| Basic Information | |
|---|---|
| Family ID | F017631 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 239 |
| Average Sequence Length | 39 residues |
| Representative Sequence | LYNGKYQEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Number of Associated Samples | 169 |
| Number of Associated Scaffolds | 239 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.27 % |
| % of genes near scaffold ends (potentially truncated) | 95.82 % |
| % of genes from short scaffolds (< 2000 bps) | 91.63 % |
| Associated GOLD sequencing projects | 154 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.109 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.268 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.874 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.69% β-sheet: 0.00% Coil/Unstructured: 70.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 239 Family Scaffolds |
|---|---|---|
| PF02945 | Endonuclease_7 | 0.84 |
| PF01844 | HNH | 0.42 |
| PF13649 | Methyltransf_25 | 0.42 |
| PF13385 | Laminin_G_3 | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.11 % |
| All Organisms | root | All Organisms | 33.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c029101 | Not Available | 776 | Open in IMG/M |
| 3300001839|RCM40_1019613 | Not Available | 661 | Open in IMG/M |
| 3300002092|JGI24218J26658_1021327 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300002305|B570J29619_1011370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 683 | Open in IMG/M |
| 3300003823|Ga0007875_1010628 | Not Available | 1121 | Open in IMG/M |
| 3300004460|Ga0066222_1076992 | Not Available | 508 | Open in IMG/M |
| 3300004684|Ga0065168_1064254 | Not Available | 578 | Open in IMG/M |
| 3300004685|Ga0065177_1084861 | Not Available | 588 | Open in IMG/M |
| 3300004807|Ga0007809_10116149 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300005525|Ga0068877_10245589 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300005581|Ga0049081_10151829 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300005582|Ga0049080_10223162 | Not Available | 619 | Open in IMG/M |
| 3300005582|Ga0049080_10246664 | Not Available | 583 | Open in IMG/M |
| 3300006101|Ga0007810_1042737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
| 3300006104|Ga0007882_10212002 | Not Available | 653 | Open in IMG/M |
| 3300006108|Ga0007862_1011788 | Not Available | 2018 | Open in IMG/M |
| 3300006108|Ga0007862_1087169 | Not Available | 595 | Open in IMG/M |
| 3300006110|Ga0007871_1086331 | Not Available | 591 | Open in IMG/M |
| 3300006110|Ga0007871_1093234 | Not Available | 568 | Open in IMG/M |
| 3300006123|Ga0007852_1045000 | Not Available | 1049 | Open in IMG/M |
| 3300006123|Ga0007852_1087994 | Not Available | 699 | Open in IMG/M |
| 3300006129|Ga0007834_1125903 | Not Available | 527 | Open in IMG/M |
| 3300006637|Ga0075461_10243736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300006802|Ga0070749_10134645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1445 | Open in IMG/M |
| 3300006802|Ga0070749_10196067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1158 | Open in IMG/M |
| 3300006802|Ga0070749_10594479 | Not Available | 597 | Open in IMG/M |
| 3300006802|Ga0070749_10646051 | Not Available | 568 | Open in IMG/M |
| 3300006810|Ga0070754_10026654 | All Organisms → Viruses → Predicted Viral | 3285 | Open in IMG/M |
| 3300006810|Ga0070754_10206691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
| 3300006810|Ga0070754_10247163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300006916|Ga0070750_10038123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2369 | Open in IMG/M |
| 3300007171|Ga0102977_1001150 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. | 2288 | Open in IMG/M |
| 3300007516|Ga0105050_10194100 | Not Available | 1275 | Open in IMG/M |
| 3300007520|Ga0105054_10855827 | Not Available | 653 | Open in IMG/M |
| 3300007538|Ga0099851_1055747 | Not Available | 1548 | Open in IMG/M |
| 3300007539|Ga0099849_1205221 | Not Available | 740 | Open in IMG/M |
| 3300007540|Ga0099847_1063086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1154 | Open in IMG/M |
| 3300007541|Ga0099848_1185615 | Not Available | 753 | Open in IMG/M |
| 3300007541|Ga0099848_1201780 | Not Available | 713 | Open in IMG/M |
| 3300007960|Ga0099850_1062625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1570 | Open in IMG/M |
| 3300008012|Ga0075480_10531246 | Not Available | 563 | Open in IMG/M |
| 3300008110|Ga0114343_1033844 | Not Available | 2106 | Open in IMG/M |
| 3300008110|Ga0114343_1205517 | Not Available | 564 | Open in IMG/M |
| 3300008266|Ga0114363_1080335 | All Organisms → Viruses → Predicted Viral | 1217 | Open in IMG/M |
| 3300008266|Ga0114363_1148817 | All Organisms → Viruses → Predicted Viral | 1143 | Open in IMG/M |
| 3300009037|Ga0105093_10526128 | Not Available | 661 | Open in IMG/M |
| 3300009037|Ga0105093_10797107 | Not Available | 549 | Open in IMG/M |
| 3300009068|Ga0114973_10563754 | Not Available | 586 | Open in IMG/M |
| 3300009082|Ga0105099_10935328 | Not Available | 549 | Open in IMG/M |
| 3300009149|Ga0114918_10424615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300009151|Ga0114962_10617463 | Not Available | 561 | Open in IMG/M |
| 3300009152|Ga0114980_10653910 | Not Available | 591 | Open in IMG/M |
| 3300009155|Ga0114968_10380517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 774 | Open in IMG/M |
| 3300009159|Ga0114978_10749505 | Not Available | 553 | Open in IMG/M |
| 3300009161|Ga0114966_10757848 | Not Available | 527 | Open in IMG/M |
| 3300009168|Ga0105104_10868456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300009180|Ga0114979_10216036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1157 | Open in IMG/M |
| 3300009180|Ga0114979_10337710 | Not Available | 890 | Open in IMG/M |
| 3300009181|Ga0114969_10671052 | Not Available | 561 | Open in IMG/M |
| 3300009182|Ga0114959_10445928 | Not Available | 629 | Open in IMG/M |
| 3300009182|Ga0114959_10565647 | Not Available | 545 | Open in IMG/M |
| 3300009183|Ga0114974_10087489 | Not Available | 2021 | Open in IMG/M |
| 3300009183|Ga0114974_10387053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300009183|Ga0114974_10614590 | Not Available | 598 | Open in IMG/M |
| 3300009184|Ga0114976_10578460 | Not Available | 572 | Open in IMG/M |
| 3300010157|Ga0114964_10029638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3024 | Open in IMG/M |
| 3300010157|Ga0114964_10181912 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
| 3300010157|Ga0114964_10293698 | Not Available | 771 | Open in IMG/M |
| 3300010158|Ga0114960_10305107 | Not Available | 798 | Open in IMG/M |
| 3300010299|Ga0129342_1160202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
| 3300010300|Ga0129351_1327778 | Not Available | 576 | Open in IMG/M |
| 3300010316|Ga0136655_1136763 | Not Available | 733 | Open in IMG/M |
| 3300010334|Ga0136644_10519727 | Not Available | 662 | Open in IMG/M |
| 3300010354|Ga0129333_10135531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2263 | Open in IMG/M |
| 3300010368|Ga0129324_10259381 | Not Available | 691 | Open in IMG/M |
| 3300010389|Ga0136549_10082011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1563 | Open in IMG/M |
| 3300010389|Ga0136549_10138378 | All Organisms → Viruses → Predicted Viral | 1106 | Open in IMG/M |
| 3300010885|Ga0133913_10569140 | Not Available | 2978 | Open in IMG/M |
| 3300011010|Ga0139557_1008829 | Not Available | 2017 | Open in IMG/M |
| 3300012012|Ga0153799_1102638 | Not Available | 507 | Open in IMG/M |
| 3300012017|Ga0153801_1047999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300012732|Ga0157549_1186783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1916 | Open in IMG/M |
| 3300013093|Ga0164296_1066288 | All Organisms → Viruses → Predicted Viral | 1635 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10524075 | Not Available | 784 | Open in IMG/M |
| 3300017700|Ga0181339_1034285 | Not Available | 555 | Open in IMG/M |
| 3300017701|Ga0181364_1046970 | Not Available | 680 | Open in IMG/M |
| 3300017707|Ga0181363_1068183 | Not Available | 618 | Open in IMG/M |
| 3300017716|Ga0181350_1075074 | Not Available | 862 | Open in IMG/M |
| 3300017716|Ga0181350_1080985 | Not Available | 821 | Open in IMG/M |
| 3300017716|Ga0181350_1123420 | Not Available | 620 | Open in IMG/M |
| 3300017716|Ga0181350_1142711 | Not Available | 563 | Open in IMG/M |
| 3300017716|Ga0181350_1165473 | Not Available | 511 | Open in IMG/M |
| 3300017722|Ga0181347_1125776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 714 | Open in IMG/M |
| 3300017722|Ga0181347_1166127 | Not Available | 596 | Open in IMG/M |
| 3300017723|Ga0181362_1029431 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
| 3300017723|Ga0181362_1110826 | Not Available | 541 | Open in IMG/M |
| 3300017723|Ga0181362_1125221 | Not Available | 502 | Open in IMG/M |
| 3300017736|Ga0181365_1053953 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300017754|Ga0181344_1087199 | Not Available | 913 | Open in IMG/M |
| 3300017754|Ga0181344_1127382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 732 | Open in IMG/M |
| 3300017754|Ga0181344_1133749 | Not Available | 711 | Open in IMG/M |
| 3300017754|Ga0181344_1135054 | Not Available | 707 | Open in IMG/M |
| 3300017754|Ga0181344_1182679 | Not Available | 592 | Open in IMG/M |
| 3300017761|Ga0181356_1128947 | Not Available | 800 | Open in IMG/M |
| 3300017761|Ga0181356_1223728 | Not Available | 547 | Open in IMG/M |
| 3300017766|Ga0181343_1127926 | Not Available | 712 | Open in IMG/M |
| 3300017774|Ga0181358_1248869 | Not Available | 560 | Open in IMG/M |
| 3300017774|Ga0181358_1265351 | Not Available | 535 | Open in IMG/M |
| 3300017777|Ga0181357_1117747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 998 | Open in IMG/M |
| 3300017777|Ga0181357_1251747 | Not Available | 613 | Open in IMG/M |
| 3300017777|Ga0181357_1292870 | Not Available | 555 | Open in IMG/M |
| 3300017778|Ga0181349_1088290 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
| 3300017778|Ga0181349_1274255 | Not Available | 555 | Open in IMG/M |
| 3300017778|Ga0181349_1297696 | Not Available | 524 | Open in IMG/M |
| 3300017778|Ga0181349_1316644 | Not Available | 502 | Open in IMG/M |
| 3300017780|Ga0181346_1125221 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300017780|Ga0181346_1298058 | Not Available | 548 | Open in IMG/M |
| 3300017784|Ga0181348_1038991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1975 | Open in IMG/M |
| 3300017784|Ga0181348_1232457 | Not Available | 646 | Open in IMG/M |
| 3300017785|Ga0181355_1083678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1331 | Open in IMG/M |
| 3300017785|Ga0181355_1319719 | Not Available | 578 | Open in IMG/M |
| 3300017785|Ga0181355_1362262 | Not Available | 531 | Open in IMG/M |
| 3300017963|Ga0180437_11067029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300018420|Ga0181563_10684809 | Not Available | 566 | Open in IMG/M |
| 3300019783|Ga0181361_109210 | Not Available | 767 | Open in IMG/M |
| 3300019783|Ga0181361_113568 | Not Available | 640 | Open in IMG/M |
| 3300019784|Ga0181359_1010861 | All Organisms → Viruses → Predicted Viral | 3250 | Open in IMG/M |
| 3300019784|Ga0181359_1064194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1401 | Open in IMG/M |
| 3300020179|Ga0194134_10290181 | Not Available | 650 | Open in IMG/M |
| 3300020200|Ga0194121_10142750 | Not Available | 1404 | Open in IMG/M |
| 3300020204|Ga0194116_10501278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300021129|Ga0214179_1042081 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300021139|Ga0214166_1073239 | Not Available | 705 | Open in IMG/M |
| 3300021424|Ga0194117_10503961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300021961|Ga0222714_10126252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1571 | Open in IMG/M |
| 3300021962|Ga0222713_10161063 | All Organisms → Viruses → Predicted Viral | 1538 | Open in IMG/M |
| 3300021962|Ga0222713_10557542 | Not Available | 675 | Open in IMG/M |
| 3300022057|Ga0212025_1029480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 920 | Open in IMG/M |
| 3300022167|Ga0212020_1078806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300022190|Ga0181354_1049381 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300022190|Ga0181354_1073609 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300022190|Ga0181354_1081580 | Not Available | 1066 | Open in IMG/M |
| 3300022190|Ga0181354_1099662 | Not Available | 947 | Open in IMG/M |
| 3300022190|Ga0181354_1214336 | Not Available | 566 | Open in IMG/M |
| 3300022190|Ga0181354_1214932 | Not Available | 565 | Open in IMG/M |
| 3300022190|Ga0181354_1251603 | Not Available | 503 | Open in IMG/M |
| 3300022198|Ga0196905_1165738 | Not Available | 564 | Open in IMG/M |
| 3300022407|Ga0181351_1060170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1563 | Open in IMG/M |
| 3300022407|Ga0181351_1189033 | Not Available | 700 | Open in IMG/M |
| 3300022407|Ga0181351_1234076 | Not Available | 585 | Open in IMG/M |
| 3300022839|Ga0222649_1014896 | Not Available | 1088 | Open in IMG/M |
| 3300025162|Ga0209083_1130625 | Not Available | 975 | Open in IMG/M |
| 3300025353|Ga0208255_110015 | Not Available | 885 | Open in IMG/M |
| 3300025353|Ga0208255_117854 | Not Available | 634 | Open in IMG/M |
| 3300025357|Ga0208383_1013086 | Not Available | 1030 | Open in IMG/M |
| 3300025375|Ga0208259_1012782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1297 | Open in IMG/M |
| 3300025379|Ga0208738_1052665 | Not Available | 581 | Open in IMG/M |
| 3300025407|Ga0208378_1023505 | Not Available | 1115 | Open in IMG/M |
| 3300025410|Ga0208875_1036775 | Not Available | 792 | Open in IMG/M |
| 3300025411|Ga0208865_1041210 | Not Available | 748 | Open in IMG/M |
| 3300025417|Ga0208616_1029168 | Not Available | 838 | Open in IMG/M |
| 3300025421|Ga0207958_1029029 | Not Available | 869 | Open in IMG/M |
| 3300025424|Ga0208617_1081835 | Not Available | 533 | Open in IMG/M |
| 3300025429|Ga0208500_1018625 | Not Available | 925 | Open in IMG/M |
| 3300025598|Ga0208379_1106076 | Not Available | 666 | Open in IMG/M |
| 3300025616|Ga0208613_1096213 | Not Available | 670 | Open in IMG/M |
| 3300025647|Ga0208160_1049930 | Not Available | 1193 | Open in IMG/M |
| 3300025652|Ga0208134_1041682 | All Organisms → Viruses → Predicted Viral | 1522 | Open in IMG/M |
| 3300025652|Ga0208134_1167013 | Not Available | 540 | Open in IMG/M |
| 3300025698|Ga0208771_1172505 | Not Available | 586 | Open in IMG/M |
| 3300025781|Ga0208386_1035773 | Not Available | 701 | Open in IMG/M |
| 3300025889|Ga0208644_1287682 | Not Available | 659 | Open in IMG/M |
| 3300025889|Ga0208644_1335866 | Not Available | 583 | Open in IMG/M |
| 3300026187|Ga0209929_1118797 | Not Available | 670 | Open in IMG/M |
| 3300027396|Ga0255146_1114958 | Not Available | 550 | Open in IMG/M |
| 3300027499|Ga0208788_1079631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
| 3300027608|Ga0208974_1001307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9804 | Open in IMG/M |
| 3300027608|Ga0208974_1144569 | Not Available | 607 | Open in IMG/M |
| 3300027659|Ga0208975_1022269 | All Organisms → Viruses → Predicted Viral | 2070 | Open in IMG/M |
| 3300027659|Ga0208975_1083276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 944 | Open in IMG/M |
| 3300027708|Ga0209188_1314236 | Not Available | 517 | Open in IMG/M |
| 3300027732|Ga0209442_1253299 | Not Available | 628 | Open in IMG/M |
| 3300027733|Ga0209297_1163637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
| 3300027736|Ga0209190_1009432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5901 | Open in IMG/M |
| 3300027741|Ga0209085_1065827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1649 | Open in IMG/M |
| 3300027747|Ga0209189_1049436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2042 | Open in IMG/M |
| 3300027749|Ga0209084_1117992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1146 | Open in IMG/M |
| 3300027749|Ga0209084_1203552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
| 3300027749|Ga0209084_1362904 | Not Available | 528 | Open in IMG/M |
| 3300027759|Ga0209296_1130464 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
| 3300027759|Ga0209296_1367990 | Not Available | 548 | Open in IMG/M |
| 3300027760|Ga0209598_10242814 | Not Available | 734 | Open in IMG/M |
| 3300027772|Ga0209768_10271120 | Not Available | 726 | Open in IMG/M |
| 3300027798|Ga0209353_10155825 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
| 3300027798|Ga0209353_10367853 | Not Available | 597 | Open in IMG/M |
| 3300027892|Ga0209550_10368782 | Not Available | 898 | Open in IMG/M |
| 3300027893|Ga0209636_10804380 | Not Available | 719 | Open in IMG/M |
| 3300027896|Ga0209777_10443307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
| 3300027896|Ga0209777_10596231 | Not Available | 800 | Open in IMG/M |
| 3300027917|Ga0209536_101235875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
| 3300027969|Ga0209191_1033056 | All Organisms → Viruses → Predicted Viral | 2466 | Open in IMG/M |
| 3300027969|Ga0209191_1256873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300027973|Ga0209298_10090920 | All Organisms → Viruses → Predicted Viral | 1344 | Open in IMG/M |
| 3300027976|Ga0209702_10097645 | Not Available | 1395 | Open in IMG/M |
| 3300028086|Ga0255201_1007418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1906 | Open in IMG/M |
| 3300028393|Ga0304728_1102448 | Not Available | 1093 | Open in IMG/M |
| 3300028393|Ga0304728_1181402 | Not Available | 742 | Open in IMG/M |
| 3300028393|Ga0304728_1296554 | Not Available | 525 | Open in IMG/M |
| 3300029932|Ga0119933_1043646 | Not Available | 552 | Open in IMG/M |
| 3300031539|Ga0307380_10234748 | Not Available | 1744 | Open in IMG/M |
| 3300031578|Ga0307376_10555126 | Not Available | 736 | Open in IMG/M |
| 3300031669|Ga0307375_10149697 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1617 | Open in IMG/M |
| 3300031759|Ga0316219_1273172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300031787|Ga0315900_10464253 | Not Available | 974 | Open in IMG/M |
| 3300031787|Ga0315900_11015436 | Not Available | 543 | Open in IMG/M |
| 3300031999|Ga0315274_11421879 | Not Available | 666 | Open in IMG/M |
| 3300032053|Ga0315284_11185842 | Not Available | 840 | Open in IMG/M |
| 3300032118|Ga0315277_10822485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300032173|Ga0315268_12279567 | Not Available | 555 | Open in IMG/M |
| 3300032435|Ga0335398_10240304 | Not Available | 1603 | Open in IMG/M |
| 3300032560|Ga0316223_1034881 | All Organisms → Viruses → Predicted Viral | 2132 | Open in IMG/M |
| 3300032560|Ga0316223_1216229 | Not Available | 606 | Open in IMG/M |
| 3300032561|Ga0316222_1135508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
| 3300032562|Ga0316226_1385966 | Not Available | 514 | Open in IMG/M |
| 3300032605|Ga0316232_1077481 | Not Available | 1555 | Open in IMG/M |
| 3300032605|Ga0316232_1337307 | Not Available | 553 | Open in IMG/M |
| 3300032675|Ga0316225_1198021 | Not Available | 625 | Open in IMG/M |
| 3300032677|Ga0316227_1187666 | Not Available | 732 | Open in IMG/M |
| 3300033233|Ga0334722_10229676 | All Organisms → Viruses → Predicted Viral | 1367 | Open in IMG/M |
| 3300033993|Ga0334994_0145231 | Not Available | 1340 | Open in IMG/M |
| 3300033993|Ga0334994_0410272 | Not Available | 652 | Open in IMG/M |
| 3300034062|Ga0334995_0158958 | Not Available | 1620 | Open in IMG/M |
| 3300034092|Ga0335010_0695856 | Not Available | 501 | Open in IMG/M |
| 3300034105|Ga0335035_0709449 | Not Available | 515 | Open in IMG/M |
| 3300034112|Ga0335066_0505977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300034121|Ga0335058_0765278 | Not Available | 528 | Open in IMG/M |
| 3300034272|Ga0335049_0079341 | Not Available | 2408 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.27% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 11.72% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 3.77% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.09% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.09% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.09% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.67% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.26% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.26% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.84% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.84% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.84% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.42% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.42% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.42% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.42% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.42% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.42% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.42% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.42% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.42% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.42% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.42% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002305 | Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300003823 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006110 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09 | Environmental | Open in IMG/M |
| 3300006123 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 | Environmental | Open in IMG/M |
| 3300006129 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007520 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012732 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES039 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300021129 | Freshwater microbial communities from Trout Bog Lake, WI - 01OCT2007 epilimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022839 | Saline water microbial communities from Ace Lake, Antarctica - #337 | Environmental | Open in IMG/M |
| 3300025162 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025353 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025375 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025411 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025424 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025429 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025698 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX (SPAdes) | Environmental | Open in IMG/M |
| 3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028086 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300029932 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201207A | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032435 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 (spades assembly) | Environmental | Open in IMG/M |
| 3300032560 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009 | Environmental | Open in IMG/M |
| 3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
| 3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
| 3300032677 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0291011 | 3300000176 | Freshwater | ADMVALYEKRYTEALALAKRLGDGMERQDAYRSGQFRQAVT* |
| RCM40_10196131 | 3300001839 | Marine Plankton | LYNQKYMEALALAKRLGDGLERSDAYRSGQYRAAP |
| JGI24218J26658_10213271 | 3300002092 | Lentic | FMKGEQDMMTLYNQKYVEALALAKRLGDGMERQDAYRTPQFREAVT* |
| B570J29619_10113701 | 3300002305 | Freshwater | MKGETDMMALYNQKFMEALALAKRLADGMERQDAYRSGQFRQKVT* |
| Ga0007875_10106284 | 3300003823 | Freshwater | EQDMFTIYNQKYTEALALAKRLGDGMERQDAYRNGQYRQKVT* |
| Ga0066222_10769923 | 3300004460 | Marine | KGEQDMMALYNQKFAQAIALAKRLGDGLERRDAYRDGQLRVDVS* |
| Ga0065168_10642542 | 3300004684 | Freshwater | MVKLYTDRYMEALALAKRLGDGMERTDAYRTGQYSQAVK* |
| Ga0065177_10848612 | 3300004685 | Freshwater | MFTIYNQKYTEALALAKRLGDGMERRDAYRSGQTRIDVS* |
| Ga0007809_101161493 | 3300004807 | Freshwater | DMMALYNQKYIEALALAKRLGDGMERQDAYRTPQFRQAVT* |
| Ga0068877_102455893 | 3300005525 | Freshwater Lake | LYNTKYAEALAMAKRLGDGMERQDAYRSGQYRQAVT* |
| Ga0049081_101518291 | 3300005581 | Freshwater Lentic | YNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT* |
| Ga0049080_102231621 | 3300005582 | Freshwater Lentic | ETDMMALYNGKYQEALALAKRLGDGMERQDAYRSGQFRQVVT* |
| Ga0049080_102466641 | 3300005582 | Freshwater Lentic | ETDMMALYNGKYQEALALAKRLGDGMERQDAYRSGQFRQAVT* |
| Ga0007810_10427371 | 3300006101 | Freshwater | EQDLVQLYNGKYVEALAQAKRLGDGLERQDAFRSGQYRQKVE* |
| Ga0007882_102120023 | 3300006104 | Freshwater | MMALYNQKYIEALALAKRLGDGLERQDSYRDGQFRQVVT* |
| Ga0007862_10117881 | 3300006108 | Freshwater | LYDGKYKEALGQAKRLGDGLERQDAYRSGQYRQQVT* |
| Ga0007862_10871692 | 3300006108 | Freshwater | YNQKYVEALALAKRLGDGMERRDAYRSGQFRQAVT* |
| Ga0007871_10863311 | 3300006110 | Freshwater | EADLVTLYNTKYTEALAEAKRLGDALERQDAYRSGQYRQAVT* |
| Ga0007871_10932342 | 3300006110 | Freshwater | NQKYVEALALAKRLGDGMERQDAYRDGQFRQKVT* |
| Ga0007852_10450003 | 3300006123 | Freshwater | YNQKYVEALALAKRLGDGMERQDAYRDGQFRQKVT* |
| Ga0007852_10879941 | 3300006123 | Freshwater | LYDKKYNEALAIAKRLGDGMERQDAYRSGQYRQAVT* |
| Ga0007834_11259032 | 3300006129 | Freshwater | TDMMTLYNQKYVEALALAKRLGDGMERQDAYRDGQFRQKVT* |
| Ga0075461_102437362 | 3300006637 | Aqueous | DVLANYNKRYEEAMILAKRLGDGMERRDAYRSGQVRMTVN* |
| Ga0070749_101346453 | 3300006802 | Aqueous | MTAYDAKYKEALALAKRLGDGLERQDSYRSGQYRQAVT* |
| Ga0070749_101960673 | 3300006802 | Aqueous | VIAQYTKRYEEAIMLAKRLGDGMDRRDSYRSGQLRVPVN* |
| Ga0070749_105944791 | 3300006802 | Aqueous | YNTKYTEALALAKRLGDGMERQDAYRSGQYRQAVT* |
| Ga0070749_106460513 | 3300006802 | Aqueous | YDGKFKEAVALAQRLGDGLERQDAYRSGQARVQVT* |
| Ga0070754_100266541 | 3300006810 | Aqueous | NTKFNEGIQLAKRLGDGLERQDAYRSGQVRVPVT* |
| Ga0070754_102066913 | 3300006810 | Aqueous | YNKRYEEAMILAKRLGDGMERRDAYRSGQVRMTVN* |
| Ga0070754_102471631 | 3300006810 | Aqueous | PDVLANYQNRYNEALMLAKRMGDGMERQDAYRSGQVRVPVT* |
| Ga0070750_100381231 | 3300006916 | Aqueous | NKRYEEAMILAKRLGDGMERRDAYRSGQTRMSVN* |
| Ga0102977_10011501 | 3300007171 | Freshwater Lake | QTQYENKYKEAILLAKRLGDGMERQDAYRSGQARIPVT* |
| Ga0105050_101941001 | 3300007516 | Freshwater | DMMQLYNAKYAEAMQLAKRLGDGLEKNDSYRTGQVQVPVN* |
| Ga0105054_108558272 | 3300007520 | Freshwater | EADLLTLYNTKYNEALQLAKRLGDGLERQDSYRSGQVRIPVI* |
| Ga0099851_10557475 | 3300007538 | Aqueous | KGDADLMTQYDNKYKEALLLAKRLGDGMERQDAYRSGQARIPVT* |
| Ga0099849_12052211 | 3300007539 | Aqueous | GDADLMTQYDNKYKEALLLAKRLGDGMERQDAYRSGQARIPVT* |
| Ga0099847_10630861 | 3300007540 | Aqueous | AYNKRYEEAMILLKRLGDGMERRDAYRSGQVRMTVN* |
| Ga0099848_11856151 | 3300007541 | Aqueous | MTQYDNKYKEALLLAKRLGDGMERQDAYRSGQARIPVT* |
| Ga0099848_12017801 | 3300007541 | Aqueous | NKRYEEAMILLKRLGDGMERRDAYRSGQVRMSVN* |
| Ga0099850_10626251 | 3300007960 | Aqueous | AYNAKYNEALQLAKRLGDGLERQDSYRSGQVRVPVT* |
| Ga0075480_105312461 | 3300008012 | Aqueous | QLYNAKYNEALQLAKRLGDGLERQDSYRSGQVRVPVT* |
| Ga0114343_10338445 | 3300008110 | Freshwater, Plankton | MKGEQDMMALYNQKFMEALALAKRLADGMERQDAYRSGQFRQKVT* |
| Ga0114343_12055171 | 3300008110 | Freshwater, Plankton | DTKFKEALALAKRLGDGMERQDAYRSGQFRQAVT* |
| Ga0114363_10803351 | 3300008266 | Freshwater, Plankton | YNQKYMEAMALAKRLGDGMERQDAYRSGQFRQKVT* |
| Ga0114363_11488171 | 3300008266 | Freshwater, Plankton | DGKYKEALAQAKRLGDGMERQDAYRSGQYRQAVT* |
| Ga0105093_105261283 | 3300009037 | Freshwater Sediment | ALYDGKYKEALAQAKRLGDGMERQDAYRSGQYRQAVT* |
| Ga0105093_107971071 | 3300009037 | Freshwater Sediment | TALYNGKYTEALALAKRLGDGMERQDAYRSGQYRQAVT* |
| Ga0114973_105637541 | 3300009068 | Freshwater Lake | MKGEVDMMGLYNQKFIEALALAKRLGDGMERQDAYRSGQFRQVVT* |
| Ga0105099_109353281 | 3300009082 | Freshwater Sediment | GEQDMLTLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT* |
| Ga0114918_104246151 | 3300009149 | Deep Subsurface | INNYEKRYNEALLLAKRLGDGMERQDAYRSGQFRMDVQ* |
| Ga0114962_106174631 | 3300009151 | Freshwater Lake | EQDLIALYDGKYKEALGLAKRLGDGLERQDAYRSGQFRQAVT* |
| Ga0114980_106539101 | 3300009152 | Freshwater Lake | MKGETDMMQLYDGKYKEAVALAKRLGDGLERQDAYRSGQLRVKVT* |
| Ga0114968_103805173 | 3300009155 | Freshwater Lake | EQDMITLYNTKFGETLIQLKRLGDGLERQDAYRSGQVRTQVN* |
| Ga0114977_103337914 | 3300009158 | Freshwater Lake | KGEADMVALYSGRYQESLALAKRLGDGLEKQDSYRSGTYRVDVR* |
| Ga0114978_107495051 | 3300009159 | Freshwater Lake | MMALYDGKYKEALALAKRLGDGMERQDAYRSGQVRINVT* |
| Ga0114966_107578482 | 3300009161 | Freshwater Lake | DMMALYNGKYQEALALAKRLGDGMERQDAYRSGQFRQAVT* |
| Ga0105104_108684561 | 3300009168 | Freshwater Sediment | KQRYEEALLMAKRLGDGMERTDAYRAGQARYQVV* |
| Ga0114979_102160361 | 3300009180 | Freshwater Lake | KGEPDLVALYRQKYVEALALAKRLGDGMERQDAYRSGQLRVEVS* |
| Ga0114979_103377101 | 3300009180 | Freshwater Lake | DMMALYNGKYTEALALAKRLGDGMERQDAYRSGQFRQAVT* |
| Ga0114969_106710522 | 3300009181 | Freshwater Lake | DMMGLYNQKFIEALALAKRLGDGMERQDAYRSGQFRQVVT* |
| Ga0114959_104459283 | 3300009182 | Freshwater Lake | ITLYDTKYKEALALAKRLGDGMERQDAYRTGQYRQAVT* |
| Ga0114959_105656471 | 3300009182 | Freshwater Lake | YDTKYKEALALAKRLGDGMERQDAYRSGQYRQAVT* |
| Ga0114974_100874895 | 3300009183 | Freshwater Lake | VAMYQQRYMEALMLAKRLGDGMERRDAYRSGQVRAEVP* |
| Ga0114974_103870533 | 3300009183 | Freshwater Lake | ITAYNTKYMEALAMAKRLGDGMERQDAYRSGQYRQKVT* |
| Ga0114974_106145901 | 3300009183 | Freshwater Lake | MMQLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQRVT* |
| Ga0114976_105784601 | 3300009184 | Freshwater Lake | LYDTKYKEALALAKRLGDGMERQDAYRSGQYRQAVT* |
| Ga0114964_100296386 | 3300010157 | Freshwater Lake | DMMALYDGKYKEALMLAKRLGDGLERQDAYRSGQVRIPVQ* |
| Ga0114964_101819124 | 3300010157 | Freshwater Lake | YDGKYKEALGLAKRLGDGLERQDAYRSGQYRQKVT* |
| Ga0114964_102936981 | 3300010157 | Freshwater Lake | QLYDAKYKEAVALAKRLGDGLERQDAYRSGQYRQKVN* |
| Ga0114960_103051071 | 3300010158 | Freshwater Lake | ALYDGKYKEALAMAKRLGDGMERQDAYRSGQYRQAVT* |
| Ga0129342_11602023 | 3300010299 | Freshwater To Marine Saline Gradient | LLNLYNGKFSEALQMAKRLGDGLEKQDAYRSGQPKVPVN* |
| Ga0129351_13277782 | 3300010300 | Freshwater To Marine Saline Gradient | EPDLLQLYNTKFNEGIQLAKRLGDGLERQDAYRSGQVRVPVT* |
| Ga0136655_11367633 | 3300010316 | Freshwater To Marine Saline Gradient | YTGKYQEALALAKRLGDGMERQDAYRSGQVRVQVT* |
| Ga0136644_105197271 | 3300010334 | Freshwater Lake | ADLITVYDTKYKEALALAKRLGDGLERQDAYRSGQFRQAVT* |
| Ga0129333_101355316 | 3300010354 | Freshwater To Marine Saline Gradient | YNGKYNEALALAKRLGDGMERGDAYRSGQFRQAVT* |
| Ga0129324_102593811 | 3300010368 | Freshwater To Marine Saline Gradient | TQYDNKYKEAVLLAKRLGDGMERQDAYRSGQARIPVT* |
| Ga0136549_100820115 | 3300010389 | Marine Methane Seep Sediment | VLANYNKRYEEAMILAKRLGDGMERRDAYRSGQVRMTVN* |
| Ga0136549_101383781 | 3300010389 | Marine Methane Seep Sediment | VLANYNKRYEEAMILAKRLGDGMERRDAYRSGQVRMAVN* |
| Ga0133913_105691405 | 3300010885 | Freshwater Lake | YNQKYMEALALAKRLGDGMERQDAYRSGQFRQAVT* |
| Ga0139557_10088291 | 3300011010 | Freshwater | MMALYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT* |
| Ga0153799_11026381 | 3300012012 | Freshwater | GLYNTKYMEAMALAKRLGDGMERQDAYRSGQFRQAVT* |
| Ga0153801_10479991 | 3300012017 | Freshwater | YDGKYKEALGQLKRLGDGLERQDSYRSGQYRQAVT* |
| Ga0157549_11867831 | 3300012732 | Freshwater | LAQYQKRYDDALMMAKRLGDGMERGDAYRDGQYKQKVV* |
| Ga0164296_10662881 | 3300013093 | Freshwater | IIALYDQKYMEAVAQAKRLGDGLERQDAYRSGQYRQPVT* |
| (restricted) Ga0172375_105240751 | 3300013137 | Freshwater | AKRYEEAMILAKRMGDGMMRRDAYRSGQVRMTVN* |
| Ga0181339_10342852 | 3300017700 | Freshwater Lake | DMMALYNQKFMEALALAKRLGDGLERQDAYRSGQFRQKVT |
| Ga0181364_10469703 | 3300017701 | Freshwater Lake | MQLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0181363_10681831 | 3300017707 | Freshwater Lake | MQLYDGKFKEALQLAVKLGDGLERRDSYRNGQFRVEL |
| Ga0181350_10750744 | 3300017716 | Freshwater Lake | LAVYDGKYKEALAQAKRLGDGMERQDAYRSGQYRQRVT |
| Ga0181350_10809851 | 3300017716 | Freshwater Lake | ALYNGKYQEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0181350_11234203 | 3300017716 | Freshwater Lake | LGLYEGKYKEALALAKRLGDGLERQDAYRSGQFRQAVT |
| Ga0181350_11427111 | 3300017716 | Freshwater Lake | GLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0181350_11654731 | 3300017716 | Freshwater Lake | MMTLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQRVT |
| Ga0181347_11257763 | 3300017722 | Freshwater Lake | YNGKYQEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0181347_11661272 | 3300017722 | Freshwater Lake | DMVALYNQKYMEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0181362_10294311 | 3300017723 | Freshwater Lake | DDGKYKEALILAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0181362_11108261 | 3300017723 | Freshwater Lake | LYNQKFIEALALAKRLGDGLERQDAYRSGQFRQVVT |
| Ga0181362_11252212 | 3300017723 | Freshwater Lake | QLYNTKFMEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0181365_10539534 | 3300017736 | Freshwater Lake | RYNQKFMEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0181344_10871991 | 3300017754 | Freshwater Lake | MMALYNQKYMEAVVLAKRLADGLERQDAYRSGQFRQAVK |
| Ga0181344_11273821 | 3300017754 | Freshwater Lake | GENNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0181344_11337491 | 3300017754 | Freshwater Lake | TLYDGKYKEALAMAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0181344_11350543 | 3300017754 | Freshwater Lake | LYDTKFKEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0181344_11826792 | 3300017754 | Freshwater Lake | YNGKFMEALALAKRLGDGMERQDAYRSGQFRQRVT |
| Ga0181356_11289471 | 3300017761 | Freshwater Lake | ALYNQKFMEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0181356_12237281 | 3300017761 | Freshwater Lake | ITYQKKYEEAVAQAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0181343_11279263 | 3300017766 | Freshwater Lake | KGEQDMMTLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0181358_12488691 | 3300017774 | Freshwater Lake | IILGYDAKYKEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0181358_12653512 | 3300017774 | Freshwater Lake | IGLYEGKYKEALALAKRLGDGLERQDAYRSGQYRQAVT |
| Ga0181357_11177473 | 3300017777 | Freshwater Lake | DMIGLYEKKYQDALMLAKRLGDGMERRDAYRSGQARVDVQ |
| Ga0181357_12517472 | 3300017777 | Freshwater Lake | GETDMMALYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0181357_12928701 | 3300017777 | Freshwater Lake | MKGEVDMMGLYNQKFIEALALAKRLGDGMERQDAYRSGQFRQVVT |
| Ga0181349_10882903 | 3300017778 | Freshwater Lake | LYNGKYQEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0181349_12742551 | 3300017778 | Freshwater Lake | DMMALYDGKYKEALVLAKRLGDGLERQGAYRSGQYRQPVT |
| Ga0181349_12976961 | 3300017778 | Freshwater Lake | GLYDGKYKEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0181349_13166442 | 3300017778 | Freshwater Lake | KAEADMVTLYNQKYMEALALAKRLGDGMERQDAYRSGQDRHAVT |
| Ga0181346_11252213 | 3300017780 | Freshwater Lake | ALYNQKFMEALALAKRLADGMERQDAYRSGQFRQQVT |
| Ga0181346_12980582 | 3300017780 | Freshwater Lake | GEQDIISLYDTKFKEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0181348_10389915 | 3300017784 | Freshwater Lake | ETDMMALYNQKFMEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0181348_12324571 | 3300017784 | Freshwater Lake | DMMALYNQKFMEALALAKRLADGMERQDAYRSGQFRQKVT |
| Ga0181355_10836785 | 3300017785 | Freshwater Lake | VYDGKYKEALAQAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0181355_13197191 | 3300017785 | Freshwater Lake | MMQLYNGKFMEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0181355_13622621 | 3300017785 | Freshwater Lake | MTLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0180437_110670292 | 3300017963 | Hypersaline Lake Sediment | DVLAGYNKRYEEAMILAKRLGDGMERRDAYRSGQVRMAVN |
| Ga0181563_106848091 | 3300018420 | Salt Marsh | IMTGYDMKYKEALMLAKRLGDGMERQDAYRSGQFRQVVT |
| Ga0181361_1092103 | 3300019783 | Freshwater Lake | IMKGETDMLALYDGKYKEALALAKRLGDGLERGDAYRNGQARIQVT |
| Ga0181361_1135683 | 3300019783 | Freshwater Lake | EADMMQLYNGKYMEAMALAKRLGDGMERQDAYRSGQFRQRVT |
| Ga0181359_10108611 | 3300019784 | Freshwater Lake | TLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0181359_10641941 | 3300019784 | Freshwater Lake | ADMTALYNGKYTEALAQAKRLGDGLERGDAYRDGQYKQKVI |
| Ga0194134_102901811 | 3300020179 | Freshwater Lake | INSRYKEALILAKRLGDGLERMDAYRSGQVRDKVV |
| Ga0194121_101427504 | 3300020200 | Freshwater Lake | TQYENKYKEAILLAKRLGDGLERQDAYRSGQVRIPVG |
| Ga0194116_105012782 | 3300020204 | Freshwater Lake | YMGRYNEALMLAKRLGDGMERQDAYRSGQFRMEVK |
| Ga0214179_10420811 | 3300021129 | Freshwater | YEKRYMEALAIAKRLGDGLEREDAYRSGQFRIQPVQ |
| Ga0214164_10594223 | 3300021138 | Freshwater | DNKYKEALAIAKRLGDGMDRQDAYRSGQTRIQPVP |
| Ga0214166_10732393 | 3300021139 | Freshwater | MVKLYTDRYMEALALAKRLGDGMERTDAYRTGQYTQAVT |
| Ga0194117_105039611 | 3300021424 | Freshwater Lake | QYMGRYNEALMLAKRLGDGMERQDAYRSGQFRMEVK |
| Ga0222714_101262525 | 3300021961 | Estuarine Water | EADMMGIYNQKFMEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0222713_101610631 | 3300021962 | Estuarine Water | LYDGKYKEAMGQLKRLGDGLERQDSYRSGQYRQAVT |
| Ga0222713_105575423 | 3300021962 | Estuarine Water | TDMMQLYNQKFMEALALAKRLGDGMDRQDAYRSGQFRQKVT |
| Ga0212025_10294803 | 3300022057 | Aqueous | ANYNKRYEEAMILAKRLGDGMERRDAYRSGQVRMTVN |
| Ga0212020_10788061 | 3300022167 | Aqueous | YNKRYEEAMILAKRLGDGMERRDAYRSGQVRMTVN |
| Ga0181354_10493811 | 3300022190 | Freshwater Lake | TDLLAVYDGKYKEALAQAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0181354_10736093 | 3300022190 | Freshwater Lake | ELDMMALYNQKFMEALALAKRLADGMERQDAYRSGQFRQQVT |
| Ga0181354_10815803 | 3300022190 | Freshwater Lake | LYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0181354_10996622 | 3300022190 | Freshwater Lake | MKGETDMMALYNQKFMEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0181354_12143362 | 3300022190 | Freshwater Lake | MKGETDMMQLYNGKFMEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0181354_12149322 | 3300022190 | Freshwater Lake | MGLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0181354_12516031 | 3300022190 | Freshwater Lake | TDMMALYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0196905_11657381 | 3300022198 | Aqueous | DMIANYEKKYQESLMLAKRLGDGMEKQDQYRSGTPRVPVN |
| Ga0181351_10601701 | 3300022407 | Freshwater Lake | TIYDGKYKEALAQAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0181351_11890331 | 3300022407 | Freshwater Lake | RSNTKYNEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0181351_12340761 | 3300022407 | Freshwater Lake | ALYNGKYQEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0222649_10148963 | 3300022839 | Saline Water | MMQLYNAKYAEAMQLAKRLGDGLEKNDSYRTGQVQVPVN |
| Ga0209083_11306254 | 3300025162 | Freshwater | TYMKGEEDMMKLYDGKYKEALMLAKRLGDGMERGDAYRDGQYKQKVT |
| Ga0208255_1100151 | 3300025353 | Freshwater | YNSKYTEALAEAKRLGDALERQDAYRSGQYRQAVT |
| Ga0208255_1178541 | 3300025353 | Freshwater | YNQKYVEALALAKRLGDGMERRDAYRSGQFRQAVT |
| Ga0208383_10130864 | 3300025357 | Freshwater | LVALYDGKYKEALGQAKRLGDGLERQDAYRSGQYRQKVT |
| Ga0208259_10127821 | 3300025375 | Freshwater | FMKGETDMMTLYNQKYVEALALAKRLGDGMERQDAYRDGQFRQKVT |
| Ga0208738_10526652 | 3300025379 | Freshwater | MKGETDMMTLYNQKYVEALALAKRLGDGMERQDAYRDGQFRQQVT |
| Ga0208378_10235051 | 3300025407 | Freshwater | YNQKYVEALALAKRLGDGMERQDAYRDGQFRQQVT |
| Ga0208875_10367751 | 3300025410 | Freshwater | IITLYNSKYTEALAEAKRLGDALERQDAYRSGQYRQAVT |
| Ga0208865_10412101 | 3300025411 | Freshwater | TLYNQKYVEALALAKRLGDGMERQDAYRDGQFRQKVT |
| Ga0208616_10291683 | 3300025417 | Freshwater | LYDGKYKEAIAQAKRLGDGLERQDAYRSGQYRQKVT |
| Ga0207958_10290294 | 3300025421 | Freshwater | LYNQKYVEALALAKRLGDGMERQDAYRDGQFRQQVT |
| Ga0208617_10818351 | 3300025424 | Freshwater | TDMMTLYNQKYVEALALAKRLGDGMERQDAYRDGQFRQKVT |
| Ga0208500_10186251 | 3300025429 | Freshwater | TIYNQKYVEALALAKRLGDGMERRDAYRSGQFRQAVT |
| Ga0208379_11060763 | 3300025598 | Freshwater | AFYDNKYKEALAIAKRLGDGMDRQDAYRSGQIRIQPVP |
| Ga0208613_10962133 | 3300025616 | Freshwater | MQLYDTKYREALAIAKRLGDGLEKQDSYRNGTYRVPVR |
| Ga0208160_10499303 | 3300025647 | Aqueous | DLLQLYNAKYNEALQLAKRLGDGLERQDSYRSGQVRVPVT |
| Ga0208134_10416823 | 3300025652 | Aqueous | LALYNTKYNEALQLAKRLGDGLERRDSYRSGQVRVPVN |
| Ga0208134_11670131 | 3300025652 | Aqueous | YNTKYTEALALAKRLGDGMERQDAYRSGQVRIKVT |
| Ga0208771_11725052 | 3300025698 | Saline Lake | KGEADMMQLYNAKYAEAMQLAKRLGDGLEKNDSYRTGQVQVPVN |
| Ga0208386_10357733 | 3300025781 | Freshwater | LVTLYGKKYNEALAIAKRLGDGMERQDAYRAGQYRQAVK |
| Ga0208644_12876823 | 3300025889 | Aqueous | LMANINGKYKEALILAKRLGDGLERQDAYRTGQVRDKVV |
| Ga0208644_13358661 | 3300025889 | Aqueous | IIGLYDNKFKEALVMAKRLGDGLERQDAYRSGQARMPVK |
| Ga0209929_11187973 | 3300026187 | Pond Water | LQLYNTKFNEGIQLAKRLGDGLERQDSYRSGQVRVPVT |
| Ga0255146_11149582 | 3300027396 | Freshwater | LYNQKYMEALALAKRLGDGMERQDAYRSGQFRQKVN |
| Ga0208788_10796312 | 3300027499 | Deep Subsurface | MKGETDMVTLYNTKYNEALALAKRLGDGMERTDSYRTGQVRVAVT |
| Ga0208974_10013071 | 3300027608 | Freshwater Lentic | FETDMMNLYNQKYMEAMALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0208974_11445691 | 3300027608 | Freshwater Lentic | GETDMMQLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0208975_10222691 | 3300027659 | Freshwater Lentic | YQKRYDEALAMAKRLGDGMERQDAYRSGQVRIAVT |
| Ga0208975_10832763 | 3300027659 | Freshwater Lentic | ALYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0209188_13142361 | 3300027708 | Freshwater Lake | LYDTKYKEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0209442_12532993 | 3300027732 | Freshwater Lake | GYDMKYKEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0209297_11636374 | 3300027733 | Freshwater Lake | GYNNKYMEALAMAKRLGDGMERQDAYRSGQYRQKVT |
| Ga0209190_10094328 | 3300027736 | Freshwater Lake | MMALYDGKYKEALMLAKRLGDGLERQDAYRSGQYRQAVT |
| Ga0209085_10658271 | 3300027741 | Freshwater Lake | GYTARYNEALALAKRLGDGLERQDAYRSGQVRIEVR |
| Ga0209189_10494365 | 3300027747 | Freshwater Lake | DMMQLYDGKYKEAVALAKRLGDGLERQDAYRSGQYRQTVT |
| Ga0209084_11179921 | 3300027749 | Freshwater Lake | AGTYQQRYMEALTLAKRLGDGMERRDAYRSGQVRAEVP |
| Ga0209084_12035521 | 3300027749 | Freshwater Lake | LIALYDGKYKEALTLAKRLADGMERQDAYRSGQYRQAVT |
| Ga0209084_13629042 | 3300027749 | Freshwater Lake | LYDTKYKEALALAKRLGDGMERQDAYRTGQYRQAVT |
| Ga0209296_11304641 | 3300027759 | Freshwater Lake | QLYEGKYKEALTLAKRLGDGLERQDAYRSGQYRQPVT |
| Ga0209296_13679902 | 3300027759 | Freshwater Lake | MKGETDMMNLYNQKYMEAMALAKRLGDGMERQDAYRSGQFRQRVT |
| Ga0209598_102428141 | 3300027760 | Freshwater Lake | MLALYDGKYKEALAQAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0209768_102711201 | 3300027772 | Freshwater Lake | IIAGYDMKYKEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0209353_101558254 | 3300027798 | Freshwater Lake | YNQKFMEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0209353_103678532 | 3300027798 | Freshwater Lake | LITLYNTKYNEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0209550_103687824 | 3300027892 | Freshwater Lake | YNTKYNEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0209636_108043801 | 3300027893 | Marine Sediment | LKGDAHLMTQYDNKYKEALLLAKRLGDGMERQDAYRSGQARIPVT |
| Ga0209777_104433071 | 3300027896 | Freshwater Lake Sediment | VALYNQKYTEALEQAKRLGDALERMDAYRSGQYRQAVT |
| Ga0209777_105962313 | 3300027896 | Freshwater Lake Sediment | LYDAKYKEAVAQAKRLGDALERQDAYRSGQYRQPVT |
| Ga0209536_1012358751 | 3300027917 | Marine Sediment | YDKKYQEALMMAKRMGDGMERQDAYRSGQYRQAVT |
| Ga0209191_10330566 | 3300027969 | Freshwater Lake | KGETDLVALYKQKYVEAIALAKRLGDGMERQDAYRSGQLRVEVS |
| Ga0209191_12568733 | 3300027969 | Freshwater Lake | AFYDKKYQDALMLAKRLGDGLERQDAYRSGQARVPVT |
| Ga0209298_100909205 | 3300027973 | Freshwater Lake | IITGYDMKYKEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0209702_100976454 | 3300027976 | Freshwater | ADMMQLYNAKYAEAMQLAKRLGDGLEKNDSYRTGQVQVPVN |
| Ga0255201_10074184 | 3300028086 | Freshwater | NYEKKYQEALMLAKRLGDGMEKQDQYRSGTPRVPVS |
| Ga0304728_11024483 | 3300028393 | Freshwater Lake | GEQDIIGLYDAKFKDAIILAKRLGDGMEKQDQYRSGQFRQQVT |
| Ga0304728_11814021 | 3300028393 | Freshwater Lake | YDIKYKEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0304728_12965541 | 3300028393 | Freshwater Lake | MALYNQKYMEALALAKRLGDGLERQDAYRSGQFRQAVT |
| Ga0119933_10436461 | 3300029932 | Drinking Water Treatment Plant | YEAKYKEALGLAKRLGDGLERQDAYRSGQVRYPVA |
| Ga0307380_102347484 | 3300031539 | Soil | DLLQLYELKYNQALALAKRLGDGLEKQDSYRSGQARVSVT |
| Ga0307376_105551263 | 3300031578 | Soil | EADIVAAYNKRYEEAMILAKRLGDGMERRDAYRSGQVRMTVN |
| Ga0307375_101496974 | 3300031669 | Soil | FMKGDTDMMQLYNGKYMEALQLAKRLGDGLEKNDSYRVGQPQVPVN |
| Ga0316219_12731722 | 3300031759 | Freshwater | DLMVFYDTKYKEALSQAKRLGDGLERMDSYRSGQYRQPVT |
| Ga0315900_104642531 | 3300031787 | Freshwater | ITGRYKEALALAKRLGDGLDRQDAYRSGQVRDKVV |
| Ga0315900_110154362 | 3300031787 | Freshwater | NYNKRYEEAMILAKRLGDGMDRRDAYRSGQIRMSVN |
| Ga0315274_114218793 | 3300031999 | Sediment | QLYNQKFMEALALAKRLGDGLERQDAYRSGQFRQAVT |
| Ga0315284_111858423 | 3300032053 | Sediment | TVYKAKYDEAVALAKRLGDGLERRDAYRSGQARVDVT |
| Ga0315277_108224851 | 3300032118 | Sediment | YDGKYKEAMGQLKRLGDGLERQDAYRSGQARVPVT |
| Ga0315268_122795672 | 3300032173 | Sediment | MKGENDMMALYNGKYQEALALAKRLGDGMERQDAYRSGQFRQAVT |
| Ga0335398_102403041 | 3300032435 | Freshwater | LLTLYNTKYNEALQLAKRLGDGLERQDSYRSGQVRIPVI |
| Ga0316223_10348811 | 3300032560 | Freshwater | YDKKYNEALAIAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0316223_12162292 | 3300032560 | Freshwater | KLYTDRYMEALALAKRLGDGMERTDAYRTGQYSQAVK |
| Ga0316222_11355083 | 3300032561 | Freshwater | FYDNKYKEALAIAKRLGDGLERQDAYRSGQTRIQPVP |
| Ga0316226_13859661 | 3300032562 | Freshwater | IYNQKYVEALALAKRLGDGMERRDAYRSGQFRQAVT |
| Ga0316232_10774811 | 3300032605 | Freshwater | LVALYDKKYVEAVQIAKRLGDGMERQDSYRSGQYRETVK |
| Ga0316232_13373071 | 3300032605 | Freshwater | DLVGLYNGKYTEALAQAKRLGDGLERQDAFRSGQYRQKVE |
| Ga0316225_11980212 | 3300032675 | Freshwater | MKGEADMVKLYTDRYMEALALAKRLGDGMERTDAYRTGQYSQAVK |
| Ga0316227_11876663 | 3300032677 | Freshwater | LYDKKYNEALAIAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0334722_102296764 | 3300033233 | Sediment | PEVLSTYQKRYDEALAMAKRLGDGMERQDAYRSGQVRIAVT |
| Ga0334994_0145231_5_142 | 3300033993 | Freshwater | MKGETDMMQLYNQKFMEALALAKRLGDGMERQDAYRSGQFRQKVT |
| Ga0334994_0410272_17_127 | 3300033993 | Freshwater | LYNTKYNEALALAKRLGDGMERQDAYRSGQYRQQVT |
| Ga0334995_0158958_22_159 | 3300034062 | Freshwater | MKGETDMMALYNQKFMEALALAKRLADGMERQDAYRSGQFRQKVT |
| Ga0335010_0695856_380_496 | 3300034092 | Freshwater | MAFYETKYKEALALAKRLGDGMERQDAYRSGQYRQPVT |
| Ga0335035_0709449_3_110 | 3300034105 | Freshwater | YNTKYTEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0335066_0505977_521_640 | 3300034112 | Freshwater | IVTLYDTKYKEALALAKRLGDGMERQDAYRSGQYRQAVT |
| Ga0335058_0765278_375_512 | 3300034121 | Freshwater | MKGEADIIALYDGKYKEALTLAKRLIDGLDRQDVYRSGQTRVPVT |
| Ga0335049_0079341_2272_2391 | 3300034272 | Freshwater | MLQLYNTKYQEALMLAKRLGDGMERQDAYRSGQYRQKVV |
| ⦗Top⦘ |