NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F017564

Metagenome / Metatranscriptome Family F017564

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017564
Family Type Metagenome / Metatranscriptome
Number of Sequences 240
Average Sequence Length 46 residues
Representative Sequence VRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSADPAGVRSV
Number of Associated Samples 206
Number of Associated Scaffolds 240

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 55.00 %
% of genes near scaffold ends (potentially truncated) 99.17 %
% of genes from short scaffolds (< 2000 bps) 97.08 %
Associated GOLD sequencing projects 203
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.833 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.417 % of family members)
Environment Ontology (ENVO) Unclassified
(30.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.167 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.67%    β-sheet: 0.00%    Coil/Unstructured: 58.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 240 Family Scaffolds
PF09851SHOCT 91.25
PF13396PLDc_N 0.83
PF08241Methyltransf_11 0.42
PF03724META 0.42
PF01804Penicil_amidase 0.42
PF00081Sod_Fe_N 0.42
PF01494FAD_binding_3 0.42
PF00884Sulfatase 0.42
PF01740STAS 0.42
PF07366SnoaL 0.42
PF13581HATPase_c_2 0.42
PF13483Lactamase_B_3 0.42
PF07394DUF1501 0.42
PF01957NfeD 0.42
PF00274Glycolytic 0.42

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 240 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.83
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.42
COG0605Superoxide dismutaseInorganic ion transport and metabolism [P] 0.42
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.42
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.42
COG2366Acyl-homoserine lactone (AHL) acylase PvdQSecondary metabolites biosynthesis, transport and catabolism [Q] 0.42
COG3187Heat shock protein HslJPosttranslational modification, protein turnover, chaperones [O] 0.42
COG3588Fructose-bisphosphate aldolase class 1Carbohydrate transport and metabolism [G] 0.42


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.83 %
UnclassifiedrootN/A39.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_81454All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300000955|JGI1027J12803_103325580All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300003369|JGI24140J50213_10248445All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300004633|Ga0066395_11033877All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300004643|Ga0062591_100855093All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300004798|Ga0058859_11589978All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300004801|Ga0058860_10004491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1022Open in IMG/M
3300004803|Ga0058862_12289173All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300005338|Ga0068868_101906004All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300005356|Ga0070674_100369500All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300005526|Ga0073909_10112829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1091Open in IMG/M
3300005530|Ga0070679_101498823All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005535|Ga0070684_100870666All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300005535|Ga0070684_101001888All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300005545|Ga0070695_100618994All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300005546|Ga0070696_101490793All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300005547|Ga0070693_100911302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300005564|Ga0070664_100840887All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300005614|Ga0068856_100465544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1285Open in IMG/M
3300005615|Ga0070702_100870002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300005713|Ga0066905_100273885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1311Open in IMG/M
3300005718|Ga0068866_10333541All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300005764|Ga0066903_103013747All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300005764|Ga0066903_106815301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales593Open in IMG/M
3300006049|Ga0075417_10347826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales726Open in IMG/M
3300006059|Ga0075017_100411307All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300006163|Ga0070715_10865466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300006175|Ga0070712_101632982All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300006196|Ga0075422_10039396All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300006576|Ga0074047_12000294All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300006846|Ga0075430_100017119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6172Open in IMG/M
3300006876|Ga0079217_11300480All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300006881|Ga0068865_100975584All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300006904|Ga0075424_101912645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia627Open in IMG/M
3300009093|Ga0105240_11003583Not Available892Open in IMG/M
3300009098|Ga0105245_11271947Not Available784Open in IMG/M
3300009100|Ga0075418_10779472Not Available1032Open in IMG/M
3300009101|Ga0105247_10808144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria716Open in IMG/M
3300009147|Ga0114129_11339649Not Available886Open in IMG/M
3300009147|Ga0114129_13256190Not Available526Open in IMG/M
3300009147|Ga0114129_13466990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300009148|Ga0105243_12204361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300009176|Ga0105242_11159153Not Available790Open in IMG/M
3300009792|Ga0126374_11163586Not Available615Open in IMG/M
3300009840|Ga0126313_10078967Not Available2382Open in IMG/M
3300010038|Ga0126315_10730978Not Available648Open in IMG/M
3300010041|Ga0126312_10021029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4360Open in IMG/M
3300010043|Ga0126380_11576479Not Available585Open in IMG/M
3300010045|Ga0126311_11599657Not Available548Open in IMG/M
3300010047|Ga0126382_10241285Not Available1317Open in IMG/M
3300010146|Ga0126320_1099574Not Available734Open in IMG/M
3300010146|Ga0126320_1270089Not Available533Open in IMG/M
3300010147|Ga0126319_1335060Not Available948Open in IMG/M
3300010154|Ga0127503_10027668Not Available957Open in IMG/M
3300010154|Ga0127503_10855610Not Available944Open in IMG/M
3300010154|Ga0127503_10931311Not Available845Open in IMG/M
3300010166|Ga0126306_10107795All Organisms → cellular organisms → Bacteria → Terrabacteria group2022Open in IMG/M
3300010166|Ga0126306_11200824Not Available623Open in IMG/M
3300010166|Ga0126306_11352411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300010359|Ga0126376_11719012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300010360|Ga0126372_12100123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
3300010361|Ga0126378_13152994Not Available525Open in IMG/M
3300010371|Ga0134125_10968819Not Available933Open in IMG/M
3300010371|Ga0134125_11626003Not Available703Open in IMG/M
3300010396|Ga0134126_11905676Not Available651Open in IMG/M
3300010399|Ga0134127_13300873Not Available528Open in IMG/M
3300010400|Ga0134122_10393533Not Available1221Open in IMG/M
3300010400|Ga0134122_11649080Not Available667Open in IMG/M
3300010403|Ga0134123_10729139Not Available974Open in IMG/M
3300011119|Ga0105246_10328119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella multipartita → Nakamurella multipartita DSM 442331246Open in IMG/M
3300011398|Ga0137348_1032651Not Available851Open in IMG/M
3300011415|Ga0137325_1010964All Organisms → cellular organisms → Bacteria1773Open in IMG/M
3300012212|Ga0150985_107753651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300012378|Ga0134025_1107701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2626Open in IMG/M
3300012469|Ga0150984_107274000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1116Open in IMG/M
3300012469|Ga0150984_112872045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300012481|Ga0157320_1035637Not Available520Open in IMG/M
3300012496|Ga0157353_1031422Not Available568Open in IMG/M
3300012519|Ga0157352_1081067Not Available543Open in IMG/M
3300012905|Ga0157296_10185241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria652Open in IMG/M
3300012907|Ga0157283_10294902Not Available560Open in IMG/M
3300012908|Ga0157286_10474833Not Available502Open in IMG/M
3300012911|Ga0157301_10348950Not Available557Open in IMG/M
3300012914|Ga0157297_10328065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2587Open in IMG/M
3300012948|Ga0126375_10585781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria849Open in IMG/M
3300012960|Ga0164301_10876492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2694Open in IMG/M
3300012961|Ga0164302_11747353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300012987|Ga0164307_10191133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-21386Open in IMG/M
3300012987|Ga0164307_10326098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1105Open in IMG/M
3300012987|Ga0164307_10368227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-21049Open in IMG/M
3300013096|Ga0157307_1104171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300013296|Ga0157374_10229520Not Available1823Open in IMG/M
3300013297|Ga0157378_10668162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1056Open in IMG/M
3300014259|Ga0075311_1100746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2617Open in IMG/M
3300014267|Ga0075313_1021145Not Available1477Open in IMG/M
3300014271|Ga0075326_1192542Not Available610Open in IMG/M
3300014272|Ga0075327_1102808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2866Open in IMG/M
3300014310|Ga0075331_1193029Not Available514Open in IMG/M
3300014745|Ga0157377_10854392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300015077|Ga0173483_10104672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1185Open in IMG/M
3300015200|Ga0173480_10044076Not Available1981Open in IMG/M
3300015201|Ga0173478_10148380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2929Open in IMG/M
3300015371|Ga0132258_12718302Not Available1234Open in IMG/M
3300015372|Ga0132256_101274280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria848Open in IMG/M
3300015373|Ga0132257_101186093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria966Open in IMG/M
3300015374|Ga0132255_102070256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria867Open in IMG/M
3300016319|Ga0182033_11844147Not Available549Open in IMG/M
3300017792|Ga0163161_11145087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria670Open in IMG/M
3300017947|Ga0187785_10459097Not Available626Open in IMG/M
3300017965|Ga0190266_10130938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-21092Open in IMG/M
3300017965|Ga0190266_11184050Not Available528Open in IMG/M
3300018032|Ga0187788_10372296Not Available595Open in IMG/M
3300018054|Ga0184621_10144108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2857Open in IMG/M
3300018054|Ga0184621_10261788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2615Open in IMG/M
3300018073|Ga0184624_10185184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2925Open in IMG/M
3300018073|Ga0184624_10377998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2632Open in IMG/M
3300018075|Ga0184632_10228099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2817Open in IMG/M
3300018076|Ga0184609_10300624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300018078|Ga0184612_10191080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1066Open in IMG/M
3300018432|Ga0190275_10610080Not Available1140Open in IMG/M
3300018469|Ga0190270_12686194Not Available560Open in IMG/M
3300018476|Ga0190274_10771355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1015Open in IMG/M
3300018476|Ga0190274_13721376Not Available516Open in IMG/M
3300018481|Ga0190271_11906095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300019233|Ga0184645_1146566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300019263|Ga0184647_1280119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2915Open in IMG/M
3300019361|Ga0173482_10282740All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300019869|Ga0193705_1089371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300020002|Ga0193730_1175606Not Available544Open in IMG/M
3300020069|Ga0197907_11212273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1064Open in IMG/M
3300021073|Ga0210378_10162101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-2861Open in IMG/M
3300021560|Ga0126371_13918037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300022195|Ga0222625_1782206Not Available633Open in IMG/M
3300022756|Ga0222622_10420982All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300022756|Ga0222622_11441086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300022883|Ga0247786_1150069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300024331|Ga0247668_1040477All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300025386|Ga0208585_1001385Not Available1930Open in IMG/M
3300025898|Ga0207692_10205639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus1160Open in IMG/M
3300025926|Ga0207659_11668036Not Available543Open in IMG/M
3300025927|Ga0207687_10418520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1105Open in IMG/M
3300025927|Ga0207687_10858128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus776Open in IMG/M
3300025931|Ga0207644_10831461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria773Open in IMG/M
3300025944|Ga0207661_10450988All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300025949|Ga0207667_11826751All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300025960|Ga0207651_10467010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1085Open in IMG/M
3300025961|Ga0207712_11455509Not Available613Open in IMG/M
3300026035|Ga0207703_12281575Not Available517Open in IMG/M
3300026075|Ga0207708_10244762All Organisms → cellular organisms → Bacteria1443Open in IMG/M
3300026089|Ga0207648_11103883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria744Open in IMG/M
3300026121|Ga0207683_10285084Not Available1510Open in IMG/M
3300026121|Ga0207683_10412849All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300027209|Ga0209875_1002703All Organisms → cellular organisms → Bacteria2239Open in IMG/M
3300027909|Ga0209382_10843021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria971Open in IMG/M
(restricted) 3300027970|Ga0247837_1149758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1038Open in IMG/M
3300028587|Ga0247828_10292762Not Available894Open in IMG/M
3300028592|Ga0247822_11714474Not Available535Open in IMG/M
3300028592|Ga0247822_11889556Not Available511Open in IMG/M
3300028679|Ga0302169_10130335Not Available623Open in IMG/M
3300028715|Ga0307313_10111910All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300028721|Ga0307315_10006919Not Available2772Open in IMG/M
3300028722|Ga0307319_10254991Not Available578Open in IMG/M
3300028722|Ga0307319_10274061Not Available557Open in IMG/M
3300028732|Ga0302264_1023331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1424Open in IMG/M
3300028733|Ga0302261_1097177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae696Open in IMG/M
3300028744|Ga0307318_10299616Not Available563Open in IMG/M
3300028754|Ga0307297_10130549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria846Open in IMG/M
3300028755|Ga0307316_10268093Not Available622Open in IMG/M
3300028764|Ga0302260_1043817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria925Open in IMG/M
3300028771|Ga0307320_10035751Not Available1815Open in IMG/M
3300028771|Ga0307320_10133592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria955Open in IMG/M
3300028778|Ga0307288_10051364All Organisms → cellular organisms → Bacteria1420Open in IMG/M
3300028782|Ga0307306_10018666All Organisms → cellular organisms → Bacteria1560Open in IMG/M
3300028784|Ga0307282_10188201All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300028802|Ga0307503_10595420Not Available609Open in IMG/M
3300028809|Ga0247824_10307199Not Available894Open in IMG/M
3300028828|Ga0307312_11007563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300028870|Ga0302254_10122036Not Available954Open in IMG/M
3300028870|Ga0302254_10127504Not Available933Open in IMG/M
3300028872|Ga0307314_10316610Not Available501Open in IMG/M
3300028876|Ga0307286_10098027All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300028880|Ga0307300_10132442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria773Open in IMG/M
3300028880|Ga0307300_10332221Not Available520Open in IMG/M
3300028889|Ga0247827_10142815Not Available1261Open in IMG/M
3300030052|Ga0302217_10040187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1015Open in IMG/M
3300030336|Ga0247826_10091760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1860Open in IMG/M
3300030339|Ga0311360_11032185Not Available649Open in IMG/M
3300030552|Ga0247654_1021324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales872Open in IMG/M
3300030620|Ga0302046_11131203Not Available618Open in IMG/M
3300030829|Ga0308203_1025481All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300030838|Ga0311335_10155018All Organisms → cellular organisms → Bacteria1511Open in IMG/M
3300030902|Ga0308202_1061964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria709Open in IMG/M
3300030902|Ga0308202_1117659Not Available565Open in IMG/M
3300030903|Ga0308206_1131211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300030905|Ga0308200_1092525Not Available633Open in IMG/M
3300030905|Ga0308200_1184218Not Available501Open in IMG/M
3300030988|Ga0308183_1035905All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300030990|Ga0308178_1026353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria962Open in IMG/M
3300030993|Ga0308190_1038454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria877Open in IMG/M
3300030993|Ga0308190_1084901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria671Open in IMG/M
3300031094|Ga0308199_1038566All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300031094|Ga0308199_1054720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300031100|Ga0308180_1022788Not Available618Open in IMG/M
3300031114|Ga0308187_10037632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1263Open in IMG/M
3300031123|Ga0308195_1014293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300031124|Ga0308151_1020966Not Available675Open in IMG/M
3300031170|Ga0307498_10124613All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300031422|Ga0308186_1020554Not Available635Open in IMG/M
3300031548|Ga0307408_102450950Not Available507Open in IMG/M
3300031564|Ga0318573_10632342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300031720|Ga0307469_12528988Not Available502Open in IMG/M
3300031781|Ga0318547_10527944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria730Open in IMG/M
3300031852|Ga0307410_10978972Not Available728Open in IMG/M
3300031903|Ga0307407_11205509Not Available591Open in IMG/M
3300031908|Ga0310900_11486926Not Available571Open in IMG/M
3300031911|Ga0307412_10241128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1398Open in IMG/M
3300031912|Ga0306921_11591331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria711Open in IMG/M
3300031918|Ga0311367_10311487Not Available1632Open in IMG/M
3300031995|Ga0307409_101123595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria807Open in IMG/M
3300032004|Ga0307414_10836446All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300032043|Ga0318556_10335414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300032126|Ga0307415_100747392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria887Open in IMG/M
3300032164|Ga0315283_11037809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria866Open in IMG/M
3300032177|Ga0315276_11114293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria835Open in IMG/M
3300032276|Ga0316188_10353734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300032783|Ga0335079_10604519Not Available1156Open in IMG/M
3300033408|Ga0316605_11539617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300033433|Ga0326726_11894063Not Available581Open in IMG/M
3300033550|Ga0247829_10013198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4943Open in IMG/M
3300033551|Ga0247830_10432615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1028Open in IMG/M
3300034659|Ga0314780_041319All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300034659|Ga0314780_076509Not Available723Open in IMG/M
3300034660|Ga0314781_148090Not Available507Open in IMG/M
3300034662|Ga0314783_031808All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300034664|Ga0314786_015185All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300034664|Ga0314786_147737Not Available547Open in IMG/M
3300034666|Ga0314788_032338Not Available948Open in IMG/M
3300034666|Ga0314788_089221Not Available677Open in IMG/M
3300034678|Ga0314803_024037Not Available927Open in IMG/M
3300034678|Ga0314803_079601Not Available614Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.33%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.92%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.08%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.08%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.67%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.67%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.25%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.25%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.83%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.83%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.83%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.42%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.42%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.42%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.42%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.42%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.42%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.42%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.42%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.42%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.42%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003369Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22AEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010146Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011398Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2EnvironmentalOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012378Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012496Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610EnvironmentalOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014259Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1EnvironmentalOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014310Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019233Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025386Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027209Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028679Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028732Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4EnvironmentalOpen in IMG/M
3300028733Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028764Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_4EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028870Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030052Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030552Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031100Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031123Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031124Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031422Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034660Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034662Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034666Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034678Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_011702002199352025SoilMAEPYSRLAGVYDEIVVDPCHEAWASYLHDRWRGDPDGVHTVLDLCCG
JGI1027J12803_10332558013300000955SoilVDEAEPYARLADVYDEVVVDPCYDRWAAYLHELWSSDHDGVQTVLDVCCGTG
JGI24140J50213_1024844513300003369Arctic Peat SoilVTAVEAYSRLAGIYNEIVVDPCYDRWATFLHELWHSDDAGVHDVLDVCC
Ga0066395_1103387713300004633Tropical Forest SoilVIPVEAYSRLAGVYDEIVVDPCHGAWASFLHELWRDDENGVHRVLDVCCGTGLL
Ga0062591_10085509313300004643SoilVRPVDAYTRLAGVYDEAVVDPCHGALARFLDELFAADDEAVAGVLDV
Ga0058859_1158997813300004798Host-AssociatedVKPVEAYSRLAGIYDEVVIDPCHGQWASYLHALWSADPEGVRTVLDVCCGTGLLAS
Ga0058860_1000449133300004801Host-AssociatedVKPVEAYSRLAGIYDEVVIDPCHGQWASYLHALWSADPEGVR
Ga0058862_1228917313300004803Host-AssociatedMTVDEAEPYTRLAAVYDEIVVDPCHRAWASYLHELWAGDPAHVRCVLDLGCGTGLMA
Ga0068868_10190600423300005338Miscanthus RhizosphereVTVDGAEPYTRLAAVYDEIVVDPCHRAWASYLHELWAGDPAHVHCVLDLGCG
Ga0070674_10036950043300005356Miscanthus RhizosphereVRPVDAYTRLAGVYDEVVVDPCHADWAGFLDGLFEGDEDGVSDVLDVCCGTGLLAAELAARG
Ga0073909_1011282933300005526Surface SoilVRPVDAYTRLAGVYDEAVVDPCHGALAGFLDELFAAGEEAVAFVLD
Ga0070679_10149882313300005530Corn RhizosphereVKPVEAYSRLAGIYDEVVIDPCHGQWASYLHALWSADPEGVRTVLDVCCG
Ga0070684_10087066633300005535Corn RhizosphereVSEAAEHEAAPYSRLAGVYDEMVVDSCHGRWAAHLDELWRADSHSVRTVLDLCCGT
Ga0070684_10100188833300005535Corn RhizosphereVRPVDAYTRLAGVYDEVVVDPCHADWAGFLDGLFEGDEEGVSDVLDVCCGTGLLAAE
Ga0070695_10061899433300005545Corn, Switchgrass And Miscanthus RhizosphereVRPVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADPDGVRSVL
Ga0070696_10149079313300005546Corn, Switchgrass And Miscanthus RhizosphereVRPVENYTRLAGVYDEVVVDPCHGAWAEFLDELFGTDEAGVTDVLDVCCGTGLLAAELTA
Ga0070693_10091130233300005547Corn, Switchgrass And Miscanthus RhizosphereVKPVEAYSRLAGIYDEVVIDPCHGQWASYLHALWSADPEGV
Ga0070664_10084088733300005564Corn RhizosphereVDEAEPYARLAAVYDEIVVDPCHRVWATYLHELWVDDPAQVHSVLDLGC
Ga0068856_10046554443300005614Corn RhizosphereVRPVEAYTRLAGVYDEAVVDPCHDALAAFLDELFGADE
Ga0070702_10087000213300005615Corn, Switchgrass And Miscanthus RhizosphereVDEAEPYARLAAVYDEIVVDPCHRVWASYLHELWVSDPAQVH
Ga0066905_10027388513300005713Tropical Forest SoilVRQVEAYTRLAGVYDEIVVDPCHGAWASFLHELWSEDGHGVQTVLDVCCGTGLL
Ga0068866_1033354133300005718Miscanthus RhizosphereVRQVEAYSRLAGVYDEIVVDPCHGRLASYFEELWGADPAGVR
Ga0066903_10301374713300005764Tropical Forest SoilVSEVEAYTRLAGVYDEIVIDPCHGAWASFLDRLWGEGDDVHDVLDVCCG
Ga0066903_10681530133300005764Tropical Forest SoilVGQVDAYTSLAGVYDELVVDPCHGAWAAFLDELWSDDEHGVHDVLDVCCGTGLLAGEL
Ga0075417_1034782633300006049Populus RhizosphereVRQVEAYSRLAGLYDEIVIDPCHDRCASYLDELWSDDADGVRSVLD
Ga0075017_10041130733300006059WatershedsVSAAEAYSRLAGVYDEIVVDPCHRSWAGFLDELWSSDESGVRSVLDVCCGTGLLAAELV
Ga0070715_1086546613300006163Corn, Switchgrass And Miscanthus RhizosphereVRPVDAYTRLAGVYDEAVVDPCHDALAAFLDELFGADEEAVAGVLDVCCGTGLL
Ga0070712_10163298223300006175Corn, Switchgrass And Miscanthus RhizosphereVRANEAEPYARLAAVYDEIVVDPCHRAWASYLHDLWTSDQAGVRRVLDLGCGTG
Ga0075422_1003939613300006196Populus RhizosphereVAQVEAYTRLAGVYDEIVVDPCHGAWASFLHELWSDDEHGVH
Ga0074047_1200029423300006576SoilVRANEAEPYARLAGVYDEIVVDPCHRVWASYLHDLWTSDPAEVHSVLDLGWGLP*
Ga0075430_10001711913300006846Populus RhizosphereVRHAEAYSRLAGVYDEIVVDPCHGRCAAFLHDLWSA
Ga0079217_1130048023300006876Agricultural SoilVRHVEAYSRLAGVYDEIVVDPCHGHWASFLDELWNTDRDGVRAVLDLCCGTGLLAE
Ga0068865_10097558433300006881Miscanthus RhizosphereVRPVDVYTRLAGVYDEVVVDPCHSALAEFLDELFDADNEKVADVLDVCCGTGLLA
Ga0075424_10191264533300006904Populus RhizosphereVRHAEAYSRLAGVYDEIVVDPCHDRWASFLDDLWSADPEGVCSVLDLCCGTG
Ga0105240_1100358313300009093Corn RhizosphereVRHAEAYSRLAGVYDELVIDPCHDRWASFLDDLWSADPAGVHSV
Ga0105245_1127194713300009098Miscanthus RhizosphereVRPVDAYTRLAGVYDEAVVDPCHGALARFLDELFAADDEAVAGVLDVCCGTG
Ga0075418_1077947213300009100Populus RhizosphereVRQVEAYSRLAGLYDEIVIDPCHDRCASYLHELWSDDADGVRS
Ga0105247_1080814413300009101Switchgrass RhizosphereVRPVDAYTRLAGVYDEFVVDPCHDAIAAFLDLLWAGDVHDVLDVA
Ga0114129_1133964913300009147Populus RhizosphereVSHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVL
Ga0114129_1325619033300009147Populus RhizosphereVGHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTD
Ga0114129_1346699013300009147Populus RhizosphereVTQVEAYSRLAGVYDEMVVDPCHGRLASYFDELWGADTAGVRSVLDLG
Ga0105243_1220436133300009148Miscanthus RhizosphereMRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSADADGVRSVLDL
Ga0105242_1115915333300009176Miscanthus RhizosphereVRPVEAYTRLAGVYDEAVVDPCHEALAAFLDQLFGADE
Ga0126374_1116358633300009792Tropical Forest SoilLGQFEAYTRLAGVYDEIVVDPYHGAWASFLHDLWSDDERGVHT
Ga0126313_1007896713300009840Serpentine SoilVTQVEPYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPQGVRS
Ga0126315_1073097813300010038Serpentine SoilVQHVEAYSRLAEVYDEIVIDPCHDRWASFLHELWSTDP
Ga0126312_1002102983300010041Serpentine SoilVRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDP
Ga0126380_1157647913300010043Tropical Forest SoilVRTDDAYTRLAGVYDEVVVDPCHGALAGFLDELFRADEQAVAEVLDVCCGT
Ga0126311_1159965713300010045Serpentine SoilVRRAEAYSQLAGVYDEIVIDPCHDRWASFLDELWSADAAGVRSVLDLCCGT
Ga0126382_1024128543300010047Tropical Forest SoilVRQVEAYTRLAGVYDEIVIDPCHDRCATYLHELWSDDEDGVRSVLDLCCG
Ga0126320_109957413300010146SoilVRVNEAEPYTRLAAVYDEIVVDPCHREWASFLHELWVSDPAQVHTV
Ga0126320_127008913300010146SoilVPHAEAYSRLAGVYDEIVIDPCHDRWASYLHELWSTDPEGVRSVL
Ga0126319_133506033300010147SoilVSQVEAYTRLAGVYDEIVVDPCHGAWASFLDELWSDDEHGVHDVLDVCCG
Ga0127503_1002766833300010154SoilVKPVEAYSRLASVYDEVVIDPCHGNWAGFLDEIWRADPQGVSSVLDLCCGT
Ga0127503_1085561013300010154SoilVRRVEAYSRLAGLYDEIVIDPCHDRWASFLHELWSADADGVRSVLDLCCGTG
Ga0127503_1093131133300010154SoilVRTVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSA
Ga0126306_1010779513300010166Serpentine SoilVGQVEAYTRLAGVYDEIVVDPCHGAWASFLHELWRDDEHGVRNVLDVCCGTGLLAGELAALG
Ga0126306_1120082413300010166Serpentine SoilMRNVAAYSRLAGIYDEIVIDPCHDRWASFLHEVWSADPVGVRS
Ga0126306_1135241133300010166Serpentine SoilMSNVAAYSRLAGVYDEIVIDPCHDRWASFLHDLWSADPEGVRSVLDL
Ga0126376_1171901233300010359Tropical Forest SoilVSQVEAYTRLAGVYDEIVVDPCHGAWAAFLDDLWRDDDVRDVLDVCCGTGLLAAELLALG
Ga0126372_1210012333300010360Tropical Forest SoilVDQAEAYTRLAGVYDEIVVDPCHGAWASFLHELWSGDGYGVHDVFDVCCGTGLLAGELV
Ga0126378_1315299413300010361Tropical Forest SoilVRPVEAYTQLAGVYDEVVVDPCHGALAGFLHELFAADEEVVAGVVDV
Ga0134125_1096881913300010371Terrestrial SoilVRQVEAYTRLAGVYDEVVVDPCHGAWAGFLDELFGTDETGVTDVLDVCCGTGLL
Ga0134125_1162600333300010371Terrestrial SoilVRPVEAYTRLAGVYDEAVVDPCHGALAAFLDELFGA
Ga0134126_1190567633300010396Terrestrial SoilVTVDGAEPYTRLAAVYDEIVVDPCHRAWASYLHELWAGDPAHVLCVL
Ga0134127_1330087313300010399Terrestrial SoilVGQVDAYTRLAGVYDEIVVDPCHGAWASFLHELWSADERGVQNVLDVCCGT
Ga0134122_1039353333300010400Terrestrial SoilVRHVEAYSRLAGIYDEVVIDPCHERWASFLDGLWSADP
Ga0134122_1164908013300010400Terrestrial SoilVSHVEAYSRLAGVYDEIVVDPCHGRWASFLHELWSADPEGVRSVLDL
Ga0134123_1072913933300010403Terrestrial SoilVSQVEAYSRLAGVYDEIVVDPCHDRWASFLDELWSADAEGVRSVLDLCCGT
Ga0105246_1032811913300011119Miscanthus RhizosphereVDEAEPYARLAAVYDEIVVDPCHRVWATYLHELWVDDPAQVHSVLDLG
Ga0137348_103265113300011398SoilVSHVAAYSRLAGVYDEIVIDPCHDRWASFLHEVWSADPAGVRS
Ga0137325_101096443300011415SoilVNQFEAYTRLAGVYDEIVVDPCHDRLAAFLHELWSSDEEGVRSVLDLCCGSG
Ga0150985_10775365133300012212Avena Fatua RhizosphereMAQVEAYSRLAGVYDEVVADPCHDAWASFLDELWSDDEDGVRDVLDVCCGTGLLA
Ga0134025_110770133300012378Grasslands SoilVRQVEAYSRLAGVYDEIVIDPCHDRWAAFLHELWSTD
Ga0150984_10727400013300012469Avena Fatua RhizosphereVRPVEAYSRLAGVYDEVVIDPCHGTWASFLHEFWSADPQGGRSGLDPCFGTRLPARGLVEGGERLRGARGPPAN
Ga0150984_11287204513300012469Avena Fatua RhizosphereVRQVEAYSRLAGIYDEIVIDPCHGTWAAFLDALWSADPEGVHAVLDVCCG
Ga0157320_103563733300012481Arabidopsis RhizosphereVRPVDAYTRLAGVYDEAVVDPCHGALAGFLAELFGADE
Ga0157353_103142233300012496Unplanted SoilVDAYTRLAGVYDEVVVDPCHGALAGFLDELFGAGDEGVADVLDVGCG
Ga0157352_108106723300012519Unplanted SoilVDAYTRLAGVYDEVVVDPCHGAVAEFLEELFGAGEEAVARVLDVCCGTGLLAAELVARGY
Ga0157296_1018524113300012905SoilVRPVDAYTRLAGVYDEVVVDPCHADWAGFLDGLFEGD
Ga0157283_1029490233300012907SoilVTHVEAYSRLARVYDEIVIDPCHDRWASFLHELWSTD
Ga0157286_1047483313300012908SoilVRHVEAYSRLAGVYDEIVVDPCHDRWASFLDELWNGDSE
Ga0157301_1034895013300012911SoilVRQVEAYSRLAGVYDEIVIDPCHDRSASFLHELWGADPVGVR
Ga0157297_1032806513300012914SoilVRQVEAYSRLAGVYDEIVIDPCHDRPASFLHELWSADPVG
Ga0126375_1058578113300012948Tropical Forest SoilVRPVDAYTRLAGVYDEAVVDPCHGDLAGFLDELFGVDEGAVADV
Ga0164301_1087649213300012960SoilVRSVEAYSRLAAVYDEIVIDPGHDQWASFLHGQWR
Ga0164302_1174735313300012961SoilMTVEAYSRLAGVYDQIVVDPCHGRWAGFLDELWRKDEHDVHSV
Ga0164307_1019113333300012987SoilVTVDEAEPYTRLAAVYDEIVVDPCHRAWASYLHELWAGDPAHVRCVLDLGCG
Ga0164307_1032609833300012987SoilVTQVEAYTRLAGVYDEIVIDPCHDRWASFLHELWSTDPQGVRSVL
Ga0164307_1036822713300012987SoilVTEVEAYSRLAGVYDEIVVDPCYDRWACFLHERWQSDKAGVNAVMDVCCGTG
Ga0157307_110417113300013096SoilVRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSADPAGVRSV
Ga0157374_1022952013300013296Miscanthus RhizosphereVRTVEAYSRLAAVYDEIVTDPCHDRWASFLQEQWRTDPAGVRLVLDLCCGT
Ga0157378_1066816213300013297Miscanthus RhizosphereVSQVEAYSRLAGVYDEIVVDPCHDRWASFLDELWSA
Ga0075311_110074613300014259Natural And Restored WetlandsMGHVEAYSRLAGVYDEIVVDPCHDRWASFLHELWSADAEGVCS
Ga0075313_102114513300014267Natural And Restored WetlandsVRHVEAYSRLAGVYDDIVVDPCHAHWASFLHELWSADPEGVRSVLD
Ga0075326_119254213300014271Natural And Restored WetlandsVRHVEAYSRLAGVYDEIVVDPCHDRYASFLHELWNADAKGVCSVLDLCC
Ga0075327_110280833300014272Natural And Restored WetlandsMRHVEAYSRLAGVYDEIVVDPCHDRYASFLHGLWSADAAGVCSVLDLCCGT
Ga0075331_119302913300014310Natural And Restored WetlandsVRDVEAYSRLAGVYDDIVVDPCHAHWAWFLDELWRADPEGVR
Ga0157377_1085439213300014745Miscanthus RhizosphereVAHVEAYSRLAGVYDEIVIDPCHESWASFLHELWSADSVGVRSVLDLGCGTG
Ga0173483_1010467243300015077SoilVRHVEAYSELAGVYDEIVIDPCHDRWASFLHELWSADEEGVESVLD
Ga0173480_1004407613300015200SoilVNVAAYSRLAGVYDEIVIDPCHDRWASFLDELWSAD
Ga0173478_1014838033300015201SoilVNVAAYSRLAGVYDEIVIDPCHDRWASFLDELWSADPGGVRSVLDL
Ga0132258_1271830213300015371Arabidopsis RhizosphereVSQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWGAAPKGVRSVLDLWCGTGLLAGEL
Ga0132256_10127428013300015372Arabidopsis RhizosphereVRHVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADPDG
Ga0132257_10118609333300015373Arabidopsis RhizosphereVSEVEAYTRLAGVYDEIVVDPCHGAWASFLDDLWAADE
Ga0132255_10207025613300015374Arabidopsis RhizosphereVRPVEAYTRLAAVYDEVVVDACHGTWASFLDELWSADPQGVRSVLDVCCGTGLLARELID
Ga0182033_1184414713300016319SoilVRPVEAYSRLAGVYDEIVVDPCHGALAGFLDELFAADEEAVAGVL
Ga0163161_1114508733300017792Switchgrass RhizosphereVRPVDAYTRLAGVYDEAVVDPCHGALAGFLAELFGADEE
Ga0187785_1045909713300017947Tropical PeatlandVRPVDAYTRLAGVYDEIVVDPCHDAVAGFLDELFGGDETAVSEVLDV
Ga0190266_1013093813300017965SoilMRHVEAYSQLAGVYDEIVVDPCHDRWASFLHELWAPTRRA
Ga0190266_1118405023300017965SoilVRHAEAYSRLAGVYDEIVVDPCHDRWAAVLHDLWSA
Ga0187788_1037229633300018032Tropical PeatlandVRPVDAYTRLAEIYDSVVVDPCHAAVAGFLDELFGADEESV
Ga0184621_1014410833300018054Groundwater SedimentVRHVEAYSRLAGLYDEIVIDPCHDRRASYLHELWSADADGV
Ga0184621_1026178833300018054Groundwater SedimentVRPVEAYSRLAAVYDEIVVDPCHGRWAAFLDELWTADPAGV
Ga0184624_1018518413300018073Groundwater SedimentVRPVEAYSRLAAVYDEIVVDPCHGRWAKFLDELWTADPAGVRSIL
Ga0184624_1037799813300018073Groundwater SedimentVRHVEAYSRLAEVYDEIVVDPCHDRWASFLHEHWSAD
Ga0184632_1022809913300018075Groundwater SedimentVGQVEAYSRLAGVYDEIVIDPCHDHWASFLDELWSADPVGVRSVL
Ga0184609_1030062413300018076Groundwater SedimentVAHVEAYSRLAGVYDEIVVDPCHDRWASFLHELWSADPEGVGSV
Ga0184612_1019108013300018078Groundwater SedimentVRHVEAYSRLAGIYDEIVIDPCHDQWASFLHELWGADPEGVRC
Ga0190275_1061008043300018432SoilVRHVEAYSRLAGVYDEIVVDPCYDRWASFLHELWSTDANGVHSVLDLCCGTGLLAD
Ga0190270_1268619413300018469SoilVRHAEAYSRLAGVYDEIVVDPCHDRWAAFFHDLWSADPEGVRSVLDLCCGTG
Ga0190274_1077135533300018476SoilVRHVEAYSRLAGVYDEVVIDPCHGRWASFLHELWSTDPEGVRTVLDLGCGT
Ga0190274_1372137633300018476SoilVRQAEPYSRLAGVYDEIVTDPCHDRLAAFLHELWS
Ga0190271_1190609513300018481SoilVRQVEAYTGLAGLYDEIVVDPCHDRWAAFLDQLWSADPDGVTSVLDLCCGTGLLAGEL
Ga0184645_114656613300019233Groundwater SedimentVRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWG
Ga0184647_128011933300019263Groundwater SedimentVRNVAAYSRLAGVYDEIVVDPCFALWATYLDAAWAGDPRRVHRVLDVCCGTGLMAAELL
Ga0173482_1028274033300019361SoilVTHVESYSRLAAVYDEMVVDDAYPQWASFLHELWRHDERGVEDVLDVCCGTGLMAYELM
Ga0193705_108937133300019869SoilVRDVEAYSRLAGFYDEIVIDPCHDRWASFLHELWSADPEGVRFVLDLCC
Ga0193730_117560633300020002SoilVRPVEAYSRLAAVYDEIVVDPCHGRWAAFLDELWTADPAGVRSVLDLCC
Ga0197907_1121227333300020069Corn, Switchgrass And Miscanthus RhizosphereLGSVAAYSRLAGVYDEIVVDPCHGRWAAFLEELWQADDPGVHSVL
Ga0210378_1016210113300021073Groundwater SedimentVQHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWRADPAG
Ga0126371_1391803723300021560Tropical Forest SoilVRPVEAYSRLAGVYDEIVVDPCHGRWAAFLDELWDVSVRTVLDLCCGTGLLAAELVALGYRV
Ga0222625_178220613300022195Groundwater SedimentVRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPE
Ga0222622_1042098213300022756Groundwater SedimentVRQVKAYSRLAGLYDEIVIDPCHDRRASYLHELWSADADGVRSVLDLCCGTGLLAGE
Ga0222622_1144108613300022756Groundwater SedimentVRQVESYSRLAGLYDEIVVDPCHDRWASFLHELWSADAEGVRSVLDLCCGTGLLAGELI
Ga0247786_115006933300022883SoilVRHVEAYSRLAGVYDEIVIDPCHGRWASFLHERWSTDPDGVRSVLDLCCGTG
Ga0247668_104047713300024331SoilVIQVEAYTRLAGVYDEIVVDPCHGAWASFLDDLWRDDEPGVRDVLDVC
Ga0208585_100138513300025386Arctic Peat SoilVTAVEAYSRLAGIYNEVVVDPCYDRWATFLHELWHSDDAGVHAVL
Ga0207692_1020563913300025898Corn, Switchgrass And Miscanthus RhizosphereVRANEAEPYARLAAVYDEIVVDPCHRAWASYLHDLWTSDQAGVRRVL
Ga0207659_1166803613300025926Miscanthus RhizosphereVRHVEAYSRLAGVYDEIVVDPCHDRWASFLHELWSSD
Ga0207687_1041852013300025927Miscanthus RhizosphereVKPVEAYSRLAGIYDEVVIDPCHGQWASYLHALWSADPEGVRTVLDVCCGTG
Ga0207687_1085812833300025927Miscanthus RhizosphereVDEAEPYARLAAVYDEIVVDPCHRVWASYLHELWVSDPAQVHNVLDL
Ga0207644_1083146133300025931Switchgrass RhizosphereVRPVGAYTRLAGVYDEAVVDPCHGALARFLDELFAADDEAVAG
Ga0207661_1045098833300025944Corn RhizosphereVAHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVIRLLGLWPETSNTEVR
Ga0207667_1182675113300025949Corn RhizosphereVRPVENYTRLAGVYDEVVVDPCHDAWASFLDELFRADDDAVRDVLDVCCGTGLLAAQLV
Ga0207651_1046701013300025960Switchgrass RhizosphereVRTVEAYSRLAAVYDEIVIDPCHERWASFLQEQWRTDPAGV
Ga0207712_1145550933300025961Switchgrass RhizosphereVRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSADAEGVRSVLDLCCGTGLLAGELIQ
Ga0207703_1228157513300026035Switchgrass RhizosphereVRPVDVYTRLAGVYDEVVVDPCHSALAGFLDELFDADEEKVADVLDV
Ga0207708_1024476243300026075Corn, Switchgrass And Miscanthus RhizosphereVRPVEAYSRLAGVYDEIVIDPCHDQWASFLPELWSADPDGV
Ga0207648_1110388333300026089Miscanthus RhizosphereVRHVEAYSRLAGVYDEIVVDPCHDRWASFLHELWSSDPESVGSVLDLGCGTGLL
Ga0207683_1028508413300026121Miscanthus RhizosphereVRTVEAYSRLAAVYDEIVIDPCHDRWASFLQEQWRTDPAGVRLVL
Ga0207683_1041284933300026121Miscanthus RhizosphereVRPVDAYTRLAGVYDEVVVDPCHADWAGFLDGLFEDDEDGVRDVLDVCCGTGLLA
Ga0209875_100270353300027209Groundwater SandVRHVEAYTRLAEVYDEIVIDPCHDRWASFLHELWSTDPEG
Ga0209382_1084302113300027909Populus RhizosphereMREVAAYSRLAGIYDEIVIDPCHDRWASFLDELWSADPGGVRSVLDLCCGT
(restricted) Ga0247837_114975833300027970FreshwaterVTPYSRLAGVYDEIVVDPCFSDWAQFLVDLWSGDHVSSVLDVC
Ga0247828_1029276213300028587SoilVRHVEAYSQLAGVYDEIVVDPCHDRWAAFLHELWTPD
Ga0247822_1171447413300028592SoilMRHVEAYSQLAGVYDEIVVDPCHGRWASFLHELWSADPEGVRSVLDLGCGTG
Ga0247822_1188955633300028592SoilVRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTD
Ga0302169_1013033533300028679FenVSGADPYTRLAAVYDEIVVDPCHGQWAGFLHEVWAADTEGVRTVLDVCCG
Ga0307313_1011191013300028715SoilVRDVEAYSRLAGFYDEIVIDPCHDRWASFLHELWSAD
Ga0307315_1000691943300028721SoilVRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSSDPEGVRS
Ga0307319_1025499133300028722SoilVAHVEPYSRLAGIYDEIVIDPCHDRWASFLHELWSTDPEGVRSVLDLCC
Ga0307319_1027406133300028722SoilVSHVAAYSRLAEVYDEIVIDPCHDRWASFLDELWSADPMGV
Ga0302264_102333133300028732FenVTAVEAYSRLAGIYDEIVVDLPSYDRWAAFLHELWHSDAAAVHAVLDVCC
Ga0302261_109717713300028733FenMVEAEAYSRLAGVYDEIVVDPSYRRWAQYLHELWSSD
Ga0307318_1029961633300028744SoilVQHVEPYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPQ
Ga0307297_1013054913300028754SoilVRVDEAEPYTRLAAVYDEIVVDPCHRAWASYLHELWISDPAQVRCVLDLGC
Ga0307316_1026809313300028755SoilVKQVEPYSRLAGVYDEIVIDPCHDRWASFLHELWSTDP
Ga0302260_104381713300028764FenVPAVRVTAVEAYSRLAGIYDEIVVDLPSYDRWAAFLHELWHSDAAAVHAVLDVCCGTG
Ga0307320_1003575143300028771SoilVRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVL
Ga0307320_1013359213300028771SoilVRQVEAYSRLAGLYDEIVVDPCHDRWASFLHQLWSAYAE
Ga0307288_1005136413300028778SoilVRDVEAYSRLAGFYDEIVIDPCHDRWASFLHELWSADPEGVRFVLDLCCG
Ga0307306_1001866643300028782SoilVAHVEAYSRLAGVYDEIVIDACHDRWASFLHELWSTDPEGVRSVLDLCC
Ga0307282_1018820133300028784SoilVRHVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADPD
Ga0307503_1059542013300028802SoilVRQVEAYSRLAGLYDEIVIDPCHDRRASYLHELWSADADGVRSVLDLCCGTGLLAGE
Ga0247824_1030719913300028809SoilMRHVEAYSQLAGVYDEIVVDPCHGRWASFLHELWSADPEGVRS
Ga0307312_1100756333300028828SoilVRHAEAYSRLAGVYDELVVDPCHDRWASFLHDLWSDDPEGVRSVLDLCCGT
Ga0302254_1012203613300028870FenVSGADPYTRLAAVYDEIVVDPCHGQWAGFLHEVWAADTEGVRTVLDVC
Ga0302254_1012750413300028870FenMVEAEAYSRLAGVYDEIVVDPSYRRWARFLHELWSSDERPV
Ga0307314_1031661023300028872SoilVRQVEAYSRLAGLYDEIVIDPCHDRRASYLHELWSADAD
Ga0307286_1009802713300028876SoilVRQVEAYSRLAGLYDEIVIDPCHDRRASYLHELWSADADGVRSVLDLCCGTGLLAG
Ga0307300_1013244213300028880SoilVSHVAAYSRLAEVYDEIVIDPCHDRWASFLHEHWSADPVGVRSVLDLCC
Ga0307300_1033222133300028880SoilVRQVEAYSRLAGLYDEIVIDPCHDRRASYLHELWS
Ga0247827_1014281543300028889SoilVRQVEAYSRLAGLYDEIVIDPCHDRSASYLDELWSDDADGVRSVLDLC
Ga0302217_1004018713300030052FenVPAVRVTAVEAYSRLAGIYDEIVVDLPSYDRWAAFLHELWHSDAAAVHAVL
Ga0247826_1009176053300030336SoilVRHVEAYSQLAGVYDEIVVDPCHDRWASFLHELWSAD
Ga0311360_1103218533300030339BogVTAAEPYTRLAGVYDEIVVDPCYARWAAYLHELWRADDAGVRTVLDVCCG
Ga0247654_102132413300030552SoilVRHAEAYSRLAGVYDEIVVDPCHDHCAAFLHDLWSADPEGVRSVLDLCCGTG
Ga0302046_1113120313300030620SoilVRHVEAYSRLAGFYDEIVIDPCHDAWASFLHELWSADPEGVRSVLD
Ga0308203_102548133300030829SoilVRQVEAYSRLAGLYDEIVIDPCHDRRASYLHELWSADA
Ga0311335_1015501843300030838FenMVEEEAYSRLAGVYDEIVVDPSYRRWAQYLHELWS
Ga0308202_106196413300030902SoilVRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVLDL
Ga0308202_111765933300030902SoilVKQVEPYSRLAGVYDEIVIDPCHDRWASFLHELWST
Ga0308206_113121113300030903SoilVRHVEAYSRLAGVYDEIVIDPCHDRWASFLDELWSADP
Ga0308200_109252533300030905SoilVRQVEAYSRLAEVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVLDLCCG
Ga0308200_118421813300030905SoilVNEAEPYARLAAVYDEIVVDPCHRAWASHLHDLWTGDPAEVHSVLDL
Ga0308183_103590533300030988SoilVRHVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADPDGVRSVLDVCCGTGLLAGELI
Ga0308178_102635313300030990SoilVAHVEAYSRLAGVYDQIDIDPCHDRWASFLHELWSTDAEGVRWVLDLCCGTGLLASEL
Ga0308190_103845413300030993SoilVRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSV
Ga0308190_108490133300030993SoilVRPVEAYSRLAAVYDEIVIDPCHDHWASFLHERWR
Ga0308199_103856613300031094SoilVQHVEPYSRLAGVYDEIVIDPCHDRRASYLHEVWSADADGVRSVLDLCCGTGLLA
Ga0308199_105472013300031094SoilVRQVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSGDPDGVRS
Ga0308180_102278813300031100SoilVKQVEPYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPESVRA
Ga0308187_1003763213300031114SoilVRDVEAYSRLAGFYDEIVIDPCHDRWASFLHELWS
Ga0308195_101429333300031123SoilVRVDEAEPYTRLAAVYDEIVVDPCHRAWASYLHELWISDPAQVRC
Ga0308151_102096613300031124SoilVRHVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADP
Ga0307498_1012461313300031170SoilVSQVEAYTRLAGVYDEIVVDPCHGAWASFLDDVWRADVPGVR
Ga0308186_102055433300031422SoilVRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVLDLCC
Ga0307408_10245095013300031548RhizosphereVQHVEAYSRLAGVYDEIVIDPCHDRWASFLHALWSTDPQGVRSVLDLCCGTGLLAGELIA
Ga0318573_1063234233300031564SoilVSQVEAYTNLAGVYDQIVVDPCHGVIASFLDDLWSTGGDGVRE
Ga0307469_1252898823300031720Hardwood Forest SoilVDKSEPYARLADVYDDVVVDPCHDRWAAYLHELWSSDHDSVQAVLDVCCGTGL
Ga0318547_1052794413300031781SoilVRPVEAYSRLAGVYDEIVVDPCHGRWARFLDELWERGVHAVLDLCCGTG
Ga0307410_1097897213300031852RhizosphereVRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWST
Ga0307407_1120550913300031903RhizosphereVRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWS
Ga0310900_1148692613300031908SoilVGQVEAYTRLAGVYDEIVVDPCHGALASFLHELWSDDARGVHDVLDVCCGTGLL
Ga0307412_1024112813300031911RhizosphereVQHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVLDLCC
Ga0306921_1159133133300031912SoilVKPVEAYSRLAGVYDEIVVDPCHGAWAAFLDGLWRADEQRVQEVLDVCCGT
Ga0311367_1031148713300031918FenVTDAEAYSLLAGVYDEIVVDPCHALWAGYLDGLWRADEAGVHDVLDVCCG
Ga0307409_10112359513300031995RhizosphereVRQVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRSVLDVC
Ga0307414_1083644613300032004RhizosphereVRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWST
Ga0318556_1033541433300032043SoilVRPVEAYSRLAGVYDEIVVDPCHGRWAAFLDELWDGGVGAVLDVCCGTGLLAAEL
Ga0307415_10074739233300032126RhizosphereVRQVEPYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPQGV
Ga0315283_1103780913300032164SedimentVSGADPYARLAGVYDEIVVDPCYGRWAAHLHELWEGDTTG
Ga0315276_1111429313300032177SedimentVSGADPYARLAGVYDEIVVDPCYGRWAAHLHELWEGDTTGVRAVLDVCCGTGLMASELIA
Ga0316188_1035373433300032276Worm BurrowMSVAEPYSRLAGVYDEIVVDPCYPLWAEFLLDLWDDDPQ
Ga0335079_1060451913300032783SoilVLKRVEAYSRLAEVYDEIVVDPCHGEWASFLDELWSADAGG
Ga0316605_1153961733300033408SoilVREADPYARLAGVYDEIVVDPCYGRWAAFLHDLWRADGGGVRTVLDVCCGTGLMAFELVA
Ga0326726_1189406313300033433Peat SoilVGAAEAYSRLAGVYDEIVVDPCYDRWAAYLHELWSSD
Ga0247829_1001319813300033550SoilVRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWSTDPEGVRS
Ga0247830_1043261533300033551SoilVRHVEAYSRLAGVYDEIVADPCHGQWASFLDELWSADPQGVGTVL
Ga0314780_041319_2_1243300034659SoilVRHVEAYSRLAGVYDEIVIDPCHDRWASFLHELWEADPDGV
Ga0314780_076509_572_7213300034659SoilMDEAEPYARLAGVYDEIVVDPCHRAWASHLHDLWTGDPAEVHSVLDLGCG
Ga0314781_148090_1_1263300034660SoilVRHVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADPDGVR
Ga0314783_031808_801_9143300034662SoilMRQVEAYSRLAGLYDEIVIDPCHGLWASFLDELWSADR
Ga0314786_015185_2_1363300034664SoilVRHVEAYSRLAGVYDEIVIDPCHDQWASFLHELWSADPDGVRSVL
Ga0314786_147737_1_1713300034664SoilVRHVEAYSRLAGVYDEIVVDPCHDRWAAFLHELWTPDPEGVRSVLDLCCGTGLLAGE
Ga0314788_032338_797_9463300034666SoilVRHVDAYSRLAGVYDEIVVDPCHDRWASFLHQLWSSDPESVRSVLDLGCG
Ga0314788_089221_3_1433300034666SoilVRHVEAYSRLAGVYDEIVADPCHGQWASFLDELWSADPQGVGTVLDL
Ga0314803_024037_793_9273300034678SoilMRVDEAEPYARLAGVYDEIVVDPCYRAWASHLHDLWTGDPAEVHS
Ga0314803_079601_1_1353300034678SoilMRHVEAYSQLAGVYDEIVVDPCHGRWASFLHELWSADPEGVRSVL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.