005_111205731 | 3300009432 | Marine | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTESEIGAALAE* |
| Ga0115562_11533852 | 3300009434 | Pelagic Marine | MAQKLGIPFTDDLMQLGGYEEISSNLVEQAINAGKTEEEITAALA* |
| Ga0115562_11605183 | 3300009434 | Pelagic Marine | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGAE* |
| Ga0115008_101774284 | 3300009436 | Marine | MEKVNGMAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKDEAEINKALD* |
| Ga0115008_105201252 | 3300009436 | Marine | MAKALGIPMTPELMQLGSNEAISNALVEIAVGMGKSEAEIGAALA* |
| Ga0115008_114166662 | 3300009436 | Marine | MTPELMQLGTNEAISNALVEIAVGMGKSETEISSALTD* |
| Ga0115569_102894252 | 3300009497 | Pelagic Marine | MTPELMQLGSNEAISNALVEIAVGMGKTETEIGAALGSD* |
| Ga0115569_104887052 | 3300009497 | Pelagic Marine | EGMAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEAEISASLD* |
| Ga0115099_103001082 | 3300009543 | Marine | MTPDLMQLGTNEAISNALVEIAVGMGKSEEEIGAALG* |
| Ga0115101_10071953 | 3300009592 | Marine | MTPELMQLGNNEAISNALVEIAIGMGKSEAEIAQAVGA* |
| Ga0115103_17425611 | 3300009599 | Marine | MTPEIMQLGTNEAISNALVEIAVGMGKSEEEIGAALGSE* |
| Ga0115103_17509981 | 3300009599 | Marine | MTPELLGLGSNEAISNALVEIAVGMGKSEDEIAGALS* |
| Ga0115102_101395102 | 3300009606 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSETEISG |
| Ga0115102_103768652 | 3300009606 | Marine | MEKVSGMAQKLGIPMTQDLMNLGSNEAISNALVEIAVGMGKSEGEISRALG* |
| Ga0115102_109472041 | 3300009606 | Marine | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISAALGAE* |
| Ga0115100_103144252 | 3300009608 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSETE |
| Ga0115100_107394672 | 3300009608 | Marine | MTPELMQLGNNEAISNALVEIAVGMGKTEEEIGAALGAD* |
| Ga0115100_109244361 | 3300009608 | Marine | KVTAMAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKTETEISAALSD* |
| Ga0115100_112324451 | 3300009608 | Marine | MTPELMQLGNNEAISNALVEIAVGMGKSEDEITKALGP |
| Ga0115104_100040051 | 3300009677 | Marine | MTPELMQLGTNEAISNALVEIAVGMGKSETDISKALD* |
| Ga0115104_101584271 | 3300009677 | Marine | MTPELMQLGTNEAISNALVEIAVGMGKSEGEISSALTD* |
| Ga0115104_101799702 | 3300009677 | Marine | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTESEIGAALGAE* |
| Ga0115104_111010541 | 3300009677 | Marine | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSETEISAALGAE* |
| Ga0123373_1646342 | 3300009732 | Marine | MAQKLGIPMTPELMQLGNNESISSALVEIAVGMGKTEAEINKALGD* |
| Ga0115001_105467141 | 3300009785 | Marine | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKTESEISNALAE* |
| Ga0115012_114881192 | 3300009790 | Marine | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKTEQEIGAALGE* |
| Ga0129333_105639361 | 3300010354 | Freshwater To Marine Saline Gradient | MAQQLGIPMTPELMQLGSNEAISNALVEIAVGMGKSEDEIG* |
| Ga0137575_100485612 | 3300010970 | Pond Fresh Water | MAEKLGIPMTDDIMQLGTNEAISNALVEIAVGMGKTEEEIGAALG* |
| Ga0138316_116515082 | 3300010981 | Marine | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKSEAEISGALSD* |
| Ga0138324_105324031 | 3300010987 | Marine | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEGEIEKALD* |
| Ga0138263_12505712 | 3300012415 | Polar Marine | MTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGAE* |
| Ga0138262_11535831 | 3300012417 | Polar Marine | MAKALGIPMTPELMQLGSNEAISNALVEIAVGMGKSEEEIGAALG* |
| Ga0138260_110106891 | 3300012419 | Polar Marine | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEADISASIE* |
| Ga0129329_10775041 | 3300012470 | Aqueous | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGA |
| Ga0129325_11419111 | 3300012516 | Aqueous | MAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISAALGAE* |
| Ga0129344_12447012 | 3300012520 | Aqueous | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSESEISAALGDE* |
| Ga0129344_12680102 | 3300012520 | Aqueous | MTPELMQLGSNEAISNALVEIAVGMGKSEEEISAALGTD* |
| Ga0129331_13818802 | 3300012524 | Aqueous | MTPELMQLGNNEAISNALVEIAVGMGKSEDEISAALGAE* |
| Ga0157601_12543551 | 3300012714 | Freshwater | MAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEIAKSID* |
| Ga0160423_108222771 | 3300012920 | Surface Seawater | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSETEISAALGAD* |
| Ga0129335_11787361 | 3300012962 | Aqueous | MAEKLGIPMTDEIMQLGTNQAISNALVEIAVGMGKSEEEIGAALGSD* |
| Ga0129343_14474202 | 3300012967 | Aqueous | MTPELMQLGSNEAISNALVEIAVGMGKSEEEISAALGSD* |
| Ga0182055_10242151 | 3300016746 | Salt Marsh | MTPELMQLGSNEAISNALVEIAVGMGKTEEEISAALGSDXAKN |
| Ga0181380_12282962 | 3300017782 | Seawater | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTESEIGAALGAE |
| Ga0169931_104104442 | 3300017788 | Freshwater | MAEKLGIQITDDIMQLGSNEAISNALVEIVVGMGKFVYEISYSRLRLT |
| Ga0181583_106145182 | 3300017952 | Salt Marsh | MTPELMQLGSNEAISNALVEIAVGMGKSEEEISAALGSD |
| Ga0181590_110002852 | 3300017967 | Salt Marsh | MTPELMQLGSNEAISNARVEIAVGMGKSEEEISAALGTD |
| Ga0193474_10184061 | 3300018575 | Marine | MTPELMQLGNNEAISNALVEIAVGMGKSESEIGAALDXTXILSYX |
| Ga0188850_10162981 | 3300018601 | Freshwater Lake | MTPELMQLGSNEAISNALVEIAVGMGKTEEEISAALGAEXKHKKVNKL |
| Ga0188821_10230793 | 3300018607 | Freshwater Lake | MAEKLGIPMTDDIMQLGTNEAISNALVEIAVGMGKSEDEIS |
| Ga0192969_10253862 | 3300018649 | Marine | MAQKLGIPMTPDLMQLGNNEAISNALVEIAVGMGKTETEIGAALAE |
| Ga0192969_10563852 | 3300018649 | Marine | MTPDLMQLGSPEAISGALIEIAVSMGKSEEEIAASLS |
| Ga0193166_10316382 | 3300018674 | Marine | MAEKLGIPMTPELMQLGTNEAISNALVEIAVGMGKSEEEISAALG |
| Ga0192983_10169482 | 3300018684 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTEAEISASIA |
| Ga0192983_10530312 | 3300018684 | Marine | MTPDLMQLGSNEAISNALVEIAVGMGKTEEEIGAALG |
| Ga0192944_10341611 | 3300018692 | Marine | MAQKLGIPMTPDLMQLGNNEAISNALVEIAVGMGKSEEEIAGALGPE |
| Ga0192944_10403972 | 3300018692 | Marine | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTESEIGAALGTD |
| Ga0193517_10440361 | 3300018725 | Marine | MDKVTNMAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTEAEIGAALD |
| Ga0192967_10296591 | 3300018730 | Marine | MTPDLMQLGSNEAISNALVEIAVGMGKTEEEIGAALGXALKXR |
| Ga0192967_10514993 | 3300018730 | Marine | MTPELMQLGSNEAISNALVEIAVGMGKTETEIGAALG |
| Ga0193031_10533051 | 3300018765 | Marine | MAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEIGAALG |
| Ga0193306_10397122 | 3300018800 | Marine | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKTEQEISAALSD |
| Ga0194240_10233422 | 3300018832 | Marine | MTPELMQLGTNEAISNALVEIAVGMGKSEAEISGALTD |
| Ga0193302_10679191 | 3300018838 | Marine | MTPELMQLGTNEAISNALVEIAVGMGKTEGEISAALTD |
| Ga0193219_10493781 | 3300018842 | Marine | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISAALGAEXAKNQCM |
| Ga0193253_10558732 | 3300018846 | Marine | MTPDLMQLGTNEAISNALVEIAVGMGKSEEEIGAALG |
| Ga0193253_10900902 | 3300018846 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEEEIAASLGPEXA |
| Ga0193253_11200421 | 3300018846 | Marine | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGAEXAIKVCRP |
| Ga0192977_10796182 | 3300018874 | Marine | MAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGAE |
| Ga0193311_100435482 | 3300018885 | Marine | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKTEQEINAALTE |
| Ga0193090_11451321 | 3300018899 | Marine | MAKALGIPMTPELMQLGSNEAISNALVEIAVGMGKSEEEIGAALGXVIQNPSE |
| Ga0192873_101151371 | 3300018974 | Marine | MDKVNGMAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKSEGEIEKALD |
| Ga0192873_103400211 | 3300018974 | Marine | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEAEIGAALGTD |
| Ga0193254_101493481 | 3300018976 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEEEIAASLGPE |
| Ga0192961_101372542 | 3300018980 | Marine | MTPELMQLGSNEAISNALVEIAVGMGKTEEEISAALGAE |
| Ga0192947_101252963 | 3300018982 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSESEISGALGAE |
| Ga0193030_101168831 | 3300018989 | Marine | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEAEISASLD |
| Ga0193030_102407591 | 3300018989 | Marine | MSPDIMQLGDNEQISNALVEIAMSMGKSEDEIAAALEXAM |
| Ga0193034_101298052 | 3300019001 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTEEEIG |
| Ga0193044_102392141 | 3300019010 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEAEISASIA |
| Ga0192909_101119452 | 3300019027 | Marine | MTPELMQLGNNEAISNALVEIAVAMGKSEEEIGAALGPE |
| Ga0192909_102350181 | 3300019027 | Marine | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKTEDEIAAALG |
| Ga0193516_100405694 | 3300019031 | Marine | MTPELMQLGSNEAISNALVEIAVGMGKSEGEIEKALD |
| Ga0193516_100928781 | 3300019031 | Marine | MDKVNSMAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKSETEIERALD |
| Ga0193516_102519211 | 3300019031 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTESEIEAALA |
| Ga0193516_102537901 | 3300019031 | Marine | MDKVNGMAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKSETEIEHALD |
| Ga0192869_102568103 | 3300019032 | Marine | MAKKLGIPMTPELMQLGNNEAISNAPVEIAVGMGKTEAEIGAALSD |
| Ga0192869_102997781 | 3300019032 | Marine | MTPELMQLGNNEAISNALVEIAVGMGKSESEIGAALGAE |
| Ga0192869_103945851 | 3300019032 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEGEIAAALGPEXRE |
| Ga0193037_103709272 | 3300019033 | Marine | MEKINDMAKALGVDVTPDILQLGTNEAISNALMEIAVANGKTED |
| Ga0192945_101266522 | 3300019036 | Marine | MTPELMQLGSNEAISNALVEIAVGMGKTEEEISAALGAEXA |
| Ga0192945_101412633 | 3300019036 | Marine | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKTEQEIGSA |
| Ga0192945_102050601 | 3300019036 | Marine | MAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEADISAALGAEXEIXXGTKXPRX |
| Ga0193123_103872322 | 3300019039 | Marine | MTPELMQLGTNEAISNALVEIAVGMGKTETEISSALTD |
| Ga0193336_104345031 | 3300019045 | Marine | MTPELMQLGSNEAISNALVEIAVGMGKTEAEISASLD |
| Ga0192981_101358781 | 3300019048 | Marine | MTPELMQLGNNEAISNALVEIAVGMGKTEDEISKALGADEXRIMIXLTTFXNSF |
| Ga0192966_100800102 | 3300019050 | Marine | MAQKLGIPMTPDIMQLGNNEAISNALVEIAVGMGKTETEIGAALAE |
| Ga0192966_101270941 | 3300019050 | Marine | MTPELMQLGSNEAISNALVEIAVGMGKTEEEIGAALGXATKXR |
| Ga0192826_103238812 | 3300019051 | Marine | MTPELMQLGSNEAISNALVEIAVGMGKTETEISAALGSDXNKM |
| Ga0192826_103780881 | 3300019051 | Marine | MTPDIMQLGNNEAISNALVEIAIGMGKSEDEIAAALGPDQ |
| Ga0192826_103919902 | 3300019051 | Marine | MAQKLGIPMTPELMSLGSNEAISNALVEIAVGMGKTEEEITAALGPEXNK |
| Ga0188866_10094161 | 3300019095 | Freshwater Lake | MTPELMQLGTNEAISNALVEIAVGMGKSEEEISAALG |
| Ga0188866_10103421 | 3300019095 | Freshwater Lake | MTPELMQLGTNEAISNALVEIAVGMGKSETEISSALTD |
| Ga0188866_10221812 | 3300019095 | Freshwater Lake | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGSD |
| Ga0188866_10275031 | 3300019095 | Freshwater Lake | MTPELMQLGSNEAISNALVEIAVGMGKTETEIGAALGSDXTI |
| Ga0192972_10839961 | 3300019108 | Marine | MSAMAQQLGIPMTPDIMQLGTNEAISNALVEIAVGMGKSESEIGAALAE |
| Ga0193054_10394111 | 3300019117 | Marine | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEAEIGAALEG |
| Ga0193249_11353841 | 3300019131 | Marine | MAQNLGIPMTPEIMQLGTNEAISNALVEIAVGMGKSEQEISSALG |
| Ga0188870_101015811 | 3300019149 | Freshwater Lake | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTESEIGAALG |
| Ga0188870_101074861 | 3300019149 | Freshwater Lake | MTPELMQLGTNEAISNALVEIAVGMGKSEDEIAAALG |
| Ga0188870_101094401 | 3300019149 | Freshwater Lake | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTEAEIGAALG |
| Ga0194244_101213391 | 3300019150 | Marine | MAEKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEDEISAALG |
| Ga0194244_101258921 | 3300019150 | Marine | MAQKLGIPMTPDIMQLGNNEAISNALVEIAVGMGKSEEEIAAAL |
| Ga0182075_14961761 | 3300019282 | Salt Marsh | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKSEEEIGAALGADE |
| Ga0206126_101627822 | 3300020595 | Seawater | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKNEDEITKALGPDEXENIDIK |
| Ga0194133_106079201 | 3300021091 | Freshwater Lake | MAQKLGISMTDDIMQLGINLVIINALVEIAVGMRKRQN |
| Ga0194123_104745691 | 3300021093 | Freshwater Lake | MAEKLGIPMTDDIMQLGTNEAISNALVEIAVGMGKTE |
| Ga0206687_10929632 | 3300021169 | Seawater | MAQKLGIPMSPEIMQLGNNEAISNALVEIAVGMGKSEEEIAAALGPE |
| Ga0206687_17737152 | 3300021169 | Seawater | MAQKLGIPMTQDLMNLGSNEAISNALVEIAVGMGKTE |
| Ga0206691_11142502 | 3300021342 | Seawater | MDKVTQMAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEEEISHALD |
| Ga0206688_106475392 | 3300021345 | Seawater | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEEEIGAALGAE |
| Ga0206692_17772531 | 3300021350 | Seawater | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGAEXAIKVCKPG |
| Ga0206690_106619131 | 3300021355 | Seawater | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGMTEEEISSALGAD |
| Ga0206690_107405622 | 3300021355 | Seawater | MAQKLGIPMTQDLMNLGSNEAISNALVEIAVGMGKNEAEISRALG |
| Ga0194130_104402291 | 3300021376 | Freshwater Lake | MAEKLGIPMTDDIMQLGTNEAISNALVEIAVGMGKTEEEIGAALG |
| Ga0063132_1043602 | 3300021872 | Marine | MTPDLMQLGTNEAISNALVEIAVGMGKTEEEIGAALGAX |
| Ga0063132_1057102 | 3300021872 | Marine | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTEAEIGAALE |
| Ga0063132_1078462 | 3300021872 | Marine | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISAALGAE |
| Ga0063132_1186113 | 3300021872 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEDEITKALGTDE |
| Ga0063105_10257002 | 3300021887 | Marine | MTPELMQLGNNEAISNALVEIAVGMGKTESEIGVALGTDSAE |
| Ga0063086_10057312 | 3300021902 | Marine | MAKALGIPMTPELMQLGNNEAISNALVEIAVGMGKSEAEIGAALA |
| Ga0063133_10328681 | 3300021912 | Marine | MAQKLGIPMTPDLMQLGNNEAISNALVEIAVGMGKSEEEISAALGXNVWNTFKXINQK |
| Ga0063869_10238762 | 3300021922 | Marine | MAAKLGIPMTPELMQLGTNEAISNALVEIAVGMGKTEDEIAAALG |
| Ga0063102_11140832 | 3300021941 | Marine | MAKALGIPMTPELMQLGNNEAISNALVEIAVGMGKSEAEIGAALAXF |
| Ga0063101_10253271 | 3300021950 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKNEDEITKALGPDE |
| Ga0222717_103440801 | 3300021957 | Estuarine Water | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEAEIGAALG |
| Ga0222713_105262583 | 3300021962 | Estuarine Water | MSPELLSLGSNEAISNALVEIAIGMGKSEDEIAAALG |
| (restricted) Ga0233410_100478133 | 3300023276 | Seawater | MAQKLGIPMTQDLMNLGSNEAISNALVEIAVGMGKNE |
| Ga0228680_10307712 | 3300023695 | Seawater | MDKVTGMAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKSESEIEKALDXTN |
| Ga0228682_10153791 | 3300023698 | Seawater | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKTEAEISGALSD |
| Ga0228684_10738761 | 3300023704 | Seawater | MDKVTGMAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKSESEIEKALD |
| Ga0208148_10493841 | 3300025508 | Aqueous | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKSESEIGAALGADE |
| Ga0209405_11006072 | 3300025620 | Pelagic Marine | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGAE |
| Ga0209534_103525931 | 3300025880 | Pelagic Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEDEITKALGPDE |
| Ga0209631_102174391 | 3300025890 | Pelagic Marine | MTPELMQLGNNEAISNALVEIAVGMGKSEDEITKALGPEE |
| Ga0208275_10592682 | 3300026182 | Marine | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKTEEEISSALGAD |
| Ga0247607_10798172 | 3300026447 | Seawater | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTEEEIGAALN |
| Ga0247588_11179252 | 3300026465 | Seawater | MTPELMQLGNNEAISNALVEIAVGMGKTEEEIGAALN |
| Ga0208799_10616591 | 3300027194 | Estuarine | MTPELMQLGNNEAISNALVEIAVGMGKSEDEITKALGPDEXENIDIK |
| Ga0208176_10144803 | 3300027248 | Estuarine | MTPELMQLGSNEAISNALVEIAVGMGKSEAEISASLD |
| Ga0209502_104514611 | 3300027780 | Marine | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKSETEISNALGAE |
| Ga0209668_103626292 | 3300027899 | Freshwater Lake Sediment | MTPELMQLGSNEAISNALVEIAVGMGKTEEEIGAALGSD |
| Ga0209401_12348021 | 3300027971 | Freshwater Lake | MTPELMQLGSNEAISNALVEIAVGMGKSEEEIAKSID |
| Ga0247596_10730232 | 3300028106 | Seawater | MAQKLGIPMTPDLMQLGNNEAISNALVEIAVGMGKTEEEIGAALG |
| Ga0247596_11694351 | 3300028106 | Seawater | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEAEISASIA |
| Ga0256411_12019591 | 3300028134 | Seawater | MTPELMQLGNNEAISNALVEIAVGMGKSEEEIGAALGPEXTTFGIE |
| Ga0256412_13130411 | 3300028137 | Seawater | MAQNLGIPMTTELMQLGSNEAISNALVESAVGMGKTEAEISAALG |
| Ga0256417_11089652 | 3300028233 | Seawater | MTPELMQLGNNEAISNALVEIAVGMGKSEEEISAALGPEXTTFGIE |
| Ga0256413_12966841 | 3300028282 | Seawater | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSETEISAALGAE |
| Ga0256413_13520371 | 3300028282 | Seawater | MTPELMQLGNNEAISNALVEIAVGMGKSEEEIGAAI |
| Ga0247572_10915643 | 3300028290 | Seawater | MTPELMQLGNNEAISNALVEIAVGMGKSEEEIAASLGPEXA |
| Ga0247595_10943642 | 3300028333 | Seawater | MTPELMQLGNNEAISNALVEIAVGMGKTEEEIGAALNX |
| Ga0304731_107451532 | 3300028575 | Marine | MEKVTNMAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSESEIGAALD |
| Ga0307403_104789913 | 3300030671 | Marine | MAKALGIPMTPELMQLGSNTAISNALVEIAVGMGKTEEEIGAALG |
| Ga0307403_106122271 | 3300030671 | Marine | MAKALGIPMTPELMQLGSNTAISNALVEIAVGMGKTEEEISAALG |
| Ga0307400_102467893 | 3300030709 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEGEIEKSLD |
| Ga0307400_107782841 | 3300030709 | Marine | MAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGAEXAIKVCKP |
| Ga0073989_132290341 | 3300031062 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTEEEISAALGPEQ |
| Ga0073989_132590013 | 3300031062 | Marine | MTPELMQLGTNEAISNALVEIAVGMGKTEQEIGNALAE |
| Ga0308132_11020452 | 3300031580 | Marine | MAKKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEAEIGAALE |
| Ga0302125_100980881 | 3300031638 | Marine | MTPDLMQLGSNEAISNALVEIAVGMGKTEEEIGAALGXVIKXLSHMMHFRE |
| Ga0307386_105929182 | 3300031710 | Marine | LAQTLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEITAALGPE |
| Ga0307396_104260961 | 3300031717 | Marine | MTPELMQLGSNEAISNALVEIAVGMGKTEAEIGAALG |
| Ga0307396_105677962 | 3300031717 | Marine | MEKVTAMAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSESEIGAALDXTXFLKTFDNIY |
| Ga0307381_100402033 | 3300031725 | Marine | MTPELMQLGSNEAISNALVEIAVGMGKSESEIEQSLNDM |
| Ga0307381_101378281 | 3300031725 | Marine | MTPELMQLGTNEAISNALVEIAVGMGKSEGEISGALTE |
| Ga0307381_101630351 | 3300031725 | Marine | MAEKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSETEIEHALD |
| Ga0307391_107358861 | 3300031729 | Marine | MTPELMQLGNNEAISNALVEIAVGMGKTEDEISKALGADE |
| Ga0307391_108271043 | 3300031729 | Marine | MAKALGIPMTPELMQLGSNTAISNALVEIAVGMGKTEE |
| Ga0307397_101948892 | 3300031734 | Marine | MTPELMQLGNNEAISNALVEIAVGMGKTEDEISKALGADEXKIMIXLTTFXNSF |
| Ga0307397_103155101 | 3300031734 | Marine | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKTEAEIESALA |
| Ga0307397_104967751 | 3300031734 | Marine | LAKSLGIPMTPELMQLGSNEAISNALVEIAVGMGKTETEIG |
| Ga0307384_101707652 | 3300031738 | Marine | MTPELMQLGNNEAISNALVEIAVGMGKTEDEIAAALGTD |
| Ga0307383_101049742 | 3300031739 | Marine | MDKVNSMAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKSEGEID |
| Ga0307383_104587462 | 3300031739 | Marine | MTPELMQLGNNEAISNALVEIAVGMGKTEEEIGAALA |
| Ga0307404_104906251 | 3300031752 | Marine | MDKVSGMAQKLGIPMTPELMELGNNEAISNALVEIAVGMGKSEGEIEKSLD |
| Ga0315320_107624072 | 3300031851 | Seawater | MAQKLGIPMTPELMQLGNNEAISNALVEIAVGMGKSEEEIGA |
| Ga0315334_112549532 | 3300032360 | Seawater | MAQKLGIPMTPELMQLGSNEAISNALVEIAVGMGKSEEEITAALGPEXKKS |
| Ga0335396_104916811 | 3300032462 | Freshwater | MTPELLSLGSNEAISNALIEIAMGMGKTEDDITAALGSEXKNIXQL |
| Ga0335396_109082442 | 3300032462 | Freshwater | MTPELLSLGSNEAISNALIELALGMGKTEDDINSALGSQ |
| Ga0314684_105507981 | 3300032463 | Seawater | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGAEXAMKVCKPG |
| Ga0314670_104581632 | 3300032470 | Seawater | MTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGSDXESP |
| Ga0314675_105593892 | 3300032491 | Seawater | MAKQLGIPMTPDLMQLGSNEAISNALVEIAVGMGKTEEEIGAALG |
| Ga0314674_104635301 | 3300032615 | Seawater | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGRGKTEEEISGALGAE |
| Ga0314687_106617542 | 3300032707 | Seawater | MAQKLGIPMTPEIMSLGTNEAISSALVEIAVGMGKSETEISKALGE |
| Ga0314672_13121781 | 3300032709 | Seawater | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGAEXAIKVC |
| Ga0314690_103493292 | 3300032713 | Seawater | MAQKLGIPMTPELMQLGTNEAISNALVEIAVGMGKSETEISNALG |
| Ga0314690_105725591 | 3300032713 | Seawater | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGAEXAIK |
| Ga0314695_13751121 | 3300032724 | Seawater | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGAEXA |
| Ga0314702_11335271 | 3300032725 | Seawater | MTPELMQLGNNEAISNALVEIAVGMGKTEAEISASIA |
| Ga0314693_107165622 | 3300032727 | Seawater | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISG |
| Ga0314705_105844293 | 3300032744 | Seawater | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGRGKTEEEISGALGAEXAIKVCKPG |
| Ga0314704_107682952 | 3300032745 | Seawater | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEEISGALGAEXAIKVCK |
| Ga0314712_105645341 | 3300032747 | Seawater | MAKKLGIPMTPELMQLGSNEAISNALVEIAVGMGKTEEE |
| Ga0314694_103189903 | 3300032751 | Seawater | MTPELMQLGTNEAISNALVEIAVGMGKTEEEISGALGAE |
| Ga0307390_105491191 | 3300033572 | Marine | MTPELMQLGNNEAISNALVEIAVGMGKTEDEISKALGADEXRIMI |
| ⦗Top⦘ |