| Basic Information | |
|---|---|
| Family ID | F017467 |
| Family Type | Metagenome |
| Number of Sequences | 240 |
| Average Sequence Length | 47 residues |
| Representative Sequence | LKNNSDNYLVEWYIAVAKRRGWPEVVRLLAQYPEKEERIKMLIKKRLGK |
| Number of Associated Samples | 145 |
| Number of Associated Scaffolds | 240 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 46.25 % |
| % of genes near scaffold ends (potentially truncated) | 21.67 % |
| % of genes from short scaffolds (< 2000 bps) | 63.75 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.68 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (40.000 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (35.833 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.750 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (78.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.68 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 240 Family Scaffolds |
|---|---|---|
| PF16786 | RecA_dep_nuc | 9.58 |
| PF14549 | P22_Cro | 5.83 |
| PF00145 | DNA_methylase | 5.42 |
| PF05866 | RusA | 4.58 |
| PF00149 | Metallophos | 4.17 |
| PF10263 | SprT-like | 3.33 |
| PF13392 | HNH_3 | 2.50 |
| PF07102 | YbcO | 1.67 |
| PF13884 | Peptidase_S74 | 1.25 |
| PF00583 | Acetyltransf_1 | 0.83 |
| PF00182 | Glyco_hydro_19 | 0.83 |
| PF13539 | Peptidase_M15_4 | 0.42 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.42 |
| PF01507 | PAPS_reduct | 0.42 |
| PF13420 | Acetyltransf_4 | 0.42 |
| PF11351 | GTA_holin_3TM | 0.42 |
| PF12705 | PDDEXK_1 | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 240 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 5.42 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 4.58 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.83 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.67 % |
| Unclassified | root | N/A | 23.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c012325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1474 | Open in IMG/M |
| 3300000176|TB03JUN2009E_c032191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300002091|JGI24028J26656_1010563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
| 3300002091|JGI24028J26656_1026789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300002092|JGI24218J26658_1002332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4984 | Open in IMG/M |
| 3300002098|JGI24219J26650_1003879 | All Organisms → cellular organisms → Bacteria | 3379 | Open in IMG/M |
| 3300002203|metazooDRAFT_1292039 | Not Available | 589 | Open in IMG/M |
| 3300002307|JGI24890J29729_1052079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095 | 742 | Open in IMG/M |
| 3300002307|JGI24890J29729_1062688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| 3300002471|metazooDRAFT_1456791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| 3300002930|Water_100856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6033 | Open in IMG/M |
| 3300002930|Water_101659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4068 | Open in IMG/M |
| 3300002930|Water_103329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2646 | Open in IMG/M |
| 3300002930|Water_104820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2078 | Open in IMG/M |
| 3300002933|G310J44882_10000631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16992 | Open in IMG/M |
| 3300003375|JGI26470J50227_1005530 | Not Available | 3501 | Open in IMG/M |
| 3300003375|JGI26470J50227_1008259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2708 | Open in IMG/M |
| 3300003499|JGI25930J51415_1002914 | All Organisms → Viruses → Predicted Viral | 3803 | Open in IMG/M |
| 3300003499|JGI25930J51415_1005935 | All Organisms → Viruses → Predicted Viral | 2581 | Open in IMG/M |
| 3300003785|Ga0007851_100961 | All Organisms → cellular organisms → Bacteria | 1942 | Open in IMG/M |
| 3300003787|Ga0007811_1019639 | Not Available | 586 | Open in IMG/M |
| 3300003824|Ga0007874_1003691 | All Organisms → Viruses → Predicted Viral | 1748 | Open in IMG/M |
| 3300003852|Ga0031655_10072964 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
| 3300004155|Ga0066600_10027143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1869 | Open in IMG/M |
| 3300004448|Ga0065861_1001745 | All Organisms → Viruses → Predicted Viral | 2289 | Open in IMG/M |
| 3300004460|Ga0066222_1088943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 516 | Open in IMG/M |
| 3300004460|Ga0066222_1250201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300004461|Ga0066223_1081735 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300004461|Ga0066223_1279672 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300004684|Ga0065168_1001793 | All Organisms → cellular organisms → Bacteria | 3566 | Open in IMG/M |
| 3300004691|Ga0065176_1016752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300004694|Ga0065170_1005516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1722 | Open in IMG/M |
| 3300004770|Ga0007804_1046333 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300004770|Ga0007804_1111031 | Not Available | 695 | Open in IMG/M |
| 3300004804|Ga0007796_10027946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1977 | Open in IMG/M |
| 3300004804|Ga0007796_10102093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
| 3300004805|Ga0007792_10165275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300004807|Ga0007809_10015897 | All Organisms → cellular organisms → Bacteria | 2694 | Open in IMG/M |
| 3300005525|Ga0068877_10058891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2504 | Open in IMG/M |
| 3300005527|Ga0068876_10025167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3734 | Open in IMG/M |
| 3300005582|Ga0049080_10071034 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
| 3300006030|Ga0075470_10034178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1572 | Open in IMG/M |
| 3300006641|Ga0075471_10064869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2007 | Open in IMG/M |
| 3300006641|Ga0075471_10651765 | Not Available | 514 | Open in IMG/M |
| 3300006805|Ga0075464_10339693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
| 3300006805|Ga0075464_10479063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
| 3300007363|Ga0075458_10142218 | Not Available | 743 | Open in IMG/M |
| 3300007973|Ga0105746_1209340 | Not Available | 667 | Open in IMG/M |
| 3300007974|Ga0105747_1257232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 585 | Open in IMG/M |
| 3300008108|Ga0114341_10016092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9354 | Open in IMG/M |
| 3300008108|Ga0114341_10075222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3399 | Open in IMG/M |
| 3300008113|Ga0114346_1006049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9875 | Open in IMG/M |
| 3300008120|Ga0114355_1052329 | All Organisms → Viruses → Predicted Viral | 1848 | Open in IMG/M |
| 3300008262|Ga0114337_1019497 | All Organisms → Viruses → Predicted Viral | 4175 | Open in IMG/M |
| 3300008266|Ga0114363_1052745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3085 | Open in IMG/M |
| 3300008266|Ga0114363_1115930 | Not Available | 939 | Open in IMG/M |
| 3300008448|Ga0114876_1101874 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300008450|Ga0114880_1104118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1092 | Open in IMG/M |
| 3300009009|Ga0105105_11079038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300009056|Ga0102860_1190678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300009068|Ga0114973_10115400 | All Organisms → Viruses → Predicted Viral | 1515 | Open in IMG/M |
| 3300009068|Ga0114973_10158560 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300009068|Ga0114973_10337682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300009081|Ga0105098_10091285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1303 | Open in IMG/M |
| 3300009082|Ga0105099_10311639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300009151|Ga0114962_10076192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2137 | Open in IMG/M |
| 3300009151|Ga0114962_10393399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300009151|Ga0114962_10506023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 638 | Open in IMG/M |
| 3300009152|Ga0114980_10004509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9380 | Open in IMG/M |
| 3300009152|Ga0114980_10146539 | All Organisms → Viruses → Predicted Viral | 1400 | Open in IMG/M |
| 3300009152|Ga0114980_10147106 | All Organisms → Viruses → Predicted Viral | 1397 | Open in IMG/M |
| 3300009152|Ga0114980_10214834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 1129 | Open in IMG/M |
| 3300009152|Ga0114980_10330372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
| 3300009154|Ga0114963_10174688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1258 | Open in IMG/M |
| 3300009155|Ga0114968_10000353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33874 | Open in IMG/M |
| 3300009155|Ga0114968_10056161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2518 | Open in IMG/M |
| 3300009155|Ga0114968_10122094 | All Organisms → Viruses → Predicted Viral | 1572 | Open in IMG/M |
| 3300009155|Ga0114968_10131427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1502 | Open in IMG/M |
| 3300009155|Ga0114968_10608201 | Not Available | 578 | Open in IMG/M |
| 3300009158|Ga0114977_10327811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300009158|Ga0114977_10731194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300009159|Ga0114978_10091041 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
| 3300009159|Ga0114978_10562330 | Not Available | 663 | Open in IMG/M |
| 3300009161|Ga0114966_10143942 | All Organisms → Viruses → Predicted Viral | 1558 | Open in IMG/M |
| 3300009163|Ga0114970_10016058 | Not Available | 5125 | Open in IMG/M |
| 3300009163|Ga0114970_10022543 | All Organisms → Viruses → Predicted Viral | 4252 | Open in IMG/M |
| 3300009163|Ga0114970_10048288 | Not Available | 2760 | Open in IMG/M |
| 3300009164|Ga0114975_10000340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34977 | Open in IMG/M |
| 3300009164|Ga0114975_10059521 | All Organisms → Viruses → Predicted Viral | 2240 | Open in IMG/M |
| 3300009164|Ga0114975_10237505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1022 | Open in IMG/M |
| 3300009180|Ga0114979_10509056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300009180|Ga0114979_10561296 | Not Available | 655 | Open in IMG/M |
| 3300009181|Ga0114969_10063990 | Not Available | 2428 | Open in IMG/M |
| 3300009182|Ga0114959_10273784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300009182|Ga0114959_10338955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300009182|Ga0114959_10367588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 708 | Open in IMG/M |
| 3300009183|Ga0114974_10011890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6297 | Open in IMG/M |
| 3300009183|Ga0114974_10112642 | All Organisms → Viruses → Predicted Viral | 1738 | Open in IMG/M |
| 3300009183|Ga0114974_10187176 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300009183|Ga0114974_10644503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300009184|Ga0114976_10115405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1523 | Open in IMG/M |
| 3300009184|Ga0114976_10270766 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 916 | Open in IMG/M |
| 3300009184|Ga0114976_10476864 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300010157|Ga0114964_10053544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2106 | Open in IMG/M |
| 3300010233|Ga0136235_1000346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24979 | Open in IMG/M |
| 3300010334|Ga0136644_10164233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1343 | Open in IMG/M |
| 3300010354|Ga0129333_10164866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2029 | Open in IMG/M |
| 3300010354|Ga0129333_10210787 | Not Available | 1764 | Open in IMG/M |
| 3300010885|Ga0133913_10738505 | All Organisms → Viruses → Predicted Viral | 2572 | Open in IMG/M |
| 3300010885|Ga0133913_11901400 | Not Available | 1484 | Open in IMG/M |
| 3300010885|Ga0133913_12128711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1387 | Open in IMG/M |
| 3300010970|Ga0137575_10047992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300012346|Ga0157141_1004791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2225 | Open in IMG/M |
| 3300012664|Ga0157497_1000044 | Not Available | 28530 | Open in IMG/M |
| 3300012664|Ga0157497_1000349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9452 | Open in IMG/M |
| 3300013285|Ga0136642_1126804 | Not Available | 645 | Open in IMG/M |
| 3300013285|Ga0136642_1140379 | Not Available | 605 | Open in IMG/M |
| 3300014490|Ga0182010_10628786 | Not Available | 601 | Open in IMG/M |
| 3300014502|Ga0182021_11622377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300017722|Ga0181347_1099622 | Not Available | 830 | Open in IMG/M |
| 3300017722|Ga0181347_1153525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300017747|Ga0181352_1003743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5332 | Open in IMG/M |
| 3300017747|Ga0181352_1047881 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
| 3300017747|Ga0181352_1054205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
| 3300017747|Ga0181352_1134984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300017754|Ga0181344_1006090 | Not Available | 4023 | Open in IMG/M |
| 3300017754|Ga0181344_1020189 | All Organisms → Viruses → Predicted Viral | 2073 | Open in IMG/M |
| 3300017754|Ga0181344_1032691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1587 | Open in IMG/M |
| 3300017754|Ga0181344_1038137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1454 | Open in IMG/M |
| 3300017754|Ga0181344_1088706 | Not Available | 904 | Open in IMG/M |
| 3300017754|Ga0181344_1120536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300017754|Ga0181344_1149188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300017754|Ga0181344_1238123 | Not Available | 505 | Open in IMG/M |
| 3300017766|Ga0181343_1029636 | Not Available | 1657 | Open in IMG/M |
| 3300017784|Ga0181348_1091642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1195 | Open in IMG/M |
| 3300019784|Ga0181359_1004644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4379 | Open in IMG/M |
| 3300019784|Ga0181359_1046458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1678 | Open in IMG/M |
| 3300020151|Ga0211736_10078410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 941 | Open in IMG/M |
| 3300020151|Ga0211736_10659642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2153 | Open in IMG/M |
| 3300020159|Ga0211734_10410739 | Not Available | 1145 | Open in IMG/M |
| 3300020161|Ga0211726_10442762 | Not Available | 502 | Open in IMG/M |
| 3300020172|Ga0211729_10760309 | All Organisms → Viruses → Predicted Viral | 3392 | Open in IMG/M |
| 3300020205|Ga0211731_11595059 | Not Available | 810 | Open in IMG/M |
| 3300020706|Ga0214217_1000529 | Not Available | 9245 | Open in IMG/M |
| 3300020722|Ga0214245_1031245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300020727|Ga0214246_1005979 | All Organisms → Viruses → Predicted Viral | 2456 | Open in IMG/M |
| 3300020727|Ga0214246_1036628 | Not Available | 764 | Open in IMG/M |
| 3300021112|Ga0214186_105407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
| 3300021124|Ga0214199_1010453 | All Organisms → Viruses → Predicted Viral | 1107 | Open in IMG/M |
| 3300021131|Ga0214206_1023490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| 3300021139|Ga0214166_1018685 | All Organisms → Viruses → Predicted Viral | 1785 | Open in IMG/M |
| 3300021354|Ga0194047_10002929 | Not Available | 9606 | Open in IMG/M |
| 3300021519|Ga0194048_10000104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 35430 | Open in IMG/M |
| 3300022190|Ga0181354_1100948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
| 3300022591|Ga0236341_1069672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300022748|Ga0228702_1082911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300025316|Ga0209697_10172772 | All Organisms → Viruses → Predicted Viral | 1279 | Open in IMG/M |
| 3300025353|Ga0208255_100031 | Not Available | 22446 | Open in IMG/M |
| 3300025353|Ga0208255_104569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1397 | Open in IMG/M |
| 3300025372|Ga0207957_1000562 | Not Available | 8519 | Open in IMG/M |
| 3300025372|Ga0207957_1014644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
| 3300025379|Ga0208738_1000064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33064 | Open in IMG/M |
| 3300025426|Ga0208739_1000140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26020 | Open in IMG/M |
| 3300025426|Ga0208739_1001369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6218 | Open in IMG/M |
| 3300025429|Ga0208500_1003684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2898 | Open in IMG/M |
| 3300025429|Ga0208500_1018715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 922 | Open in IMG/M |
| 3300025606|Ga0207954_1013657 | Not Available | 2565 | Open in IMG/M |
| 3300025606|Ga0207954_1089949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300025872|Ga0208783_10273486 | Not Available | 678 | Open in IMG/M |
| 3300027608|Ga0208974_1059419 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
| 3300027697|Ga0209033_1127482 | Not Available | 811 | Open in IMG/M |
| 3300027708|Ga0209188_1000594 | All Organisms → cellular organisms → Bacteria | 33908 | Open in IMG/M |
| 3300027708|Ga0209188_1035169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2355 | Open in IMG/M |
| 3300027712|Ga0209499_1021697 | Not Available | 2966 | Open in IMG/M |
| 3300027712|Ga0209499_1037118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2095 | Open in IMG/M |
| 3300027733|Ga0209297_1000274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34716 | Open in IMG/M |
| 3300027733|Ga0209297_1001882 | Not Available | 11932 | Open in IMG/M |
| 3300027734|Ga0209087_1000254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34988 | Open in IMG/M |
| 3300027734|Ga0209087_1000460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25889 | Open in IMG/M |
| 3300027734|Ga0209087_1003575 | Not Available | 8557 | Open in IMG/M |
| 3300027734|Ga0209087_1042001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2129 | Open in IMG/M |
| 3300027734|Ga0209087_1045900 | All Organisms → Viruses → Predicted Viral | 2018 | Open in IMG/M |
| 3300027734|Ga0209087_1077919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1446 | Open in IMG/M |
| 3300027734|Ga0209087_1120844 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
| 3300027734|Ga0209087_1267461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 624 | Open in IMG/M |
| 3300027736|Ga0209190_1031288 | Not Available | 2851 | Open in IMG/M |
| 3300027736|Ga0209190_1035007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2660 | Open in IMG/M |
| 3300027741|Ga0209085_1004860 | Not Available | 7158 | Open in IMG/M |
| 3300027741|Ga0209085_1177570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 880 | Open in IMG/M |
| 3300027746|Ga0209597_1117799 | All Organisms → Viruses → Predicted Viral | 1176 | Open in IMG/M |
| 3300027746|Ga0209597_1130235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1097 | Open in IMG/M |
| 3300027746|Ga0209597_1193757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
| 3300027747|Ga0209189_1031570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2715 | Open in IMG/M |
| 3300027747|Ga0209189_1303857 | Not Available | 619 | Open in IMG/M |
| 3300027749|Ga0209084_1007230 | Not Available | 7185 | Open in IMG/M |
| 3300027749|Ga0209084_1011847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5182 | Open in IMG/M |
| 3300027749|Ga0209084_1037524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2432 | Open in IMG/M |
| 3300027749|Ga0209084_1163557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
| 3300027759|Ga0209296_1078642 | All Organisms → Viruses → Predicted Viral | 1630 | Open in IMG/M |
| 3300027759|Ga0209296_1351582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 567 | Open in IMG/M |
| 3300027763|Ga0209088_10002338 | Not Available | 11716 | Open in IMG/M |
| 3300027764|Ga0209134_10011922 | Not Available | 2655 | Open in IMG/M |
| 3300027764|Ga0209134_10171733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300027777|Ga0209829_10110873 | All Organisms → Viruses → Predicted Viral | 1312 | Open in IMG/M |
| 3300027793|Ga0209972_10021387 | All Organisms → Viruses → Predicted Viral | 3943 | Open in IMG/M |
| 3300027804|Ga0209358_10004856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9549 | Open in IMG/M |
| 3300027804|Ga0209358_10124788 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300027841|Ga0209262_10054024 | All Organisms → Viruses → Predicted Viral | 1813 | Open in IMG/M |
| 3300027899|Ga0209668_10929362 | Not Available | 586 | Open in IMG/M |
| 3300027900|Ga0209253_10726302 | Not Available | 714 | Open in IMG/M |
| 3300027902|Ga0209048_10087381 | Not Available | 2427 | Open in IMG/M |
| 3300027963|Ga0209400_1000513 | All Organisms → cellular organisms → Bacteria | 33878 | Open in IMG/M |
| 3300027963|Ga0209400_1002379 | Not Available | 14347 | Open in IMG/M |
| 3300027963|Ga0209400_1122097 | All Organisms → Viruses → Predicted Viral | 1176 | Open in IMG/M |
| 3300027963|Ga0209400_1191849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
| 3300027969|Ga0209191_1145777 | Not Available | 969 | Open in IMG/M |
| 3300027973|Ga0209298_10024472 | All Organisms → cellular organisms → Bacteria | 2983 | Open in IMG/M |
| 3300027973|Ga0209298_10117819 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
| 3300028025|Ga0247723_1000863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19054 | Open in IMG/M |
| 3300028025|Ga0247723_1034809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1551 | Open in IMG/M |
| 3300028393|Ga0304728_1230260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300029798|Ga0239581_1023927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1590 | Open in IMG/M |
| 3300031758|Ga0315907_10504881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300031772|Ga0315288_10964682 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
| 3300031784|Ga0315899_11473621 | Not Available | 572 | Open in IMG/M |
| 3300031787|Ga0315900_11005681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 547 | Open in IMG/M |
| 3300031857|Ga0315909_10463994 | Not Available | 886 | Open in IMG/M |
| 3300031857|Ga0315909_10650138 | Not Available | 694 | Open in IMG/M |
| 3300031951|Ga0315904_10264742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1636 | Open in IMG/M |
| 3300031951|Ga0315904_10609593 | Not Available | 937 | Open in IMG/M |
| 3300031963|Ga0315901_10143871 | All Organisms → Viruses → Predicted Viral | 2137 | Open in IMG/M |
| 3300031999|Ga0315274_10739338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1055 | Open in IMG/M |
| 3300031999|Ga0315274_10785156 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300032050|Ga0315906_10830374 | Not Available | 720 | Open in IMG/M |
| 3300032053|Ga0315284_10562612 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
| 3300032116|Ga0315903_10960024 | Not Available | 603 | Open in IMG/M |
| 3300032118|Ga0315277_10255431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1871 | Open in IMG/M |
| 3300034061|Ga0334987_0089273 | All Organisms → Viruses → Predicted Viral | 2405 | Open in IMG/M |
| 3300034106|Ga0335036_0618233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300034283|Ga0335007_0602750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 35.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.08% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 10.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.75% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.92% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.50% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 2.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 2.08% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.08% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.08% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.67% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.25% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.83% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.83% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.83% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.83% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.83% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.83% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.83% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.42% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.42% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002203 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAR 2013 | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300003785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300003824 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004691 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (version 2) | Environmental | Open in IMG/M |
| 3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010233 | Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA. | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
| 3300012664 | Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17 | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020706 | Freshwater microbial communities from Trout Bog Lake, WI - 02JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020722 | Freshwater microbial communities from Trout Bog Lake, WI - 23OCT2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021112 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUN2008 epilimnion | Environmental | Open in IMG/M |
| 3300021124 | Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025353 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025429 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300029798 | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0123253 | 3300000176 | Freshwater | LKHEEYLVSWYIAVAKRRGWHEVVRLLAQNKETENRMKMLIKKKLGK* |
| TB03JUN2009E_0321913 | 3300000176 | Freshwater | DWYIAVAKRRGWPEVVRLLAQNKETEDRMKMLIKKRLGK* |
| JGI24028J26656_10105631 | 3300002091 | Lentic | LNSDNYLADWYIAVAKRRGWPEVVRLLAQNKETEDRMKTLIKKRLGK* |
| JGI24028J26656_10267892 | 3300002091 | Lentic | MPNIANNSDNYLVSWYIAVAKRRGWPEVVRLLAQNKETEDRMKM |
| JGI24218J26658_10023329 | 3300002092 | Lentic | LKNNSDNYLVDWYIAVAKRRGWPEVVRLLAQYPEKEERMKMLIKKRLGK* |
| JGI24219J26650_10038796 | 3300002098 | Lentic | LKHEEYLVNWYIAVAKKRGWPEVVRLLAQNKETEDRMKMLIKKRLGK* |
| metazooDRAFT_12920393 | 3300002203 | Lake | VKHNPDNYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKQLIKKRLGK* |
| JGI24890J29729_10520792 | 3300002307 | Lentic | DDYLVWWYIGVAKRRGWPEVVRLLAQYPEKEERIKMLIKQKLGKHE* |
| JGI24890J29729_10626883 | 3300002307 | Lentic | DDYLVWWYIGVAKRRGWPEVVRLLAQYPEKEERIKLLIKRKLGK* |
| metazooDRAFT_14567912 | 3300002471 | Lake | VKHNPDDYLVEWYIGVAKRRGWNEVVRLLKQYPKDEERMKQLIKKRLGK*AQH* |
| Water_1008569 | 3300002930 | Estuary Water | LKNNSDDYLAWWYIGVAKKRGWPAVVKLLAQYPEKEERIKQLIKKKLGK* |
| Water_1016592 | 3300002930 | Estuary Water | LKNNSDNYLVEWYIAVAKRRGWLEVVRLLAQYPEKEERMKMLIKKRLGK* |
| Water_1033298 | 3300002930 | Estuary Water | LKNNSDNYLVEWYIAVAKKRGWPAVVKLLAQYPEKEERIKMMIKKRLGK* |
| Water_1048206 | 3300002930 | Estuary Water | LKNNSDNYLVEWYIAVAKKRGWPEVVKLLAQYPEKEERIKQLIKKKLGK* |
| G310J44882_1000063127 | 3300002933 | Freshwater | LKHEEYLVSWYIAVAKKRGWPEVVRLLAQNKETEDRMKMLIKKRLGK* |
| JGI26470J50227_10055307 | 3300003375 | Freshwater | LKHEEYLVSWYIAVAKRRGWPEVVRLLAQNKETEDRMKMLIKKRLGK* |
| JGI26470J50227_10082594 | 3300003375 | Freshwater | LKNNFERYLVDWYIGVAKRRGWPEVVRLLAQNKETEERMKMLIKKRLGK* |
| JGI25930J51415_10029147 | 3300003499 | Freshwater Lake | VKHIPDNYLVEWYIGVAKRRGWNEVVRLLKQYPKDEERMKELIKKRLGKT* |
| JGI25930J51415_10059355 | 3300003499 | Freshwater Lake | VKHIPDKYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKTLIKKRLGHERD* |
| Ga0007851_1009614 | 3300003785 | Freshwater | LKHEEYLVSWYIAVAKKRGWPEVVRLLAQYPDKEERIKQLIKKKLGK* |
| Ga0007811_10196392 | 3300003787 | Freshwater | LKNNSDSYLVDWYIGVAKRRGWDEVVRLLKQYPEKEERMKMLIKQRLGK* |
| Ga0007874_10036914 | 3300003824 | Freshwater | LKHEEYLVSWYIAVAKKRGWPEVVXXXAQYPDKEERIKQLIKKKLGK* |
| Ga0031655_100729647 | 3300003852 | Freshwater Lake Sediment | HEEYLVSWYIAVAKKRGWPEVVRLLAQNKETEDRMKMLIKKRLGK* |
| Ga0066600_100271433 | 3300004155 | Freshwater | LKNNPDDYLVNWYIGVAKRRGWPEVVRLLAQYPEKEERIKLLIKKRLGK* |
| Ga0065861_10017453 | 3300004448 | Marine | LKNNSDDYLAWWYIGVAKKRGWDEVVRLLKQYPEKEERIKQLIKKKLGK* |
| Ga0066222_10889432 | 3300004460 | Marine | LKNNSDDYLAWWYIGVAKKRGWDEVVRLLAQYPEKEERIKQLIKKKLGR* |
| Ga0066222_12502012 | 3300004460 | Marine | LKNNSKQYLVDWYIGVAKRRGWEVVVKLLKENPETEAEMKMLIK |
| Ga0066223_10817352 | 3300004461 | Marine | LKNNSDDYLAWWYIGVAKKRGWPEVVRLLKQYPEKEERIKQLIKKKLGK* |
| Ga0066223_12796722 | 3300004461 | Marine | LVEWYIAVAKRRGWPEVVRLLAQYPDKEERIKMLIKKRLGR* |
| Ga0065168_10017937 | 3300004684 | Freshwater | LKHEEYLVSWYITVAKRRGWPEVVRLLAQNKETEERMKMLIKKRLGK* |
| Ga0065176_10167522 | 3300004691 | Freshwater | LNSKQYLVDWYIGVAKRRGWEVVVKLLKENPETEAEMKMLIKKRLGR* |
| Ga0065170_10055168 | 3300004694 | Freshwater | LVSWYITVAKRRGWPEVVRLLAQNKETEERMKMLIKKRLGK* |
| Ga0007804_10463333 | 3300004770 | Freshwater | LKHEEYLVSWYITVAKRRGWPEVVRLLAQNKETEERMKMLIK |
| Ga0007804_11110311 | 3300004770 | Freshwater | EEYLVSWYITVAKRRGWPEVVRLLAQNKETEERMKMLIKKRLGK* |
| Ga0007796_100279461 | 3300004804 | Freshwater | LKNNSDNYLVEWYIAVAKRRGWPEVVRLLAQYPEKEERIKMLIKKRLGK* |
| Ga0007796_101020933 | 3300004804 | Freshwater | LVEWYIAVAKRRGWPEVVRLLAQYPDKEERMKMLIKKRLGK* |
| Ga0007792_101652753 | 3300004805 | Freshwater | LAYLTDWYIGVAKKRGWDEVVKLLAQYPETEAELKILIKKRLGK* |
| Ga0007809_100158978 | 3300004807 | Freshwater | LNSKQYLVDWYIGIAKRRGWEVVVKLLKENPETEAEMKMLIKKRLGK* |
| Ga0068877_100588918 | 3300005525 | Freshwater Lake | VEWYIGVAKRRGWDVVVKLLKQYPKDEERIKTLIKKRLASERSV* |
| Ga0068876_100251676 | 3300005527 | Freshwater Lake | VKHIPDNYLVEWYIGVAKRRGWDVVVKLLKQYPKDEERIKTLIKKRLASERSV* |
| Ga0049080_100710342 | 3300005582 | Freshwater Lentic | VKHIPDNYLVEWYIGVAKRRGWDVVVKLLKQYPKDEERMKKLIKKRLGRE* |
| Ga0075470_100341781 | 3300006030 | Aqueous | VNPDNYLVEWYIGVAKKRGWDVVVKLLKQYPKDEERMKTLIKKRL |
| Ga0075471_100648692 | 3300006641 | Aqueous | VNPDNYLVEWYIGVAKKRGWDVVVKLLKQYPKDEERMKTLIKKRLGHERD* |
| Ga0075471_106517652 | 3300006641 | Aqueous | VKHIPDNYLVEWYIGVAKKRGWDVVVKLLKQYPQDEERMKKLIKKRLGKE* |
| Ga0075464_103396932 | 3300006805 | Aqueous | LKHEEYLVSWYIAVAKKRGWTEVVRLLAQNKETEERMKMLIKKRLGK* |
| Ga0075464_104790633 | 3300006805 | Aqueous | MYLVDWYIGVAKKRGWDAVVKLIQQNPDTEAEIKMLIKKRLGK* |
| Ga0075458_101422182 | 3300007363 | Aqueous | VNPDNYLVEWYIGVAKKRGWDEVVRLLKQYPKDEERMKDLIKKRLGK* |
| Ga0105746_12093403 | 3300007973 | Estuary Water | VKHNPDNYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKTLIKKRLGHERD* |
| Ga0105747_12572322 | 3300007974 | Estuary Water | VNPDNYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKTLIKKRLGHERD* |
| Ga0114341_100160925 | 3300008108 | Freshwater, Plankton | VKHIPDKYLVEWYIGVAKRRGWDEVVRLLKQYPEDEERIKTLIKKRLASERSV* |
| Ga0114341_1007522210 | 3300008108 | Freshwater, Plankton | VKHIPDNYLVEWYIGVAKRRGWDVVVKLLKQYPQDEERMKMLIKKRLGK* |
| Ga0114346_10060499 | 3300008113 | Freshwater, Plankton | LKNKHEDYLVDWYIGVAKRRGWDEVVRLLAQEKDQERMKMLIKKRLGK* |
| Ga0114355_10523292 | 3300008120 | Freshwater, Plankton | VKHIPDNYLVEWYIGVAKRRGWDEVVRLLEQYPKDEERMKTLIKKRLGHERD* |
| Ga0114337_10194976 | 3300008262 | Freshwater, Plankton | VKHIPDKYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERIKTLIKKRLASERSV* |
| Ga0114363_10527453 | 3300008266 | Freshwater, Plankton | VKHIPDNYLVEWYIGVAKRRGWDEVVRLLKQFPKDEERMKMLIKKRLGK* |
| Ga0114363_11159302 | 3300008266 | Freshwater, Plankton | VKHIPDNYLVEWYIGVAKKRGWDEVVRLLKQYPKDEERMKDLIKKRLGK* |
| Ga0114876_11018742 | 3300008448 | Freshwater Lake | VKHTPDNYLVEWYIGVAKKRGWDEVVRLLKQYPKDEERMKYLINKRLGK* |
| Ga0114880_11041182 | 3300008450 | Freshwater Lake | VKHIPDNYLVEWYIGVAKRRGWDEVVRLLKQYPEDEERIKTLIKKRLASERSV* |
| Ga0105105_110790382 | 3300009009 | Freshwater Sediment | LSNWYIGVAKRRGWDEVVRLLAQYPDVEEEMKQEIKRKLGK* |
| Ga0102860_11906782 | 3300009056 | Estuarine | LKNNSDNYLVEWYIAVAKKRGWAEVVRLLAQYPEKEERIKMLIKKRLGK* |
| Ga0114973_101154002 | 3300009068 | Freshwater Lake | LKNNSDNYLVEWYIAVAKKRGWPEVVKLLAQYPEKEERIKMLIKKRLGK* |
| Ga0114973_101585605 | 3300009068 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVRLLKQYPEKEERIKQLIKKKLGK* |
| Ga0114973_103376824 | 3300009068 | Freshwater Lake | LKNNSDNYLVEWYIAVAKKRGWPAVIKLLAQYPEKEERIKMLIKKRLGK* |
| Ga0105098_100912852 | 3300009081 | Freshwater Sediment | LSSWYIGVAKRRGWDEVVRLLAQYPDVEDEMKKEIKRKLGK* |
| Ga0105099_103116392 | 3300009082 | Freshwater Sediment | LKNNSDDYLVDWYIGVAKRRGWDEVVRLLAQYPEKEERIKQLIKKKLGK* |
| Ga0114962_100761921 | 3300009151 | Freshwater Lake | DDYLAWWYIGVAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGR* |
| Ga0114962_103933991 | 3300009151 | Freshwater Lake | DDYLAWWYIGVAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGK* |
| Ga0114962_105060232 | 3300009151 | Freshwater Lake | LKNNSDNYLVEWYIAVAKKRGWPEVVRLLKQYPEKEERIKMLIKKRLGK* |
| Ga0114980_1000450917 | 3300009152 | Freshwater Lake | LKNNSDDYLAWWYIGVAKKRGWPEVVRLLAQYPEKENRIKQLIKKKLGK* |
| Ga0114980_101465394 | 3300009152 | Freshwater Lake | LKNNSDDYLAWWYIGVAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGR* |
| Ga0114980_101471063 | 3300009152 | Freshwater Lake | LKNNSDDYLAWWYIGVAKKRGWPEVVKLLAQYPEKEERIKQLIKKKLGR* |
| Ga0114980_102148341 | 3300009152 | Freshwater Lake | LKNNSDQYLADWYIGVAKKRGWDEVVRLLKQYPDKEERIKKLIKKRLGK* |
| Ga0114980_103303722 | 3300009152 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVKLLKQYPEKEERIKMLIKKKLGK* |
| Ga0114963_101746885 | 3300009154 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVRLLTQYPEKEERMKMLIKKRLGK* |
| Ga0114968_1000035331 | 3300009155 | Freshwater Lake | MNNNVDNYLAWWYIGVAKKRGWPEVVKLLAQYPEKEERIKQLIKKKLGK* |
| Ga0114968_100561617 | 3300009155 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVKLLAQYPEKEERIKMLIKKRLGK* |
| Ga0114968_101220942 | 3300009155 | Freshwater Lake | LKNNSDNYLVEWYIAVAKKRGWPEVVRLLKQYPEKEERIKMLIKKKLGK* |
| Ga0114968_101314274 | 3300009155 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVRLLAQYPDKEKRMKMLIKKRLGK* |
| Ga0114968_106082012 | 3300009155 | Freshwater Lake | LKNNSDNYLVEWYIAVAKKRGWPAVVKLLAQYPEKEERIKQLIKKKLGR* |
| Ga0114977_103278113 | 3300009158 | Freshwater Lake | LKNNSDDYLAGWYIGVAKRRGWPEVVRLLKQYPEKEERIKQLIKKKLGK* |
| Ga0114977_107311941 | 3300009158 | Freshwater Lake | MKNNSDDYLAWWYIGVAKKRGWPEVVRMLDQYHKKEERIKQLIKRKL |
| Ga0114978_100910412 | 3300009159 | Freshwater Lake | LKNNSDNYLVEWYIAVAKKRGWPAVVKLLAQYPEKEERIKMLIKKRLGK* |
| Ga0114978_105623302 | 3300009159 | Freshwater Lake | LKNNSDNYLVEWYIAVAKKRGWPAVVKLLAQYPDKEERIKMLIKKRLGK* |
| Ga0114966_101439426 | 3300009161 | Freshwater Lake | LKNNSEDYLAWWYIGVAKRRGWPEVVRLLKQYPEKEERIKQLIKKKLGK* |
| Ga0114970_100160588 | 3300009163 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVRLLAQYPEKEERMKMLIKKRLGK* |
| Ga0114970_100225437 | 3300009163 | Freshwater Lake | LKNNSDDYLAWWYIGVAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGK* |
| Ga0114970_100482882 | 3300009163 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVRLLAQYPDKEERMKMLIKKRLGK* |
| Ga0114975_1000034021 | 3300009164 | Freshwater Lake | MKNNSDDYLAWWYIGVAKKRGWPEVVRLLAQYPKKEERIKQLIKRKLGK* |
| Ga0114975_100595214 | 3300009164 | Freshwater Lake | LKNNSDDYLAWWYIGVAKKRGWPAVVKLLAQYPEKEERIKQLIKKKLGR* |
| Ga0114975_102375052 | 3300009164 | Freshwater Lake | LKNNSDDYLAWWYIGVAKKRGWDEVIRLLKQYPDKEERIKQLIKKKLGK* |
| Ga0114979_105090562 | 3300009180 | Freshwater Lake | VAKKRGWDEVVRLLKQYPDKEERIKKLIKKRLGK* |
| Ga0114979_105612962 | 3300009180 | Freshwater Lake | LVEWYIAVAKRRGWPEVVRLLAQYPEKEERIKMLIKKRLGK* |
| Ga0114969_100639904 | 3300009181 | Freshwater Lake | LNPDNYLVSWYIAVAKKRGWPEVVRLLAQYPEKEERMKMLIKKRLGK* |
| Ga0114959_102737842 | 3300009182 | Freshwater Lake | MNPDDYLVSWYIAVAKRRGWPEVVRLLAQYPDKEERIKMLIKKRLGR* |
| Ga0114959_103389551 | 3300009182 | Freshwater Lake | YLAWWYIGVAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGK* |
| Ga0114959_103675882 | 3300009182 | Freshwater Lake | LKNKSDDYLVDWYIAVAKRRGWPEVVKLLAQYPDKEERIKMLIKKRLGK* |
| Ga0114974_1001189017 | 3300009183 | Freshwater Lake | IGVAKRRGWDEVVRLLVQEKDQERMKMLIKKRLGK* |
| Ga0114974_101126424 | 3300009183 | Freshwater Lake | LKNNSDNYLVDWYIGVAKRRGWDEVVRLLKQYPEKEERMKMLIKKRLGK* |
| Ga0114974_101871763 | 3300009183 | Freshwater Lake | LKNKHEDYLVDWYIGVAKRRGWDEVVRLLVQEKDQERIKMLIKKKLGK* |
| Ga0114974_106445032 | 3300009183 | Freshwater Lake | LNSDNYLADWYIGVAKRRGWPEVVRLLKQYPEKEERIKQLIKKKLGK* |
| Ga0114976_101154054 | 3300009184 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPAVVKLLAQYPEKEERIKMLIKKRLGK* |
| Ga0114976_102707661 | 3300009184 | Freshwater Lake | KNNSDDYLAWWYIGVAKKRGWDEVIRLLKQYPEKEERIKQLIKKKLGK* |
| Ga0114976_104768642 | 3300009184 | Freshwater Lake | LKNKSDNYLVEWYIAVAKRRGWPEVVKLLAQYPEKEERIKMLIKKRLGK* |
| Ga0114964_100535441 | 3300010157 | Freshwater Lake | VAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGR* |
| Ga0136235_100034624 | 3300010233 | Freshwater | LKNNSDNYLVEWYIAVAKKRGWPAVVKLLAQYPEKEERIKQLIKKKLGK* |
| Ga0136644_101642334 | 3300010334 | Freshwater Lake | LKNKSDDYLVDWYIAVAKRRGWPEVVKLLAQYPDKEERIKMLIKKRLGR* |
| Ga0129333_101648662 | 3300010354 | Freshwater To Marine Saline Gradient | VKHNPDNYLVEWYIGVAKRRGWDVVVKLLKQYPQDEERMKKLIKKRLGK* |
| Ga0129333_102107876 | 3300010354 | Freshwater To Marine Saline Gradient | VKHIPDNYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKTLIKKRLGHERD* |
| Ga0133913_107385053 | 3300010885 | Freshwater Lake | LKNNSDDYLAWWYIGVAKRRGWPEVVRLLKQYPEKEERIKQLIKKRLGK* |
| Ga0133913_119014003 | 3300010885 | Freshwater Lake | MNNSDNYLVEWYIAVAKKRGWPAVVKLLAQYPEKEERIKMLIKKRLGK* |
| Ga0133913_121287112 | 3300010885 | Freshwater Lake | MRNNPDDYLAWWYIGVAKKRGWPEVVRLLAQYPEKEERIKQLIKRKLGR* |
| Ga0137575_100479923 | 3300010970 | Pond Fresh Water | LAWWYIGVAKKRGWPEVVRLLAQYPEKEERIKLLIKKKLGR* |
| Ga0157141_10047917 | 3300012346 | Freshwater | LAWWYIGVAKKRGWTEVVRLLAQYPEKEERIKQLIKKKLGK* |
| Ga0157497_100004433 | 3300012664 | Freshwater | LKNNYEYLAWWYIGVAKKRGWDEVVRLLKQYPENEEEIKQLIKKKLGK* |
| Ga0157497_100034913 | 3300012664 | Freshwater | LKNNSDNYLVDWYIGVAKRRGWPEVVRLLAQYPEKEERIKQLIKKRLGK* |
| Ga0136642_11268041 | 3300013285 | Freshwater | LNPDNYLVNWYIAVAKKRGWPEVVRLLAQYPDKEERIKMLIKQRLGK* |
| Ga0136642_11403792 | 3300013285 | Freshwater | LNPDNYLVSWYIAVAKKRGWPEVVRLLAQYPDKEERIKMLIKQRLGK* |
| Ga0182010_106287861 | 3300014490 | Fen | SNLKNNSDDYLAWWYIGVAKKRGWPAVVKLLAQYPEKEERIKQLIKKKLGK* |
| Ga0182021_116223772 | 3300014502 | Fen | LKNNSDDYLAWWYIGVAKKRGWPEVVKLLAQYPEKEERIKMLIKKRLGK* |
| Ga0181347_10996221 | 3300017722 | Freshwater Lake | LKPDNYLVEWYIGVAKKRGWDEVVRLLKQYPKDEERMKKLIKKRLGKT |
| Ga0181347_11535251 | 3300017722 | Freshwater Lake | IGVAKKRGWNEVVRLLKQYPKDEERMKTLIKKRLASERSV |
| Ga0181352_10037438 | 3300017747 | Freshwater Lake | LKNNSDDYLVDWYIGVAQRRGWDEVVRLLAQYPEKEERIKQLIKKRLGK |
| Ga0181352_10478814 | 3300017747 | Freshwater Lake | VKHISDNYLVEWYIGVAKRRGWDVVVKLLKQYPEDEERMKTLIKKRLGHERD |
| Ga0181352_10542052 | 3300017747 | Freshwater Lake | VKHIPDNYLVEWYIGVAKRRGWDVVVRLLKQYPKDEERMKDLIKKRLGK |
| Ga0181352_11349843 | 3300017747 | Freshwater Lake | LKNNSDNYLVEWYIAVAKKRGWPAVVKLLAQYPEKEERIKMLIKKKLGK |
| Ga0181344_10060905 | 3300017754 | Freshwater Lake | VKELTSKHEQYLVDWYIGVAKRRGWDEVVRLLVQEKDQERMKMLIKKRLGK |
| Ga0181344_10201893 | 3300017754 | Freshwater Lake | LNSDDYLAWWYIGVAKKRGWPAVVKLLAQYPEKEERIKQLIKKKLGKIER |
| Ga0181344_10326913 | 3300017754 | Freshwater Lake | LKNNSDDYLAHWYIGVAKRRGWPEVVRLLAQYPEKEERIKQLIKKKLGK |
| Ga0181344_10381374 | 3300017754 | Freshwater Lake | MPNTANKHEDYLVDWYIGVAKRRGWDEVVRLLVQEKDQERMKMLIKKRLGK |
| Ga0181344_10887061 | 3300017754 | Freshwater Lake | NWYIGVAKRRGWDEVVRLLAQYPDIEDEVKQLIKKKLGK |
| Ga0181344_11205362 | 3300017754 | Freshwater Lake | LSSWYIGVAKRRGWDVVVHLLAQYPDIENEVKQEIKRKLGK |
| Ga0181344_11491882 | 3300017754 | Freshwater Lake | LKNNSDDYLAWWYIGVAKRRGWPAVVKLLAQYPEKEERIKQLIKKKLGK |
| Ga0181344_12381232 | 3300017754 | Freshwater Lake | VKHIPDNYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKELIKKKLGKA |
| Ga0181343_10296361 | 3300017766 | Freshwater Lake | LVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKTLIKKRLGHERD |
| Ga0181348_10916422 | 3300017784 | Freshwater Lake | LKPDNYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKELIKKRLGK |
| Ga0181359_100464413 | 3300019784 | Freshwater Lake | VNWYIAVAKKRGWAEVVRLLAQYPEKDERIKMLIKKRLGK |
| Ga0181359_10464585 | 3300019784 | Freshwater Lake | LVDWYIAVAKKRGWAEVVRLLAQYPEKEERIKMLIKKRLGK |
| Ga0211736_100784101 | 3300020151 | Freshwater | PDNYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKTLIKKRLGHERD |
| Ga0211736_106596424 | 3300020151 | Freshwater | VNPDNYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKELIKKRLGK |
| Ga0211734_104107391 | 3300020159 | Freshwater | DVNPDNYLVEWYIGVAKRRGWDEVVRLLKQNPKDEERMKELIKKRLGK |
| Ga0211726_104427621 | 3300020161 | Freshwater | NYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKTLIKKRLGHERD |
| Ga0211729_107603099 | 3300020172 | Freshwater | VKHNPDNYLVEWYIGVAKKRGWDEVVRLLKQYPKDEERMKTLIKKRLGHERD |
| Ga0211731_115950592 | 3300020205 | Freshwater | VKHIPDNYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERIKTLIKKRLNHERD |
| Ga0214217_100052919 | 3300020706 | Freshwater | LKHEEYLVSWYIAVAKKRGWPEVVRLLAQNKETEDRMKMLIKKRLGK |
| Ga0214245_10312454 | 3300020722 | Freshwater | AVAKKRGWPEVVRLLAQNKETEDRMKMLIKKRLGK |
| Ga0214246_10059793 | 3300020727 | Freshwater | LKHEEYLVSWYIAVAKRRGWHEVVRLLAQNKETENRMKMLIKKKLGK |
| Ga0214246_10366282 | 3300020727 | Freshwater | LKHEEYLVDWYIAVAKRRGWPEVVRLLAQNKETEDRMKMLIKKRLGK |
| Ga0214186_1054071 | 3300021112 | Freshwater | WYIGVAKRRGWPEVVRLLAQNKETEERMKMLIKKRLGK |
| Ga0214199_10104532 | 3300021124 | Freshwater | LKHEEYLVSWYIAVAKRRGWPEVVRLLAQNKETEDRMKMLIKKRLGK |
| Ga0214206_10234902 | 3300021131 | Freshwater | MRTNPDDYLVNWYIAVAKRRGWPEVVRLLAQNKETEERMKMLIKKRLGK |
| Ga0214166_10186858 | 3300021139 | Freshwater | VDWYIAVAKKRGWPEVVRLLAQNKETEDRMKMLIKKRLGK |
| Ga0194047_100029298 | 3300021354 | Anoxic Zone Freshwater | LNPDNYLVEWYIAVAKKRGWPAVVKLLAQYPDKEERIKMLIKKRLKK |
| Ga0194048_1000010450 | 3300021519 | Anoxic Zone Freshwater | LNPDNYLVSWYIAVAKKRGWPEVVRLLAQYPEKEERMKMLIKKRLGK |
| Ga0181354_11009482 | 3300022190 | Freshwater Lake | LKNNSDDYLVDWYIAVAKKRGWAEVVRLLAQYPEKEERIKMLIKKRLGK |
| Ga0236341_10696721 | 3300022591 | Freshwater | LKNNSDSYLVNCSIGVAKRRGWDEVVRLLKQYPEKEERMKKLIKQT |
| Ga0228702_10829111 | 3300022748 | Freshwater | YIGVGRRRGWDEVVRLLKQNPETEEKFKQLIKKRLGK |
| Ga0209697_101727724 | 3300025316 | Freshwater Lake Hypolimnion | IGVAKRRGWPEVVRLLAQNKETEERMKMLIKKRLGK |
| Ga0208255_10003125 | 3300025353 | Freshwater | LKHEEYLVSWYIAVAKKRGWPEVVRLLAQYPDKEERIKQLIKKKLGK |
| Ga0208255_1045693 | 3300025353 | Freshwater | LKNNSDNYLVEWYIAVAKRRGWLEVVRLLAQNKETEERMKMLIKKRLGK |
| Ga0207957_10005626 | 3300025372 | Freshwater | LKHEEYLVSWYITVAKRRGWPEVVRLLAQNKETEERMKMLIKKRLGK |
| Ga0207957_10146442 | 3300025372 | Freshwater | LKNNFERYLVDWYIGVAKRRGWPEVVRLLAQNKETEERMKMLIKKRLGK |
| Ga0208738_100006444 | 3300025379 | Freshwater | LKNNSDSYLVDWYIGVAKRRGWDEVVRLLKQYPEKEERMKMLIKQRLGK |
| Ga0208739_100014041 | 3300025426 | Freshwater | LKNNSDSYLVDWYIGVAKRRGWDEVVRLLKQYPEKEERMKMLIKQRL |
| Ga0208739_100136917 | 3300025426 | Freshwater | SYLVDWYIGVAKRRGWDEVVRLLKQYPEKEERMKMLIKQRLGK |
| Ga0208500_10036849 | 3300025429 | Freshwater | YITVAKRRGWPEVVRLLAQNKETEERMKMLIKKRLGK |
| Ga0208500_10187151 | 3300025429 | Freshwater | LKHEEYLVSWYIAVAKRRGWPEVVRLLAQNKETEERMKMLIKKRL |
| Ga0207954_10136578 | 3300025606 | Freshwater | MNPDNYLVEWYIAVAKRRGWPEVVRLLAQYPEKEERMKMLIKKRLGR |
| Ga0207954_10899492 | 3300025606 | Freshwater | LVEWYIAVAKRRGWPEVVRLLAQYPEKEERIKMLIKKRLGK |
| Ga0208783_102734862 | 3300025872 | Aqueous | VNPDNYLVEWYIGVAKKRGWDVVVKLLKQYPKDEERMKTLIKKRLGHERD |
| Ga0208974_10594191 | 3300027608 | Freshwater Lentic | VKHIPDNYLVEWYIGVAKRRGWDVVVKLLKQYPKDEERMKKLIKKRLGRE |
| Ga0209033_11274823 | 3300027697 | Freshwater Lake | VKHIPDNYLVEWYIGVAKRRGWNEVVRLLKQYPKDEERMKELIKKRLGKT |
| Ga0209188_100059445 | 3300027708 | Freshwater Lake | LKNNSDDYLAWWYIGVAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGR |
| Ga0209188_10351696 | 3300027708 | Freshwater Lake | YLAWWYIGVAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGK |
| Ga0209499_10216975 | 3300027712 | Freshwater Lake | MYLVDWYIAVAKKRGWDAVVKLIQQYPDTEAEIKMLIKKRLGK |
| Ga0209499_10371187 | 3300027712 | Freshwater Lake | WYIGVAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGR |
| Ga0209297_100027441 | 3300027733 | Freshwater Lake | LKNNSDDYLAWWYIGVAKKRGWPAVVKLLAQYPEKEERIKQLIKKKLGK |
| Ga0209297_10018826 | 3300027733 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVRLLAQYPEKEERIKMLIKKRLGK |
| Ga0209087_100025455 | 3300027734 | Freshwater Lake | MKNNSDDYLAWWYIGVAKKRGWPEVVRLLAQYPKKEERIKQLIKRKLGK |
| Ga0209087_100046034 | 3300027734 | Freshwater Lake | LKNNSDDYLAWWYIGVAKKRGWDEVIRLLKQYPDKEERIKQLIKKKLGK |
| Ga0209087_100357514 | 3300027734 | Freshwater Lake | LKNNSDDYLAGWYIGVAKRRGWPEVVRLLKQYPEKEERIKQLIKKKLGK |
| Ga0209087_10420015 | 3300027734 | Freshwater Lake | LKNNSDNYLVEWYIAVAKKRGWPAVVKLLAQYPEKEERIKMLIKKRLGK |
| Ga0209087_10459002 | 3300027734 | Freshwater Lake | LKNNSDDYLAWWYIGVAKKRGWPAVVKLLAQYPEKEERIKQLIKKKLGR |
| Ga0209087_10779194 | 3300027734 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPAVVKLLAQYPEKEERIKMLIKKRLGK |
| Ga0209087_11208442 | 3300027734 | Freshwater Lake | LNSDNYLADWYIGVAKRRGWPEVVRLLKQYPEKEERIKQLIKKKLGK |
| Ga0209087_12674612 | 3300027734 | Freshwater Lake | LKNKSDNYLVEWYIAVAKRRGWPEVVKLLAQYPEKEERIKMLIKKRLGK |
| Ga0209190_10312884 | 3300027736 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVRLLAQYPEKEERMKMLIKKRLGK |
| Ga0209190_10350072 | 3300027736 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVRLLAQYPDKEERMKMLIKKRLGK |
| Ga0209085_100486016 | 3300027741 | Freshwater Lake | IGVAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGK |
| Ga0209085_11775702 | 3300027741 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVRLLTQYPEKEERMKMLIKKRLGK |
| Ga0209597_11177992 | 3300027746 | Freshwater Lake | LKNNSDNYLVEWYIAVAKKRGWPEVVKLLAQYPEKEERIKQLIKKKLGK |
| Ga0209597_11302352 | 3300027746 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVRLLKQYPEKEERIKQLIKKKLGK |
| Ga0209597_11937571 | 3300027746 | Freshwater Lake | LKNNSDNYLVEWYIAVAKKRGWPAVIKLLAQYPEKEERIKMLIKKRLGK |
| Ga0209189_10315708 | 3300027747 | Freshwater Lake | DYLAWWYIGVAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGR |
| Ga0209189_13038571 | 3300027747 | Freshwater Lake | KQMYLVDWYIAVAKKRGWDAVVKLIQQYPDTEAEIKMLIKKRLGK |
| Ga0209084_10072301 | 3300027749 | Freshwater Lake | SDDYLAWWYIGVAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGK |
| Ga0209084_101184716 | 3300027749 | Freshwater Lake | LKNNSDDYLAWWYIGVAKKRGWPEVVRLLAQYPEKEERIKQLIKK |
| Ga0209084_10375247 | 3300027749 | Freshwater Lake | SDDYLAWWYIGVAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGR |
| Ga0209084_11635572 | 3300027749 | Freshwater Lake | LKNNSDNYLVEWYIAVAKKRGWPEVVRLLKQYPEKEERIKMLIKKRLGK |
| Ga0209296_10786425 | 3300027759 | Freshwater Lake | LKNNSDNYLVDWYIGVAKRRGWDEVVRLLKQYPEKEERMKMLIKKRLGK |
| Ga0209296_13515822 | 3300027759 | Freshwater Lake | LKNKHEDYLVDWYIGVAKRRGWDEVVRLLVQEKDQERIKMLIKKKLGK |
| Ga0209088_1000233819 | 3300027763 | Freshwater Lake | LKNNSDDYLAWWYIGVAKKRGWPEVVRLLAQYPEKENRIKQLIKKKLGK |
| Ga0209134_100119222 | 3300027764 | Freshwater Lake | LNNRHEDYLVDWYIGIAKRRGWDEVVRLLVQEKDQERMKMLIKKRLGK |
| Ga0209134_101717331 | 3300027764 | Freshwater Lake | LKNNSDDYLVNWYIAVAKKRGWPEVVRLLAQYPEKEERIKQLIKKKLGK |
| Ga0209829_101108733 | 3300027777 | Freshwater Lake | LNSDDYLVWWYIGVAKKRGWDEVVRLLKQYPEKEERIKQLIKKKLGR |
| Ga0209972_100213873 | 3300027793 | Freshwater Lake | VKHIPDNYLVEWYIGVAKRRGWDVVVKLLKQYPKDEERIKTLIKKRLASERSV |
| Ga0209358_1000485610 | 3300027804 | Freshwater Lake | VKHIPDKYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKTLIKKRLGHERD |
| Ga0209358_101247884 | 3300027804 | Freshwater Lake | VKHIPDNYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERIKTLIKKRLASERSV |
| Ga0209262_100540243 | 3300027841 | Freshwater | LKNNYEYLAWWYIGVAKKRGWDEVVRLLKQYPEIEEEMKQLIKKKLGR |
| Ga0209668_109293622 | 3300027899 | Freshwater Lake Sediment | LKNNYEYLAWWYIGVSKKRGWDEVVRLLKQYPESEEEIKQLIKKKLGR |
| Ga0209253_107263023 | 3300027900 | Freshwater Lake Sediment | VKHKPDNYLVEWYIGVAKKRGWDEVVRLLKQYPKDEERIKTLIKKRLASERSV |
| Ga0209048_100873818 | 3300027902 | Freshwater Lake Sediment | LVEWYIAVAKRRGWPEVVKLLAQYPDKEERMKMLIKKRLGK |
| Ga0209400_100051333 | 3300027963 | Freshwater Lake | MNNNVDNYLAWWYIGVAKKRGWPEVVKLLAQYPEKEERIKQLIKKKLGK |
| Ga0209400_100237924 | 3300027963 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVKLLAQYPEKEERIKMLIKKRLGK |
| Ga0209400_11220972 | 3300027963 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVRLLAQYPDKEKRMKMLIKKRLGK |
| Ga0209400_11918491 | 3300027963 | Freshwater Lake | LKNNSDNYLVEWYIAVAKKRGWPAVVKLLAQYPEKEERIKQLIKKKLGR |
| Ga0209191_11457772 | 3300027969 | Freshwater Lake | LVEWYIAVAKRRGWPEVVRLLAQYPEKEERMKMLIKKRLGK |
| Ga0209298_100244722 | 3300027973 | Freshwater Lake | LKNNSDDYLAWWYIGVAKKRGWPEVVKLLAQYPEKEERIKQLIKKKLGR |
| Ga0209298_101178193 | 3300027973 | Freshwater Lake | LKNNSDNYLVEWYIAVAKRRGWPEVVKLLKQYPEKEERIKMLIKKKLGK |
| Ga0247723_100086330 | 3300028025 | Deep Subsurface Sediment | LKNNSDEYLAWWYIGVAKKRGWPAVVKLLAQYPEKEERIKQLIKKKLGK |
| Ga0247723_10348094 | 3300028025 | Deep Subsurface Sediment | LKNRHDDYLVNWYIGVAKRRGWDVVVHLLAQYPNDEERMKMLIKKRLGK |
| Ga0304728_12302602 | 3300028393 | Freshwater Lake | LKNKSDDYLVDWYIAVAKRRGWPEVVKLLAQYPDKEERIKMLIKKRLGK |
| Ga0239581_10239276 | 3300029798 | Freshwater Lake | LKNNSERYLTDWYIGVAKRRGWPEVVRLLAQNKETEDRMKMLIKKRLGK |
| Ga0315907_105048813 | 3300031758 | Freshwater | VKHIPDKYLVEWYIGVAKRRGWDEVVRLLKQYPEDEERIKTLIKKRLASER |
| Ga0315288_109646822 | 3300031772 | Sediment | LNPDDYLVNWYIAVAKKRGWPEVVRLLAQYPKKEERMKMLIKKRLGK |
| Ga0315899_114736212 | 3300031784 | Freshwater | VKHIPDNYLVEWYIGVAKRRGWDEVVRLLKQYPEDEERMKTLIKKRLGHERD |
| Ga0315900_110056812 | 3300031787 | Freshwater | VKHIPDNYLVEWYIGVAKRRGWDVVVKLLKQYPQDEERMKMLIKKRLGK |
| Ga0315909_104639942 | 3300031857 | Freshwater | VKHIPDNYLVEWYIGVAKKRGWDEVVRLLKQYPKDEERMKDLIKKRLGK |
| Ga0315909_106501382 | 3300031857 | Freshwater | VKHIPDNYLVEWYIGVAKKRGWDVVVKLLKQYPKDEERMKKLIKKRLGRE |
| Ga0315904_102647426 | 3300031951 | Freshwater | VKHNPDNYLVEWYIGVAKRRGWDEVVRLLKQFPKDEERMKELIKKRLGYERN |
| Ga0315904_106095932 | 3300031951 | Freshwater | NYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKDLIKKRLGK |
| Ga0315901_101438713 | 3300031963 | Freshwater | VKHIPDKYLVEWYIGVAKRRGWDEVVRLLKQYPEDEERIKTLIKKRLASERSV |
| Ga0315274_107393382 | 3300031999 | Sediment | LKNNSDDYLVNWYIAVAKKRGWPEVVRLLAQYPKKEERMKMLIKKRLGK |
| Ga0315274_107851562 | 3300031999 | Sediment | LKPDNYLVEWYIGVAKKRGWNEVVRLLKQYPKDEERMKELIKKRLGKT |
| Ga0315906_108303743 | 3300032050 | Freshwater | HEDYLVDWYIGVAKRRGWNEVVRLLVQEKDQERMKMLIKKRLGK |
| Ga0315284_105626126 | 3300032053 | Sediment | LKNNSDDYLVNWYIAVAKKRGWSEVVRLLAQYPDKEERMKMLIKKRLGK |
| Ga0315903_109600241 | 3300032116 | Freshwater | LVEWYIGVAKKRGWDEVVRLLKQYPKDEERMKDLIKKRLGK |
| Ga0315277_102554311 | 3300032118 | Sediment | GVAKRRGWPEVVRLLAQYPDKEERIKQLIKRKLGK |
| Ga0334987_0089273_916_1065 | 3300034061 | Freshwater | LKNKHEDYLVDWYIGVAKRRGWDEVVRLLAQNKETEDRIKMLIKKRLGK |
| Ga0335036_0618233_503_655 | 3300034106 | Freshwater | MKHIPDNYLVEWYIGVAKRRGWDEVVRLLKQYPKDEERMKTLIKKRLGHER |
| Ga0335007_0602750_168_326 | 3300034283 | Freshwater | VKHIPDNYLVEWYIGVAKRRGWDVVVKLLKQYPKDEERMKTLIKKRLGHERD |
| ⦗Top⦘ |