| Basic Information | |
|---|---|
| Family ID | F017713 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 239 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS |
| Number of Associated Samples | 198 |
| Number of Associated Scaffolds | 239 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 31.38 % |
| % of genes from short scaffolds (< 2000 bps) | 87.03 % |
| Associated GOLD sequencing projects | 189 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.611 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (16.318 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.218 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.791 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.67% β-sheet: 0.00% Coil/Unstructured: 65.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 239 Family Scaffolds |
|---|---|---|
| PF00474 | SSF | 53.56 |
| PF10633 | NPCBM_assoc | 10.04 |
| PF02585 | PIG-L | 0.84 |
| PF13432 | TPR_16 | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 239 Family Scaffolds |
|---|---|---|---|
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.61 % |
| Unclassified | root | N/A | 13.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01EB372 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 2170459011|GI3SL7401BGPO3 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 2170459020|G1P06HT02HZ03Z | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 2170459024|GZRSKLJ01ARY9L | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 2199352024|deeps__Contig_63798 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Pontibacter → Pontibacter actiniarum | 1455 | Open in IMG/M |
| 2199352025|deepsgr__Contig_30240 | All Organisms → cellular organisms → Bacteria | 2187 | Open in IMG/M |
| 2209111022|2221215276 | Not Available | 784 | Open in IMG/M |
| 3300000890|JGI11643J12802_10410822 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300000953|JGI11615J12901_11487426 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 664 | Open in IMG/M |
| 3300004016|Ga0058689_10159227 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300004114|Ga0062593_100370055 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1264 | Open in IMG/M |
| 3300004157|Ga0062590_101617748 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 656 | Open in IMG/M |
| 3300005166|Ga0066674_10214679 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 915 | Open in IMG/M |
| 3300005167|Ga0066672_11022226 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 504 | Open in IMG/M |
| 3300005171|Ga0066677_10028944 | All Organisms → cellular organisms → Bacteria | 2635 | Open in IMG/M |
| 3300005172|Ga0066683_10141697 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1473 | Open in IMG/M |
| 3300005175|Ga0066673_10037398 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 2376 | Open in IMG/M |
| 3300005175|Ga0066673_10270167 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 987 | Open in IMG/M |
| 3300005175|Ga0066673_10333498 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 885 | Open in IMG/M |
| 3300005175|Ga0066673_10727265 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 570 | Open in IMG/M |
| 3300005177|Ga0066690_10055807 | All Organisms → cellular organisms → Bacteria | 2424 | Open in IMG/M |
| 3300005179|Ga0066684_10086939 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
| 3300005179|Ga0066684_10801674 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 622 | Open in IMG/M |
| 3300005179|Ga0066684_11019242 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 533 | Open in IMG/M |
| 3300005184|Ga0066671_10055106 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
| 3300005184|Ga0066671_10433888 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 843 | Open in IMG/M |
| 3300005269|Ga0065706_1008091 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 996 | Open in IMG/M |
| 3300005289|Ga0065704_10057090 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300005289|Ga0065704_10578799 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005293|Ga0065715_10468225 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 809 | Open in IMG/M |
| 3300005328|Ga0070676_10206446 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1290 | Open in IMG/M |
| 3300005328|Ga0070676_10229628 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1229 | Open in IMG/M |
| 3300005333|Ga0070677_10233980 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 904 | Open in IMG/M |
| 3300005338|Ga0068868_102155191 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 531 | Open in IMG/M |
| 3300005339|Ga0070660_101637370 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 548 | Open in IMG/M |
| 3300005341|Ga0070691_10797142 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005356|Ga0070674_101039762 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 720 | Open in IMG/M |
| 3300005367|Ga0070667_101539959 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 625 | Open in IMG/M |
| 3300005434|Ga0070709_10121916 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1768 | Open in IMG/M |
| 3300005434|Ga0070709_10270865 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1230 | Open in IMG/M |
| 3300005434|Ga0070709_11071832 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 643 | Open in IMG/M |
| 3300005439|Ga0070711_100942485 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 738 | Open in IMG/M |
| 3300005439|Ga0070711_102010018 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 508 | Open in IMG/M |
| 3300005444|Ga0070694_101890860 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 509 | Open in IMG/M |
| 3300005446|Ga0066686_10371193 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 977 | Open in IMG/M |
| 3300005447|Ga0066689_10197588 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1219 | Open in IMG/M |
| 3300005447|Ga0066689_10335535 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 941 | Open in IMG/M |
| 3300005451|Ga0066681_10303725 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 976 | Open in IMG/M |
| 3300005451|Ga0066681_10341968 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 918 | Open in IMG/M |
| 3300005451|Ga0066681_10719803 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 606 | Open in IMG/M |
| 3300005454|Ga0066687_10091516 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300005454|Ga0066687_10483910 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 729 | Open in IMG/M |
| 3300005456|Ga0070678_101228379 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 696 | Open in IMG/M |
| 3300005456|Ga0070678_101464963 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 638 | Open in IMG/M |
| 3300005456|Ga0070678_102088008 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 537 | Open in IMG/M |
| 3300005540|Ga0066697_10721549 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 544 | Open in IMG/M |
| 3300005545|Ga0070695_100759301 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 774 | Open in IMG/M |
| 3300005546|Ga0070696_100718879 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 816 | Open in IMG/M |
| 3300005549|Ga0070704_100153407 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
| 3300005552|Ga0066701_10426180 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 822 | Open in IMG/M |
| 3300005554|Ga0066661_10333023 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 932 | Open in IMG/M |
| 3300005556|Ga0066707_10139032 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1530 | Open in IMG/M |
| 3300005566|Ga0066693_10266288 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 680 | Open in IMG/M |
| 3300005576|Ga0066708_10840651 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 574 | Open in IMG/M |
| 3300005614|Ga0068856_100362118 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1469 | Open in IMG/M |
| 3300005615|Ga0070702_101269276 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 597 | Open in IMG/M |
| 3300005764|Ga0066903_100327371 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2453 | Open in IMG/M |
| 3300005764|Ga0066903_104441095 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 749 | Open in IMG/M |
| 3300005764|Ga0066903_105718021 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 654 | Open in IMG/M |
| 3300005841|Ga0068863_100890408 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 890 | Open in IMG/M |
| 3300005842|Ga0068858_100952678 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 840 | Open in IMG/M |
| 3300006028|Ga0070717_12040703 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 516 | Open in IMG/M |
| 3300006034|Ga0066656_10400436 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 888 | Open in IMG/M |
| 3300006049|Ga0075417_10729095 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 510 | Open in IMG/M |
| 3300006172|Ga0075018_10229699 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 891 | Open in IMG/M |
| 3300006175|Ga0070712_100744171 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 838 | Open in IMG/M |
| 3300006237|Ga0097621_100874981 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300006755|Ga0079222_10884238 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 746 | Open in IMG/M |
| 3300006755|Ga0079222_11364809 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 653 | Open in IMG/M |
| 3300006796|Ga0066665_10257538 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1384 | Open in IMG/M |
| 3300006797|Ga0066659_10108196 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1906 | Open in IMG/M |
| 3300006800|Ga0066660_10353423 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1195 | Open in IMG/M |
| 3300006852|Ga0075433_11721841 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 540 | Open in IMG/M |
| 3300006903|Ga0075426_10607507 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 817 | Open in IMG/M |
| 3300006954|Ga0079219_11554379 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 603 | Open in IMG/M |
| 3300007255|Ga0099791_10292091 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 776 | Open in IMG/M |
| 3300007788|Ga0099795_10022625 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 2077 | Open in IMG/M |
| 3300009012|Ga0066710_102741353 | Not Available | 700 | Open in IMG/M |
| 3300009012|Ga0066710_103109985 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300009098|Ga0105245_11090072 | Not Available | 845 | Open in IMG/M |
| 3300009098|Ga0105245_12966985 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 526 | Open in IMG/M |
| 3300009137|Ga0066709_103894848 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 542 | Open in IMG/M |
| 3300009143|Ga0099792_10869961 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 595 | Open in IMG/M |
| 3300009177|Ga0105248_10816653 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300009545|Ga0105237_10849871 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 919 | Open in IMG/M |
| 3300009553|Ga0105249_10994408 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300010043|Ga0126380_10937646 | Not Available | 723 | Open in IMG/M |
| 3300010159|Ga0099796_10019554 | All Organisms → cellular organisms → Bacteria | 2055 | Open in IMG/M |
| 3300010320|Ga0134109_10163535 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300010322|Ga0134084_10245936 | Not Available | 644 | Open in IMG/M |
| 3300010335|Ga0134063_10520964 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010337|Ga0134062_10161629 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300010358|Ga0126370_10187060 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300010360|Ga0126372_10611103 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300010360|Ga0126372_11380612 | Not Available | 736 | Open in IMG/M |
| 3300010361|Ga0126378_10749183 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1088 | Open in IMG/M |
| 3300010364|Ga0134066_10084902 | Not Available | 890 | Open in IMG/M |
| 3300010373|Ga0134128_10666737 | Not Available | 1156 | Open in IMG/M |
| 3300010396|Ga0134126_11232470 | Not Available | 830 | Open in IMG/M |
| 3300010397|Ga0134124_10137615 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Fulvivirgaceae → Fulvivirga → Fulvivirga imtechensis | 2165 | Open in IMG/M |
| 3300010398|Ga0126383_11931611 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300011119|Ga0105246_11352587 | Not Available | 662 | Open in IMG/M |
| 3300012198|Ga0137364_11204900 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012199|Ga0137383_10312013 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300012200|Ga0137382_10546350 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300012201|Ga0137365_10323377 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300012208|Ga0137376_11140907 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300012285|Ga0137370_10574740 | Not Available | 695 | Open in IMG/M |
| 3300012351|Ga0137386_10585015 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012357|Ga0137384_10321864 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300012359|Ga0137385_10085980 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2792 | Open in IMG/M |
| 3300012361|Ga0137360_10045502 | All Organisms → cellular organisms → Bacteria | 3135 | Open in IMG/M |
| 3300012488|Ga0157343_1018207 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012493|Ga0157355_1019027 | Not Available | 621 | Open in IMG/M |
| 3300012683|Ga0137398_10130916 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300012895|Ga0157309_10333179 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012917|Ga0137395_10149556 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300012922|Ga0137394_10219087 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300012923|Ga0137359_10100662 | All Organisms → cellular organisms → Bacteria | 2552 | Open in IMG/M |
| 3300012924|Ga0137413_10191042 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300012925|Ga0137419_10480927 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300012929|Ga0137404_10042601 | All Organisms → cellular organisms → Bacteria | 3434 | Open in IMG/M |
| 3300012930|Ga0137407_11920335 | Not Available | 565 | Open in IMG/M |
| 3300012944|Ga0137410_10445424 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300012951|Ga0164300_10060060 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300012951|Ga0164300_10185282 | Not Available | 1007 | Open in IMG/M |
| 3300012955|Ga0164298_10601319 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300012955|Ga0164298_11196608 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012958|Ga0164299_10023258 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
| 3300012975|Ga0134110_10328799 | Not Available | 665 | Open in IMG/M |
| 3300012984|Ga0164309_10093899 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300012985|Ga0164308_10194040 | Not Available | 1542 | Open in IMG/M |
| 3300012986|Ga0164304_11336864 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300013102|Ga0157371_10564040 | Not Available | 845 | Open in IMG/M |
| 3300013306|Ga0163162_11176791 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300014157|Ga0134078_10264173 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300014325|Ga0163163_10692985 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300014968|Ga0157379_10352989 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300015357|Ga0134072_10036537 | Not Available | 1309 | Open in IMG/M |
| 3300015372|Ga0132256_100032286 | All Organisms → cellular organisms → Bacteria | 4748 | Open in IMG/M |
| 3300015372|Ga0132256_100078068 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3158 | Open in IMG/M |
| 3300015372|Ga0132256_100871751 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300015374|Ga0132255_100186129 | All Organisms → cellular organisms → Bacteria | 2928 | Open in IMG/M |
| 3300015374|Ga0132255_106284086 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300016357|Ga0182032_11111508 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300016422|Ga0182039_10282458 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300017657|Ga0134074_1009944 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3056 | Open in IMG/M |
| 3300017659|Ga0134083_10224421 | Not Available | 781 | Open in IMG/M |
| 3300017659|Ga0134083_10312696 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300017792|Ga0163161_11333989 | Not Available | 625 | Open in IMG/M |
| 3300017997|Ga0184610_1186830 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300018027|Ga0184605_10023409 | All Organisms → cellular organisms → Bacteria | 2499 | Open in IMG/M |
| 3300018431|Ga0066655_10636430 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300018431|Ga0066655_11224956 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300018431|Ga0066655_11270136 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300018433|Ga0066667_10657970 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300018433|Ga0066667_11611785 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300018468|Ga0066662_11069237 | Not Available | 804 | Open in IMG/M |
| 3300018468|Ga0066662_12765216 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300018482|Ga0066669_10087413 | All Organisms → cellular organisms → Bacteria | 2120 | Open in IMG/M |
| 3300018482|Ga0066669_11337370 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300018482|Ga0066669_11695021 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300018482|Ga0066669_12421381 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300019361|Ga0173482_10008172 | All Organisms → cellular organisms → Bacteria | 2588 | Open in IMG/M |
| 3300019362|Ga0173479_10016223 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300019872|Ga0193754_1000322 | All Organisms → cellular organisms → Bacteria | 3539 | Open in IMG/M |
| 3300019878|Ga0193715_1083907 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300019880|Ga0193712_1070899 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300019882|Ga0193713_1147129 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300019996|Ga0193693_1022920 | Not Available | 1146 | Open in IMG/M |
| 3300019997|Ga0193711_1019276 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300019998|Ga0193710_1016270 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300020008|Ga0193757_1005965 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300020010|Ga0193749_1102704 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300020199|Ga0179592_10162108 | Not Available | 1021 | Open in IMG/M |
| 3300020580|Ga0210403_10187563 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300020581|Ga0210399_10492074 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300021178|Ga0210408_10971274 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300021413|Ga0193750_1004081 | All Organisms → cellular organisms → Bacteria | 3871 | Open in IMG/M |
| 3300021413|Ga0193750_1007972 | All Organisms → cellular organisms → Bacteria | 2722 | Open in IMG/M |
| 3300021432|Ga0210384_11109313 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300021445|Ga0182009_10167324 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300021445|Ga0182009_10421907 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300022534|Ga0224452_1232511 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 565 | Open in IMG/M |
| 3300022694|Ga0222623_10378742 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300023058|Ga0193714_1059196 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300025893|Ga0207682_10101508 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300025907|Ga0207645_10005209 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 9479 | Open in IMG/M |
| 3300025923|Ga0207681_10490863 | Not Available | 1004 | Open in IMG/M |
| 3300025927|Ga0207687_11054015 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 698 | Open in IMG/M |
| 3300025930|Ga0207701_11297076 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300025931|Ga0207644_10425344 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300025933|Ga0207706_10021061 | All Organisms → cellular organisms → Bacteria | 5857 | Open in IMG/M |
| 3300025934|Ga0207686_10138033 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300025942|Ga0207689_11043459 | Not Available | 689 | Open in IMG/M |
| 3300025949|Ga0207667_11863903 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300025960|Ga0207651_10307895 | Not Available | 1320 | Open in IMG/M |
| 3300025960|Ga0207651_10513967 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1037 | Open in IMG/M |
| 3300026295|Ga0209234_1223934 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300026312|Ga0209153_1013710 | All Organisms → cellular organisms → Bacteria | 2589 | Open in IMG/M |
| 3300026312|Ga0209153_1049734 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300026316|Ga0209155_1142332 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 811 | Open in IMG/M |
| 3300026322|Ga0209687_1159700 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300026330|Ga0209473_1002187 | All Organisms → cellular organisms → Bacteria | 10782 | Open in IMG/M |
| 3300026332|Ga0209803_1321927 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300026527|Ga0209059_1042083 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2033 | Open in IMG/M |
| 3300026529|Ga0209806_1182883 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300026530|Ga0209807_1050618 | Not Available | 1919 | Open in IMG/M |
| 3300026536|Ga0209058_1006987 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 8547 | Open in IMG/M |
| 3300026550|Ga0209474_10256534 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1072 | Open in IMG/M |
| 3300026557|Ga0179587_10242747 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300026973|Ga0207479_101938 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300027478|Ga0207448_104140 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300028381|Ga0268264_10333687 | Not Available | 1438 | Open in IMG/M |
| 3300028711|Ga0307293_10104502 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300028717|Ga0307298_10121467 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300028778|Ga0307288_10181432 | Not Available | 805 | Open in IMG/M |
| 3300028796|Ga0307287_10036348 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300028885|Ga0307304_10232325 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300030844|Ga0075377_11644289 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300030979|Ga0068589_11099767 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300031469|Ga0170819_11617388 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300031720|Ga0307469_10425907 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300031820|Ga0307473_10420452 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300032174|Ga0307470_11458554 | Not Available | 567 | Open in IMG/M |
| 3300032174|Ga0307470_11561164 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300032180|Ga0307471_102912612 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300033412|Ga0310810_10901703 | Not Available | 776 | Open in IMG/M |
| 3300034817|Ga0373948_0083605 | Not Available | 732 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.13% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.51% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.26% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.26% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.26% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.84% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.84% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.42% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.42% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.42% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.42% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
| 2170459020 | Litter degradation NP2 | Engineered | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005269 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 Bulk Soil | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019872 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
| 3300020008 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026973 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-C (SPAdes) | Environmental | Open in IMG/M |
| 3300027478 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-E (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030979 | Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_11877610 | 2170459005 | Grass Soil | MKRRDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFY |
| F64_02237580 | 2170459011 | Grass Soil | SEPNGDSAPCLAARPKAYCVALGIFALEIVLLYAFTVIFS |
| 2NP_00017020 | 2170459020 | Switchgrass, Maize And Mischanthus Litter | QSCFAAQCGMKGKDLQSEPNGDSAPLFGSWPKAYCVALGIFGFEIVLLYAFTVIFS |
| FD1_02443410 | 2170459024 | Grass Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLLYA |
| deeps_00972010 | 2199352024 | Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVI |
| deepsgr_00121660 | 2199352025 | Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLLYAFTVVFS |
| 2222058492 | 2209111022 | Grass Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLLYAFTVIFS |
| JGI11643J12802_104108222 | 3300000890 | Soil | MKGTNLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| JGI11615J12901_114874262 | 3300000953 | Soil | MKKNILQSEPDGDSAPLFGSWPKAYCAALGIFAFEIVLFYAFTVIFS* |
| Ga0058689_101592272 | 3300004016 | Agave | MKGTNLQSEPSGDTAPLFGRWPTAYWVALAIFALEILFLYAFTVAFA* |
| Ga0062593_1003700552 | 3300004114 | Soil | MNPQSEPNGDTPPLFGSWPKAYCVALGIFAFEIVLFYVFTVIFS* |
| Ga0062590_1016177481 | 3300004157 | Soil | MNPQSEPNGDTPPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0066674_102146792 | 3300005166 | Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0066672_110222262 | 3300005167 | Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0066677_100289442 | 3300005171 | Soil | MKGTNPQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTAIFS* |
| Ga0066683_101416972 | 3300005172 | Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0066673_100373982 | 3300005175 | Soil | MKGTDLQSEANGDSAPLFGSWAKAYCVALGIFAFEIVLFYAFTVLFS* |
| Ga0066673_102701672 | 3300005175 | Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTLVFS* |
| Ga0066673_103334982 | 3300005175 | Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEVVLFYAFTVVFS* |
| Ga0066673_107272652 | 3300005175 | Soil | MKGTDLPSEPDGDSAPLFGSWTKAYCVALGIFGFEIVLFYAFTVIFS* |
| Ga0066690_100558072 | 3300005177 | Soil | MKGRDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0066684_100869391 | 3300005179 | Soil | MKGTELQSEPNGNSAPLFGSWPKAYCVALGIFAFEIVLFYAFTAIFS* |
| Ga0066684_108016742 | 3300005179 | Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCIALGIFAFEIVLFYAFTVVFS* |
| Ga0066684_110192422 | 3300005179 | Soil | MKGTDLQSEPDGDSPPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0066671_100551062 | 3300005184 | Soil | MKGPNRQSEPNGDSAPFFGSWPKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0066671_104338882 | 3300005184 | Soil | MKRINLESEPNGDPAPFFGRWPKAYCIALAIFAFEILLLYAFTVLFA* |
| Ga0065706_10080912 | 3300005269 | Switchgrass Rhizosphere | MKGSDLQNESNGDSPPLFGSWPKAYCVALGIFGFEIVLLYAFTVIFS* |
| Ga0065704_100570901 | 3300005289 | Switchgrass Rhizosphere | MKGSDLQNESNGDSPPLFGSWPKAYCVALGIFGFEIVLLYAFTVVFS* |
| Ga0065704_105787992 | 3300005289 | Switchgrass Rhizosphere | MKGRDLQSEPNGDSAPLFGSWPKAYCVALGIFGFEIVLLYAFTVIFS* |
| Ga0065715_104682251 | 3300005293 | Miscanthus Rhizosphere | MKGTDLQSEPNGESAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0070676_102064462 | 3300005328 | Miscanthus Rhizosphere | MKGRDLQSEPNGDSAPLFGSWRKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0070676_102296282 | 3300005328 | Miscanthus Rhizosphere | MKGTNLQSGPNGDTPPLFGSWRKAYCVTLGIFAFEVVLFYAFTVVFS* |
| Ga0070677_102339801 | 3300005333 | Miscanthus Rhizosphere | MKGRDLQSEPNGDSPPLFGSWPKAYCVALGIFGFEIVLLYAFTVIFS* |
| Ga0068868_1021551912 | 3300005338 | Miscanthus Rhizosphere | MKGTDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0070660_1016373702 | 3300005339 | Corn Rhizosphere | MNLQSEPNGDTPPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0070691_107971422 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGTDLQNEPNGDSAPLFCSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0070674_1010397622 | 3300005356 | Miscanthus Rhizosphere | MKGRDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLLYAFTVVFS* |
| Ga0070667_1015399592 | 3300005367 | Switchgrass Rhizosphere | MNLQSEPNGDTPPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0070709_101219162 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGTDLQSEPDGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0070709_102708652 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGRDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0070709_110718322 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGTDLQSEANGDSAPLFGSWPKAYCVSLGIFAFEIVLLYAFTVIFS* |
| Ga0070711_1009424852 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLLYAFTVVFS* |
| Ga0070711_1020100182 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | DLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0070694_1018908601 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | CFAARRGMKGSDLQNESNGDSPPLFGSWPKAYCVALGIFGFEIVLLYAFTVVFS* |
| Ga0066686_103711932 | 3300005446 | Soil | MKGTDRQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0066689_101975881 | 3300005447 | Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVTLGIFVFEIVLFYAFTVVFS* |
| Ga0066689_103355351 | 3300005447 | Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFVFEIVLFYAFTVVFS* |
| Ga0066681_103037251 | 3300005451 | Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYA |
| Ga0066681_103419682 | 3300005451 | Soil | MKGTDLPSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTLVFS* |
| Ga0066681_107198032 | 3300005451 | Soil | MKGKDLQSEPNGDSPPLFGSWPKAYCVALGIFGVEIVLFYAFTVVFS* |
| Ga0066687_100915162 | 3300005454 | Soil | MKGTDLQSEANGDSAPLFGSWAKDYCVALGIFAFEIVLFYAFTVLFS* |
| Ga0066687_104839102 | 3300005454 | Soil | MKGPNRQSEPNGDSVPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0070678_1012283792 | 3300005456 | Miscanthus Rhizosphere | MKGTNLQSEPNGDTPPLFGSWRKAYCVTLGIFAFEVVLFYAFTVVFS* |
| Ga0070678_1014649631 | 3300005456 | Miscanthus Rhizosphere | MKGRDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTV |
| Ga0070678_1020880081 | 3300005456 | Miscanthus Rhizosphere | MNLQSEPNGDTPPLFGSWPKAYCVTLGIFAFEIVLFYAFTVIFS* |
| Ga0066697_107215492 | 3300005540 | Soil | MKGTDLQSEPDGDSAPLFGSWTKAYCVALGIFGFEIVLFYAFTVVFS* |
| Ga0070695_1007593012 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGTDLQSEANGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0070696_1007188791 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | SEANGDSAPLFGSWPKAYCVSLGIFAFEIVLLYAFTVIFS* |
| Ga0070704_1001534071 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | KGRDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0066701_104261801 | 3300005552 | Soil | SCFAAQRGMKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0066661_103330232 | 3300005554 | Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0066707_101390321 | 3300005556 | Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVF |
| Ga0066693_102662881 | 3300005566 | Soil | DLPSEPDGDSAPLFGSWPKAYCVALGIFAVEIVLFYVFTVVFS* |
| Ga0066708_108406512 | 3300005576 | Soil | MKGRDLQSEPNGDSPPLFGSWAKAYCVALGIFAFEIVLFYVFTVVFS* |
| Ga0068856_1003621182 | 3300005614 | Corn Rhizosphere | MKGTDLQSESDGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0070702_1012692761 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LQSEPNGDSPPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0066903_1003273712 | 3300005764 | Tropical Forest Soil | MKETNLQSEANGDTAPLFGSWRKAYCVALAIFAFEIVLLYAFTVIFS* |
| Ga0066903_1044410952 | 3300005764 | Tropical Forest Soil | MKETNLQSEANSDTAPLFGSWSKAYCVTLGIFALEILLLYVFTVAFA* |
| Ga0066903_1057180212 | 3300005764 | Tropical Forest Soil | MKRTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFY |
| Ga0068863_1008904081 | 3300005841 | Switchgrass Rhizosphere | MKGTDLQSEPNGESAPLFGSWPKAYCVTLGIFAFEIVLLYAFTVVFS* |
| Ga0068858_1009526782 | 3300005842 | Switchgrass Rhizosphere | MKGTDLQSEPNGESAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVIFS* |
| Ga0070717_120407032 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGTDLQSEPNGESAPLFGSWPKAYCVTLGIFAFEIVLFYVFTVVFS* |
| Ga0066656_104004362 | 3300006034 | Soil | GDSAPLFGSWPKAYCVALGIFAFEIALFYAFTVVFS* |
| Ga0075417_107290951 | 3300006049 | Populus Rhizosphere | AQCGMKGRDLQSEPNGDSAPLFGSWPKAYCVALGIFGFEIVLLYAFTVVFS* |
| Ga0075018_102296992 | 3300006172 | Watersheds | TDLQSEPNGDSAPLFGSWPKAYCVALGIFVFEIALLYAFTVVFS* |
| Ga0070712_1007441711 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGTDLQSESDGDSAPLFGSWPKAYCVTLGIFAFEIVLFYVFTVVFS* |
| Ga0097621_1008749812 | 3300006237 | Miscanthus Rhizosphere | MKGRDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEI |
| Ga0079222_108842382 | 3300006755 | Agricultural Soil | SVPLFGSWLKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0079222_113648092 | 3300006755 | Agricultural Soil | MKGTNPQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0066665_102575382 | 3300006796 | Soil | MKGTDLQSEPDRDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0066659_101081962 | 3300006797 | Soil | MKETDLQSKPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0066660_103534232 | 3300006800 | Soil | MKGTDLPSEPDGDSAPLFGSWPKAYCVALGIFAFEIALFYAFTVVFS* |
| Ga0075433_117218412 | 3300006852 | Populus Rhizosphere | MKGTHPQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0075426_106075072 | 3300006903 | Populus Rhizosphere | MKETNLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0079219_115543791 | 3300006954 | Agricultural Soil | MKGSNPQTEPNGDSAPLFGSWLKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0099791_102920912 | 3300007255 | Vadose Zone Soil | MKGTDLQSEPNGESAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0099795_100226252 | 3300007788 | Vadose Zone Soil | MKGRDLQSEPNADSAPLFGSWPKAYCVALGIFAFEIVLLYAFTVVFS* |
| Ga0066710_1027413532 | 3300009012 | Grasslands Soil | GMKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYTFTVVFS |
| Ga0066710_1031099852 | 3300009012 | Grasslands Soil | MKETDLQSEPDGDSAPLFGSWPKAYSVALGIFAFEIVLFYAFTVIFS |
| Ga0105245_110900721 | 3300009098 | Miscanthus Rhizosphere | QCGMKGTDLQSEANGDSAPLFGSWPKAYCVALGIFGFEIVLLYAFTVIFS* |
| Ga0105245_129669852 | 3300009098 | Miscanthus Rhizosphere | MKGTDLQNEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0066709_1038948482 | 3300009137 | Grasslands Soil | MKETDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVLFS* |
| Ga0099792_108699612 | 3300009143 | Vadose Zone Soil | MKGTDLQSEPNDESAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0105248_108166531 | 3300009177 | Switchgrass Rhizosphere | MKGTNLQSEPNGDTPPLFGSWRKAYCVTLGIFAFE |
| Ga0105237_108498712 | 3300009545 | Corn Rhizosphere | MKGTDLQSEANGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVAFS* |
| Ga0105249_109944083 | 3300009553 | Switchgrass Rhizosphere | LQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVIFS* |
| Ga0126380_109376461 | 3300010043 | Tropical Forest Soil | SEANGDTAPLFGSWRKAYCVALGIFVFEIVLLYAFTVIFS* |
| Ga0099796_100195542 | 3300010159 | Vadose Zone Soil | MKGTDLQSEPNGDSPPLFGSWPKAYCVALGIFAFEIVLLYAFTVVFS* |
| Ga0134109_101635352 | 3300010320 | Grasslands Soil | MKGTDLQSEANGDSAPLFGSWAKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0134084_102459362 | 3300010322 | Grasslands Soil | VCQSCFAAQRGMKETDLQSEPDGDSPPLFGSWPKAYCVALGIFAVEIVLFYVFTVVFS* |
| Ga0134063_105209641 | 3300010335 | Grasslands Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIV |
| Ga0134062_101616292 | 3300010337 | Grasslands Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIALFYAFTVVFS* |
| Ga0126370_101870601 | 3300010358 | Tropical Forest Soil | MKETFLQSEANGDTAPLFGSWRKAYCVALAIFAFEIVLLYA |
| Ga0126372_106111031 | 3300010360 | Tropical Forest Soil | MKETNLQSEANSDTAPLFGSWSKAYCVTLGIFALEILLLYLFTVAF |
| Ga0126372_113806122 | 3300010360 | Tropical Forest Soil | FCQSCFAAQRGMKETFLQSEANGDTAPLFGSWRKAYCVALAIFAFEIVLLYAFTVIFS* |
| Ga0126378_107491832 | 3300010361 | Tropical Forest Soil | MKRTDLQSESNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVMFS* |
| Ga0134066_100849022 | 3300010364 | Grasslands Soil | MKGKDLQSEPNGDSPPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0134128_106667372 | 3300010373 | Terrestrial Soil | CQSCFAAQCGMKGTDLQSEANGDSAPLFGSWPKAYCVSLGIFAFEIVLLYAFTVIFS* |
| Ga0134126_112324702 | 3300010396 | Terrestrial Soil | QSEPNGESAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVIFS* |
| Ga0134124_101376152 | 3300010397 | Terrestrial Soil | MKGTDLQSEPNGDTPPLFGSWPKAYCVTLGIFAFEIVLFYAFTVIFS* |
| Ga0126383_119316112 | 3300010398 | Tropical Forest Soil | MKRTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVMFS* |
| Ga0105246_113525872 | 3300011119 | Miscanthus Rhizosphere | CFAAQCGMKGTDLQSEPDGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0137364_112049002 | 3300012198 | Vadose Zone Soil | MKGTDLQSEPNGDSAPLFGSWAKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0137383_103120132 | 3300012199 | Vadose Zone Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFGFEIVLFYAFTVVFS* |
| Ga0137382_105463502 | 3300012200 | Vadose Zone Soil | MKGTYRQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0137365_103233772 | 3300012201 | Vadose Zone Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFALEIVLFYAFTVIFS* |
| Ga0137376_111409072 | 3300012208 | Vadose Zone Soil | MKGRDLQSEPNGESAPLFGSWRTAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0137370_105747402 | 3300012285 | Vadose Zone Soil | MKGRDLQSEPNGDSPPLFGSWAKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0137386_105850152 | 3300012351 | Vadose Zone Soil | MKGTDLQREPNGDAAPLFGSWPKAYCIALGIFAFEIVLFYA |
| Ga0137384_103218642 | 3300012357 | Vadose Zone Soil | MKGTDLPSEPDGDSAPLFGSWTNAYCVALGIFGFEIVLFYAFTVIFS* |
| Ga0137385_100859804 | 3300012359 | Vadose Zone Soil | FAAQCGMKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0137360_100455022 | 3300012361 | Vadose Zone Soil | MKGRDLQSEPNGDSAPLFGSWPKAYCVTLGIFALEIVLFYAFTVVFS* |
| Ga0157343_10182072 | 3300012488 | Arabidopsis Rhizosphere | MKGTDLQSESDGDSAPLFGSWPKAYCVALGIFGFEIVLLYAFTVVFS* |
| Ga0157355_10190272 | 3300012493 | Unplanted Soil | AQRGMKGTNLQSEPNGDTPPLFGSWRKAYCVTLGIFAFEIVLFYAFTVIFS* |
| Ga0137398_101309162 | 3300012683 | Vadose Zone Soil | MKGTDLQSEPNGDSPPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0157309_103331792 | 3300012895 | Soil | MKGRDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFY |
| Ga0137395_101495562 | 3300012917 | Vadose Zone Soil | MKGRDLQSEPNADSAPLFGSWPKAYRVALGIFAFEIVLLYAFTVVFS* |
| Ga0137394_102190872 | 3300012922 | Vadose Zone Soil | MKGRDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLLYAFTVVFS* |
| Ga0137359_101006622 | 3300012923 | Vadose Zone Soil | MKGTDLQSEPNGESAPLFGSWRTAYCVALGIFASEIVLFYAFTVVFS* |
| Ga0137413_101910422 | 3300012924 | Vadose Zone Soil | MKGRDLQSEPNDDSAPLFGSWPKAYCVALGIFAFEIVLLYAFTVVFS* |
| Ga0137419_104809271 | 3300012925 | Vadose Zone Soil | MKGRDLQSDPNGDSAPLFGSWPKAYCVALGIFAFEI |
| Ga0137404_100426012 | 3300012929 | Vadose Zone Soil | MKGRDLQSEPNGESAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0137407_119203351 | 3300012930 | Vadose Zone Soil | CFAAQRGMKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0137410_104454242 | 3300012944 | Vadose Zone Soil | MKGTDLQSEPNGESAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVYS* |
| Ga0164300_100600602 | 3300012951 | Soil | MKGTDLQSESDGDSAPLFGSWPKAYCVTLGIFVFEIVLLYAFTVVFS* |
| Ga0164300_101852821 | 3300012951 | Soil | MEGTDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0164298_106013192 | 3300012955 | Soil | MKGTDLQSEANGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVIFS* |
| Ga0164298_111966082 | 3300012955 | Soil | MKETDLQSESDGDSAPLFGSWPKAYCVTLGIFAFEIVLFYVFTVVFS* |
| Ga0164299_100232582 | 3300012958 | Soil | MKGTDLQSESDGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVIFS* |
| Ga0134110_103287991 | 3300012975 | Grasslands Soil | GDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS* |
| Ga0164309_100938992 | 3300012984 | Soil | MKGTDLQSEANGDSAPLFGSWPKAYCVTLGIFAFEIVLLYAFTVVFS* |
| Ga0164308_101940402 | 3300012985 | Soil | MKGSDLQSDPNGDSAPLFGSWPKAYCVALGIFGFEIVLLYAFTVIFS* |
| Ga0164304_113368642 | 3300012986 | Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYVFTVVFS* |
| Ga0157371_105640402 | 3300013102 | Corn Rhizosphere | QSEPNGDSPPLFGSWPKAYCVALGIFAFEIVLLYAFTVVFS* |
| Ga0163162_111767912 | 3300013306 | Switchgrass Rhizosphere | MKGSDLQNESNGDSPPLFGSWPKAYCVALGIFGFEIVLLYAFRVIFS* |
| Ga0134078_102641732 | 3300014157 | Grasslands Soil | MKGTDLPSEPDGDSAPLFGSWPKAYCVALGIFAVEIVLFYAFTVVFS* |
| Ga0163163_106929851 | 3300014325 | Switchgrass Rhizosphere | MKGTDLQSKPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0157379_103529891 | 3300014968 | Switchgrass Rhizosphere | MKGTDLQSEPNADSAPLFGSWPKAYCVALGIFAFEIV |
| Ga0134072_100365371 | 3300015357 | Grasslands Soil | SEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS* |
| Ga0132256_1000322864 | 3300015372 | Arabidopsis Rhizosphere | MKGTDLQGEPNGESAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS* |
| Ga0132256_1000780684 | 3300015372 | Arabidopsis Rhizosphere | QSCFAAQRAMKGTNLQSEPNGDTPPLFGSWPKAYWVTLGIFAFEIVLFYAFTVIFS* |
| Ga0132256_1008717512 | 3300015372 | Arabidopsis Rhizosphere | MKGTDLQSEPNGDSPPLFGSWPKAYCVALGIFVFEIALLYAFTVVFS* |
| Ga0132255_1001861292 | 3300015374 | Arabidopsis Rhizosphere | MNLQSELNGESPPLFGSWPKAYWVALGIFAFEIVLFYAFTVIFS* |
| Ga0132255_1062840862 | 3300015374 | Arabidopsis Rhizosphere | MKGSDLQSEPNGDSAPLFGSWPKAYCVALGIFGFEIVLLYAFTVVFS* |
| Ga0182032_111115081 | 3300016357 | Soil | MKGTNLQNQPNGDTAPLFGRWSTAYYVTLGIFAFEILLLYVFTVVFA |
| Ga0182039_102824581 | 3300016422 | Soil | MKGTNLQNQPNGDTAPLFGRWSTAYYVTLGIFAFEILLLYVFTVVFAWTSWIMSS |
| Ga0134074_10099442 | 3300017657 | Grasslands Soil | MKGSDLQSEPTGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0134083_102244211 | 3300017659 | Grasslands Soil | QSEPNGDSAPLFGSWPKAYCAALGIFALEIVLFYAFTVIFS |
| Ga0134083_103126962 | 3300017659 | Grasslands Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFY |
| Ga0163161_113339891 | 3300017792 | Switchgrass Rhizosphere | DGDSAPLFGSWPKAYCVALGIFGFEIVLLYAFTVIFS |
| Ga0184610_11868302 | 3300017997 | Groundwater Sediment | MKGTYRQSEPNGDSAPLFGSWPKAYCVALGIFGFEIVLLYAFTVIFS |
| Ga0184605_100234092 | 3300018027 | Groundwater Sediment | MKGRDFQSEPNGDSPPLFGSWPKAYCVALGIFAFEIVLLYAFTVVFS |
| Ga0066655_106364302 | 3300018431 | Grasslands Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS |
| Ga0066655_112249562 | 3300018431 | Grasslands Soil | SCFAALCGMKGRDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS |
| Ga0066655_112701362 | 3300018431 | Grasslands Soil | MKGKDLQSEPNGDSPPFFGSWPKAYCFAPGIFGVETVLFYAFTVI |
| Ga0066667_106579702 | 3300018433 | Grasslands Soil | MKGTDLQSEANGDSARLFGSWAKAYCVALGIFAFEIVLFYAFTVLFS |
| Ga0066667_116117851 | 3300018433 | Grasslands Soil | MKGRDLQSEPNGDSPPLFGSWAKAYCVALGIFAFEIVLFYVFTVVFS |
| Ga0066662_110692371 | 3300018468 | Grasslands Soil | GDSAPLFGSWPKAYCVALGIFAYEIVLFYAFTVVFS |
| Ga0066662_127652161 | 3300018468 | Grasslands Soil | MKGPNRQSEPNGDSVPLFGSWPKAYCVALGIFAFEIVLFY |
| Ga0066669_100874132 | 3300018482 | Grasslands Soil | MKGTDLQSEANGDSAPLFGSWAKAYCVALGIFAFEIVLFYAFTVLFS |
| Ga0066669_113373702 | 3300018482 | Grasslands Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS |
| Ga0066669_116950212 | 3300018482 | Grasslands Soil | MKGTDLPSEPDGDSAPLFGSWTKAYCVALGIFGFEIVLFYAFTVIFS |
| Ga0066669_124213812 | 3300018482 | Grasslands Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTLVFS |
| Ga0173482_100081722 | 3300019361 | Soil | MKGRDLQSEPNGDPAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0173479_100162232 | 3300019362 | Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVIFS |
| Ga0193754_10003222 | 3300019872 | Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS |
| Ga0193715_10839072 | 3300019878 | Soil | MKGTDFQNEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS |
| Ga0193712_10708991 | 3300019880 | Soil | MKGTDLQSESNSDFAPLFGSWPKAYCVALGIFEFEIV |
| Ga0193713_11471292 | 3300019882 | Soil | MKGRDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS |
| Ga0193693_10229202 | 3300019996 | Soil | SCFAAQCGMKGRDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLLYAFTVVFS |
| Ga0193711_10192762 | 3300019997 | Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0193710_10162702 | 3300019998 | Soil | MKRRDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0193757_10059652 | 3300020008 | Soil | MKGTDLQSESNSDFAPLFGSWPKAYCVALGIFGFEIVLLYAFTVVFS |
| Ga0193749_11027042 | 3300020010 | Soil | MKGTDLQSEPNGESAPLFGSWPKAYCVALGIFAFEIVLFYVFTIVFS |
| Ga0179592_101621081 | 3300020199 | Vadose Zone Soil | MKGRDLQSEPNADSAPLFGSWPKAYCVALGIFAFEIVLLYAFTVVFS |
| Ga0210403_101875632 | 3300020580 | Soil | MKGTDLQSEPNGDSPPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0210399_104920742 | 3300020581 | Soil | MKGTDLQSEPNGDSPPLFGSWPKAYCVTLGIFAFEIVLLYAFTVVFS |
| Ga0210408_109712742 | 3300021178 | Soil | MKGTDLQSEPSADSPPLFGSWPKAYCVALGIFVFEIALLYAFTVVFS |
| Ga0193750_10040813 | 3300021413 | Soil | MKGTDLQSEPNGESAPLFGSWPKAYCVTLGVFALEIVLFYAFTVVFS |
| Ga0193750_10079722 | 3300021413 | Soil | MKGTDLQSESNGESPPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS |
| Ga0210384_111093131 | 3300021432 | Soil | MKGTDLQSEPNGESAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0182009_101673242 | 3300021445 | Soil | MKGTNLRSEGDGDTAPWFGRWSVAYCVVLGIFAFEILLLYVFTVAFA |
| Ga0182009_104219072 | 3300021445 | Soil | MKKTNLQSEADRDFAPLFGRWSMAYLVALGIFGLEILLLYAFTVVFA |
| Ga0224452_12325112 | 3300022534 | Groundwater Sediment | MKGRDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLLYAFTVVFS |
| Ga0222623_103787421 | 3300022694 | Groundwater Sediment | GMKGTDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0193714_10591962 | 3300023058 | Soil | AAQCGMKGTDLQSEPNGESAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0207682_101015082 | 3300025893 | Miscanthus Rhizosphere | GESAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0207645_100052095 | 3300025907 | Miscanthus Rhizosphere | MKGRDLQSEPNGDSAPLFGSWRKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0207681_104908632 | 3300025923 | Switchgrass Rhizosphere | GMKGSDLQNESNGDSPPLFGSWPKAYCVALGIFGFEIVLLYAFTVIFS |
| Ga0207687_110540152 | 3300025927 | Miscanthus Rhizosphere | MKGTDLQSEANGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0207701_112970762 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGRDLQSEPNGDSAPLFGSWPKAYCVALGIFGFEIVLLYAFTVIFS |
| Ga0207644_104253441 | 3300025931 | Switchgrass Rhizosphere | MKGRDLQSEPNGDSAPLFGSWRKAYCVTLGIFAFEIVLFY |
| Ga0207706_100210614 | 3300025933 | Corn Rhizosphere | MKGTDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0207686_101380332 | 3300025934 | Miscanthus Rhizosphere | MKGRDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0207689_110434591 | 3300025942 | Miscanthus Rhizosphere | PDGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0207667_118639032 | 3300025949 | Corn Rhizosphere | MKGTDLQSEANGDSAPLFGSWPKAYCVTLGIFAFEIVLLYAFTVIFS |
| Ga0207651_103078951 | 3300025960 | Switchgrass Rhizosphere | RDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0207651_105139672 | 3300025960 | Switchgrass Rhizosphere | MKGTNLQSEPNGDTPPLFGSWRKAYCVTLGIFAFEVVLFYAFTVVFS |
| Ga0209234_12239342 | 3300026295 | Grasslands Soil | MKGSDLQSEPNGDSPPLFGSWPKAYCVALGIFALEIVLFYAFTVVFS |
| Ga0209153_10137102 | 3300026312 | Soil | MKGTNPQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTAIFS |
| Ga0209153_10497342 | 3300026312 | Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVIFS |
| Ga0209155_11423322 | 3300026316 | Soil | MKGTDLQSEPDGDSAPLFGSWTKAYCVALGIFGFEIVLFYAFTVVFS |
| Ga0209687_11597002 | 3300026322 | Soil | MKGTDLQSEANGDSAPLFGSWAKDYCVALGIFAFEIVLFYAFTVLFS |
| Ga0209473_10021872 | 3300026330 | Soil | MKGTDLQSEPDGDSPPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS |
| Ga0209803_13219271 | 3300026332 | Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFVFEIVLFYAFTVVFS |
| Ga0209059_10420832 | 3300026527 | Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTV |
| Ga0209806_11828831 | 3300026529 | Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFE |
| Ga0209807_10506182 | 3300026530 | Soil | RRGMKGTNPQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTAIFS |
| Ga0209058_10069876 | 3300026536 | Soil | MKGTDLQSEPDGDSAPLFGSWPKAYCVALGIFAFEIVLFYTFTVVFS |
| Ga0209474_102565342 | 3300026550 | Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEVVLFYAFTVVFS |
| Ga0179587_102427472 | 3300026557 | Vadose Zone Soil | MKGTDLQSEPNSDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS |
| Ga0207479_1019382 | 3300026973 | Soil | MKGRYLQSEPNGDSAPLFGSWPKAYCVALGIFGFEIVLLYAFTVIFS |
| Ga0207448_1041402 | 3300027478 | Soil | MKATDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLFYAFTVVFS |
| Ga0268264_103336872 | 3300028381 | Switchgrass Rhizosphere | GMKGTDLQSEPDGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0307293_101045022 | 3300028711 | Soil | MKGTDLQSEPNGESAPLFGSWPKAYCVTLGIFAFEIVLFYVFTIVFS |
| Ga0307298_101214671 | 3300028717 | Soil | MKGTDLQSEPNGESAPLFGSWPKAYCVTLGIFAFEIVLFYAFT |
| Ga0307288_101814321 | 3300028778 | Soil | QSCFAAQCGMKGPDLQSEPDGESAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0307287_100363482 | 3300028796 | Soil | MKGTDLQSEPNGDSPPLFGSWPKAYCIALGIFAFEIVLLYAFTVVFS |
| Ga0307304_102323251 | 3300028885 | Soil | MKGRDLQSEPNGDSAPLFGSWPKAYCVALGIFAFEIVLL |
| Ga0075377_116442892 | 3300030844 | Soil | MKGTDLQGEPNDDSAPLFGSWPKAYCVVLGIFAFEIVLLYAFTVVFS |
| Ga0068589_110997672 | 3300030979 | Soil | MKGTDLQGEPNGDSAPLFGSWRKAYCVTLGIFAFEIVLLYAFTVIFS |
| Ga0170819_116173882 | 3300031469 | Forest Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLLYAFTVVFS |
| Ga0307469_104259072 | 3300031720 | Hardwood Forest Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVIFS |
| Ga0307473_104204522 | 3300031820 | Hardwood Forest Soil | MKGRDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVIFS |
| Ga0307470_114585542 | 3300032174 | Hardwood Forest Soil | VAQCGMKGTDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0307470_115611642 | 3300032174 | Hardwood Forest Soil | MKGTDLQSEPNGDSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVF |
| Ga0307471_1029126122 | 3300032180 | Hardwood Forest Soil | MKGTDLQSGPNGESAPLFGSWLKAYCVTLGIFAFEIVLFYAFTVVFS |
| Ga0310810_109017031 | 3300033412 | Soil | SEPDGDSAPLLGSWPKAYCVTLGIFAFEIVLFYAFTVIFS |
| Ga0373948_0083605_603_731 | 3300034817 | Rhizosphere Soil | LQSEPNGKSAPLFGSWPKAYCVTLGIFAFEIVLFYAFTVVFS |
| ⦗Top⦘ |