| Basic Information | |
|---|---|
| Family ID | F017228 |
| Family Type | Metagenome |
| Number of Sequences | 242 |
| Average Sequence Length | 37 residues |
| Representative Sequence | VSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERNR |
| Number of Associated Samples | 190 |
| Number of Associated Scaffolds | 242 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 68.05 % |
| % of genes near scaffold ends (potentially truncated) | 11.16 % |
| % of genes from short scaffolds (< 2000 bps) | 80.17 % |
| Associated GOLD sequencing projects | 181 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.760 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.744 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.033 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.298 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.12% β-sheet: 0.00% Coil/Unstructured: 46.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 242 Family Scaffolds |
|---|---|---|
| PF03100 | CcmE | 47.93 |
| PF01578 | Cytochrom_C_asm | 13.22 |
| PF08281 | Sigma70_r4_2 | 2.89 |
| PF16327 | CcmF_C | 2.48 |
| PF09364 | XFP_N | 2.07 |
| PF09699 | Paired_CXXCH_1 | 2.07 |
| PF03379 | CcmB | 1.65 |
| PF12706 | Lactamase_B_2 | 1.24 |
| PF16576 | HlyD_D23 | 0.83 |
| PF00005 | ABC_tran | 0.83 |
| PF13462 | Thioredoxin_4 | 0.83 |
| PF02852 | Pyr_redox_dim | 0.83 |
| PF13185 | GAF_2 | 0.41 |
| PF00376 | MerR | 0.41 |
| PF13557 | Phenol_MetA_deg | 0.41 |
| PF04014 | MazE_antitoxin | 0.41 |
| PF04028 | DUF374 | 0.41 |
| PF07690 | MFS_1 | 0.41 |
| PF14686 | fn3_3 | 0.41 |
| PF00691 | OmpA | 0.41 |
| PF07676 | PD40 | 0.41 |
| PF13463 | HTH_27 | 0.41 |
| PF02979 | NHase_alpha | 0.41 |
| PF13517 | FG-GAP_3 | 0.41 |
| PF00115 | COX1 | 0.41 |
| PF08309 | LVIVD | 0.41 |
| PF01040 | UbiA | 0.41 |
| PF07992 | Pyr_redox_2 | 0.41 |
| PF01041 | DegT_DnrJ_EryC1 | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 242 Family Scaffolds |
|---|---|---|---|
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 47.93 |
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 1.65 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.41 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.41 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.41 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.41 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.41 |
| COG2121 | Uncharacterized conserved protein, lysophospholipid acyltransferase (LPLAT) superfamily | Function unknown [S] | 0.41 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.41 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.76 % |
| Unclassified | root | N/A | 1.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908032|Perma_A_C_ConsensusfromContig147637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 808 | Open in IMG/M |
| 2162886012|MBSR1b_contig_7298227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 982 | Open in IMG/M |
| 2162886013|SwBSRL2_contig_2847455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1263 | Open in IMG/M |
| 2162886013|SwBSRL2_contig_9305598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
| 2209111007|2215194924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300005328|Ga0070676_11055421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300005332|Ga0066388_105831813 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005526|Ga0073909_10080851 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300005526|Ga0073909_10493964 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005543|Ga0070672_100002320 | All Organisms → cellular organisms → Bacteria | 12024 | Open in IMG/M |
| 3300005545|Ga0070695_100517510 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300005548|Ga0070665_100036253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 4962 | Open in IMG/M |
| 3300005549|Ga0070704_100643956 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300005561|Ga0066699_10255060 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300005563|Ga0068855_100691556 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300005568|Ga0066703_10549881 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005598|Ga0066706_11372290 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005618|Ga0068864_101323687 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300005719|Ga0068861_100379836 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300005764|Ga0066903_100079506 | All Organisms → cellular organisms → Bacteria | 4269 | Open in IMG/M |
| 3300005764|Ga0066903_101047097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1498 | Open in IMG/M |
| 3300005764|Ga0066903_102031849 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300005764|Ga0066903_102232507 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300005764|Ga0066903_103277923 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300005764|Ga0066903_106109410 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005836|Ga0074470_11622583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300005843|Ga0068860_101598639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300005937|Ga0081455_10010664 | All Organisms → cellular organisms → Bacteria | 9296 | Open in IMG/M |
| 3300005938|Ga0066795_10056941 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300005993|Ga0080027_10152203 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300005994|Ga0066789_10459782 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005995|Ga0066790_10147546 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300006046|Ga0066652_100970072 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300006163|Ga0070715_11044867 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006173|Ga0070716_100976366 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006237|Ga0097621_100308804 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300006796|Ga0066665_10345651 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300006852|Ga0075433_10324758 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300006852|Ga0075433_11837676 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006854|Ga0075425_100534107 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300006854|Ga0075425_100673447 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300006854|Ga0075425_101378807 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300006871|Ga0075434_101937433 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300006876|Ga0079217_10092927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1336 | Open in IMG/M |
| 3300006881|Ga0068865_100054162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2786 | Open in IMG/M |
| 3300006894|Ga0079215_11271802 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006904|Ga0075424_100768475 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300009012|Ga0066710_100439847 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300009012|Ga0066710_102299339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300009029|Ga0066793_10015235 | All Organisms → cellular organisms → Bacteria | 4123 | Open in IMG/M |
| 3300009038|Ga0099829_11458174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300009053|Ga0105095_10163166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1218 | Open in IMG/M |
| 3300009089|Ga0099828_10038341 | All Organisms → cellular organisms → Bacteria | 3910 | Open in IMG/M |
| 3300009090|Ga0099827_10329232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1296 | Open in IMG/M |
| 3300009147|Ga0114129_10065768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 5060 | Open in IMG/M |
| 3300009157|Ga0105092_10006724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6057 | Open in IMG/M |
| 3300009157|Ga0105092_10263698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300009168|Ga0105104_10484564 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300009174|Ga0105241_12119171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300009792|Ga0126374_10106465 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300009803|Ga0105065_1026211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 721 | Open in IMG/M |
| 3300010043|Ga0126380_12271626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300010046|Ga0126384_10218801 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
| 3300010046|Ga0126384_10457250 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300010336|Ga0134071_10180316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1036 | Open in IMG/M |
| 3300010358|Ga0126370_10821916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300010358|Ga0126370_11645498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300010359|Ga0126376_10909683 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300010360|Ga0126372_11014495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300010361|Ga0126378_10775235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1069 | Open in IMG/M |
| 3300010361|Ga0126378_12304831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300010391|Ga0136847_11298733 | All Organisms → cellular organisms → Bacteria | 12501 | Open in IMG/M |
| 3300010398|Ga0126383_11553863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300010398|Ga0126383_13304911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300010401|Ga0134121_10145594 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
| 3300010937|Ga0137776_1167388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 3166 | Open in IMG/M |
| 3300011270|Ga0137391_10226559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1623 | Open in IMG/M |
| 3300011270|Ga0137391_10817669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300011414|Ga0137442_1134602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300012164|Ga0137352_1071602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300012201|Ga0137365_10081276 | All Organisms → cellular organisms → Bacteria | 2442 | Open in IMG/M |
| 3300012204|Ga0137374_10034630 | All Organisms → cellular organisms → Bacteria | 5451 | Open in IMG/M |
| 3300012204|Ga0137374_10152316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2062 | Open in IMG/M |
| 3300012206|Ga0137380_10097660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 2683 | Open in IMG/M |
| 3300012206|Ga0137380_11147258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300012209|Ga0137379_11435178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300012209|Ga0137379_11624417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300012210|Ga0137378_10463933 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300012211|Ga0137377_10447964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1229 | Open in IMG/M |
| 3300012285|Ga0137370_10873972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300012350|Ga0137372_10588239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300012353|Ga0137367_10131817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1831 | Open in IMG/M |
| 3300012353|Ga0137367_10313388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1121 | Open in IMG/M |
| 3300012354|Ga0137366_10068762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2699 | Open in IMG/M |
| 3300012354|Ga0137366_10782267 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012355|Ga0137369_10466491 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300012357|Ga0137384_10725982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300012358|Ga0137368_10164789 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300012360|Ga0137375_10074533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3566 | Open in IMG/M |
| 3300012360|Ga0137375_11158525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300012361|Ga0137360_11546837 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012493|Ga0157355_1030291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300012931|Ga0153915_10298112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1799 | Open in IMG/M |
| 3300012948|Ga0126375_11086738 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300012951|Ga0164300_10467673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300012957|Ga0164303_10620360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 715 | Open in IMG/M |
| 3300012957|Ga0164303_11074929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300012960|Ga0164301_10300619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1080 | Open in IMG/M |
| 3300012961|Ga0164302_10831128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300012971|Ga0126369_10307508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1589 | Open in IMG/M |
| 3300012972|Ga0134077_10249858 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300012989|Ga0164305_11043456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300013306|Ga0163162_11854602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
| 3300013764|Ga0120111_1162857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300014154|Ga0134075_10548354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300014326|Ga0157380_12776715 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300014882|Ga0180069_1186710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300014969|Ga0157376_12045849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300015085|Ga0167632_1047998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300015090|Ga0167634_1021662 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300015371|Ga0132258_10067372 | All Organisms → cellular organisms → Bacteria | 8285 | Open in IMG/M |
| 3300015371|Ga0132258_10162926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 5364 | Open in IMG/M |
| 3300015371|Ga0132258_10824244 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
| 3300015372|Ga0132256_100689422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1137 | Open in IMG/M |
| 3300015373|Ga0132257_100270584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 2034 | Open in IMG/M |
| 3300015374|Ga0132255_101382891 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300015374|Ga0132255_103603561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 658 | Open in IMG/M |
| 3300017654|Ga0134069_1316374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300017927|Ga0187824_10037966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1465 | Open in IMG/M |
| 3300017930|Ga0187825_10066347 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300017944|Ga0187786_10197715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300017947|Ga0187785_10256684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300017959|Ga0187779_10041268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 2676 | Open in IMG/M |
| 3300017961|Ga0187778_10416537 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300017961|Ga0187778_10806240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300017961|Ga0187778_11074386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300017966|Ga0187776_10126143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1551 | Open in IMG/M |
| 3300017974|Ga0187777_10007260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 6976 | Open in IMG/M |
| 3300017974|Ga0187777_10110342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1814 | Open in IMG/M |
| 3300017997|Ga0184610_1254196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300018000|Ga0184604_10078052 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300018027|Ga0184605_10436873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300018031|Ga0184634_10064793 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300018031|Ga0184634_10202445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
| 3300018031|Ga0184634_10218230 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300018052|Ga0184638_1053061 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300018052|Ga0184638_1137304 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300018053|Ga0184626_10214205 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300018056|Ga0184623_10023269 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
| 3300018058|Ga0187766_10012283 | All Organisms → cellular organisms → Bacteria | 4900 | Open in IMG/M |
| 3300018058|Ga0187766_10939519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300018059|Ga0184615_10002968 | All Organisms → cellular organisms → Bacteria | 9118 | Open in IMG/M |
| 3300018060|Ga0187765_11255544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300018061|Ga0184619_10349300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300018063|Ga0184637_10103414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1754 | Open in IMG/M |
| 3300018068|Ga0184636_1206108 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300018071|Ga0184618_10505326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300018074|Ga0184640_10432411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300018077|Ga0184633_10047024 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300018082|Ga0184639_10026363 | All Organisms → cellular organisms → Bacteria | 2940 | Open in IMG/M |
| 3300018084|Ga0184629_10007960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 4031 | Open in IMG/M |
| 3300018084|Ga0184629_10214507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 998 | Open in IMG/M |
| 3300018422|Ga0190265_10178205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 2113 | Open in IMG/M |
| 3300018431|Ga0066655_11134570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300018468|Ga0066662_10658983 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300018482|Ga0066669_10002074 | All Organisms → cellular organisms → Bacteria | 8088 | Open in IMG/M |
| 3300021073|Ga0210378_10018278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 2851 | Open in IMG/M |
| 3300021081|Ga0210379_10015516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2834 | Open in IMG/M |
| 3300021445|Ga0182009_10112099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1258 | Open in IMG/M |
| 3300021476|Ga0187846_10035929 | All Organisms → cellular organisms → Bacteria | 2230 | Open in IMG/M |
| 3300021478|Ga0210402_10003815 | All Organisms → cellular organisms → Bacteria | 13976 | Open in IMG/M |
| 3300021560|Ga0126371_10426531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1470 | Open in IMG/M |
| 3300021560|Ga0126371_10555006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1297 | Open in IMG/M |
| 3300021560|Ga0126371_11306952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300023069|Ga0247751_1059155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300025324|Ga0209640_10022321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 5521 | Open in IMG/M |
| 3300025324|Ga0209640_10927842 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300025551|Ga0210131_1092261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300025899|Ga0207642_10306793 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300025904|Ga0207647_10552896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300025910|Ga0207684_10002282 | All Organisms → cellular organisms → Bacteria | 19506 | Open in IMG/M |
| 3300025910|Ga0207684_10036474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4173 | Open in IMG/M |
| 3300025922|Ga0207646_10393796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1251 | Open in IMG/M |
| 3300025922|Ga0207646_10494197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1103 | Open in IMG/M |
| 3300025922|Ga0207646_11585030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300025936|Ga0207670_10931402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300025939|Ga0207665_10630593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300025942|Ga0207689_11493625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300025960|Ga0207651_11242840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300026067|Ga0207678_10369807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1238 | Open in IMG/M |
| 3300026089|Ga0207648_11295157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300026281|Ga0209863_10086186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300026294|Ga0209839_10097331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300026320|Ga0209131_1210010 | Not Available | 882 | Open in IMG/M |
| 3300026350|Ga0256823_1037420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300026538|Ga0209056_10253571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1249 | Open in IMG/M |
| 3300027252|Ga0209973_1033602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300027665|Ga0209983_1090689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300027667|Ga0209009_1000200 | All Organisms → cellular organisms → Bacteria | 24371 | Open in IMG/M |
| 3300027722|Ga0209819_10028293 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
| 3300027821|Ga0209811_10237205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300027902|Ga0209048_10000689 | All Organisms → cellular organisms → Bacteria | 35713 | Open in IMG/M |
| 3300027902|Ga0209048_10028650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 4743 | Open in IMG/M |
| 3300028379|Ga0268266_10998522 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300028381|Ga0268264_12603839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300030606|Ga0299906_10514200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300030620|Ga0302046_10360295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1195 | Open in IMG/M |
| 3300031235|Ga0265330_10120740 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300031238|Ga0265332_10232226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300031640|Ga0318555_10397113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300031716|Ga0310813_11630297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300031720|Ga0307469_10078180 | All Organisms → cellular organisms → Bacteria | 2228 | Open in IMG/M |
| 3300031720|Ga0307469_10595025 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300031720|Ga0307469_12257155 | Not Available | 530 | Open in IMG/M |
| 3300031740|Ga0307468_100194040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1365 | Open in IMG/M |
| 3300031740|Ga0307468_100297655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1169 | Open in IMG/M |
| 3300031820|Ga0307473_10893334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300031820|Ga0307473_11011063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300031834|Ga0315290_10486189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1078 | Open in IMG/M |
| 3300032059|Ga0318533_11410511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300032174|Ga0307470_11253965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300032180|Ga0307471_100161897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2174 | Open in IMG/M |
| 3300032180|Ga0307471_100974726 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300032180|Ga0307471_101369858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300032180|Ga0307471_104062307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300032205|Ga0307472_100217561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1468 | Open in IMG/M |
| 3300032205|Ga0307472_102251607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300032770|Ga0335085_10030367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7544 | Open in IMG/M |
| 3300032783|Ga0335079_10444478 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300032828|Ga0335080_10557996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1209 | Open in IMG/M |
| 3300033004|Ga0335084_10104325 | All Organisms → cellular organisms → Bacteria | 2945 | Open in IMG/M |
| 3300033004|Ga0335084_11985818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300033408|Ga0316605_10937556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300033480|Ga0316620_11565592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300033513|Ga0316628_100059774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4025 | Open in IMG/M |
| 3300033550|Ga0247829_10483901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1024 | Open in IMG/M |
| 3300033550|Ga0247829_10754890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300033803|Ga0314862_0148203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300033814|Ga0364930_0151294 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300033815|Ga0364946_152610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300034176|Ga0364931_0328924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.74% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.02% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.65% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.24% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.24% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.24% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.24% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.41% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.41% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.41% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.41% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.41% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.41% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.41% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.41% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.41% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.41% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.41% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.41% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.41% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.41% |
| Speleothem And Rock Wall Surfaces | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.41% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.41% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 2209111007 | Cave microbial community (Dry rock wall) | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015090 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026350 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU6 | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Perma_A_C_02630880 | 2124908032 | Soil | TMSSLAFLASVNAVIWVGLFFYLWRLDRRISARERER |
| MBSR1b_0482.00000440 | 2162886012 | Miscanthus Rhizosphere | VSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERTR |
| SwBSRL2_0317.00004620 | 2162886013 | Switchgrass Rhizosphere | FVSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERTR |
| SwBSRL2_0524.00003610 | 2162886013 | Switchgrass Rhizosphere | VSSLAFLAVVNIVIWAGLFLYVWRLDRRLAEMEKNR |
| 2214270358 | 2209111007 | Speleothem And Rock Wall Surfaces | TRIMSALGYLAAVNVVIWVGLFFYLWRLDRRISERERSR |
| Ga0070676_110554212 | 3300005328 | Miscanthus Rhizosphere | FGVVPRQTEPVSSLAYLALVNVVVWVGLFLYLWRLERRISEQERNR* |
| Ga0066388_1058318132 | 3300005332 | Tropical Forest Soil | VSSLGFLAAVNVVVWVGLFLYLWRLDRRISEAERERPKG* |
| Ga0070698_1009434781 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ETGSVRSLGYLAAVNVVIWVGLFLYLWRLDRRISEAERKP* |
| Ga0073909_100808513 | 3300005526 | Surface Soil | VSSLAFLATVNLVIWAGLFFYLWRLDRRISARERER* |
| Ga0073909_104939641 | 3300005526 | Surface Soil | VNSLAFLATVNVVIWAGLFFYLWRLDRRIAARERER* |
| Ga0070672_10000232012 | 3300005543 | Miscanthus Rhizosphere | VSSLGYLAAVNVVVWVGLFFYLWRLDRRIEQLDRRR* |
| Ga0070695_1005175103 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSLGCLAAVNVVVWVGLFLYLWRLDRRITEREKEAGALRR* |
| Ga0070665_1000362535 | 3300005548 | Switchgrass Rhizosphere | MTSLGYLAAVNVVIWIGLFVYLWRLDRRVSEKERSR* |
| Ga0070704_1006439561 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VIHRQTAPVSSLAYLAAVNVVVWVGLFLYLWRLDRRISEQERNR* |
| Ga0066699_102550602 | 3300005561 | Soil | MRSLGYLAAVNVVIWVGLFFYLWRLDRRISEKERSR* |
| Ga0068855_1006915562 | 3300005563 | Corn Rhizosphere | VSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERTR* |
| Ga0066703_105498812 | 3300005568 | Soil | VSSLGFLAAVNIVIWIGLFFYVWRLDRRLTERERDR* |
| Ga0066706_113722901 | 3300005598 | Soil | PRMSLVFLAAVNVIIWTGLFVYLWRLDRRISAREKEQ* |
| Ga0068864_1013236872 | 3300005618 | Switchgrass Rhizosphere | MNSLGYLAAVNVVIWVGLFAYLWRLDRRVSERERS* |
| Ga0068861_1003798361 | 3300005719 | Switchgrass Rhizosphere | VGSLGYLAAVNVVVWVGLFLYLWRLDRRLAEAEKKELR* |
| Ga0066903_1000795065 | 3300005764 | Tropical Forest Soil | VNSLAFLAAVNVVIWVGLFFYLWRLDRRVTEREREK* |
| Ga0066903_1010470973 | 3300005764 | Tropical Forest Soil | VGSLGYLAAVNVVIWVGLFVYLWRLDRRVSDVERKS* |
| Ga0066903_1020318493 | 3300005764 | Tropical Forest Soil | VNSLGYLAAVNLVIWAGLFFYVWRLDRRISEKEREP* |
| Ga0066903_1022325072 | 3300005764 | Tropical Forest Soil | VSSLAYLAAVNLVIWVGLFFYLWRLDRRISQKGDQ* |
| Ga0066903_1032779232 | 3300005764 | Tropical Forest Soil | VSSLGYLAAVNVVVWFGLFFYLWRLDRRIDRLDRRRQETR* |
| Ga0066903_1061094102 | 3300005764 | Tropical Forest Soil | VNSLAYLAAVNILIWVGLFAYLWRLDRRLGLLEAERERKR* |
| Ga0074470_116225832 | 3300005836 | Sediment (Intertidal) | MSSLGYLAAVNVVIWVGLFFYLWRLDRRLTESERKS* |
| Ga0068860_1015986391 | 3300005843 | Switchgrass Rhizosphere | MSSLGFLAVVNGVIWGGLFFHLWRLDRRIAGKGTEK* |
| Ga0081455_100106645 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VGSLGYLAAVNVVIWVGLFLYLWRLDRRISEAERKP* |
| Ga0066795_100569412 | 3300005938 | Soil | MSSLAFLASVNAVIWVGLFFYLWRLDRRISARERER* |
| Ga0080027_101522032 | 3300005993 | Prmafrost Soil | VNSLAFLAAVNVVIWVGLFVYLWRLDRRISERERDR* |
| Ga0066789_104597822 | 3300005994 | Soil | MSSLGYLAAVNVVIWVGLFAYLWRLDRRLADGEGGR* |
| Ga0066790_101475463 | 3300005995 | Soil | MNSLAFLAAVNLVIWLGLFLFLWRLDRKISERERNR* |
| Ga0066652_1009700721 | 3300006046 | Soil | VSLVFLAAVNVIIWTGLFVYLWRLDRRISAREKEQ* |
| Ga0070715_110448671 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSLGYLAAVNLVIWAGLFFYVWRLDRRISEKEREP* |
| Ga0070716_1009763662 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VNSSLAFLAAVNLVIWAGLFAYLWRLDRRISERERER* |
| Ga0097621_1003088043 | 3300006237 | Miscanthus Rhizosphere | VSSLGYLAAVNVVVWFGLFFFLWRLDRRIEQLDRRR* |
| Ga0066665_103456512 | 3300006796 | Soil | VNSLFFLAAVNVVIWVGLFFYLWRLDRRISAREGER* |
| Ga0075433_103247583 | 3300006852 | Populus Rhizosphere | VNSLAFLAAVNLVIWAGLFFYLWRLDRQLSERERQE* |
| Ga0075433_118376762 | 3300006852 | Populus Rhizosphere | VSSLAYLAIVNIVIWAGLFLYLWRLDRRLTERERNR* |
| Ga0075425_1005341072 | 3300006854 | Populus Rhizosphere | VHSLRYLAAVNVVVWAGLFFYLWRLDRRVSERERRDGEES* |
| Ga0075425_1006734471 | 3300006854 | Populus Rhizosphere | MTSLGYLAAVNIVIWIGLFVYLWRLDRRVSEKERSR* |
| Ga0075425_1013788072 | 3300006854 | Populus Rhizosphere | VRSLAYLAAVNVVIWVGLFLYLWRLDRRISERESSR* |
| Ga0075434_1019374332 | 3300006871 | Populus Rhizosphere | VNSLAFLAAVNVIIWAGLFFYLWRLDQRIARKEKER* |
| Ga0079217_100929273 | 3300006876 | Agricultural Soil | VNSLAFLATVNVVVWAGLFLYLWRLDRRITERERNR* |
| Ga0068865_1000541624 | 3300006881 | Miscanthus Rhizosphere | VSSLGYLAAVNVVVCVGLFFYLWRLDRRIEQLDRRR* |
| Ga0079215_112718021 | 3300006894 | Agricultural Soil | VNSLAFLATVNVVVWAGLFLYLWRLDRRIAERERNR* |
| Ga0075424_1007684751 | 3300006904 | Populus Rhizosphere | VSSLAYLAAVNLVIWVGLFYYLWRLDRRISQKGGDQ* |
| Ga0066710_1004398473 | 3300009012 | Grasslands Soil | MNSLAFLATVNVVIWVGLFFYLWRLDRRISARERER |
| Ga0066710_1022993392 | 3300009012 | Grasslands Soil | VNSLVFLAGVNVVIWAGLFFYLWRLDRRISAREEER |
| Ga0066793_100152351 | 3300009029 | Prmafrost Soil | QERNNRTMSSLAFLASVNAVIWVGLFFYLWRLDRRISTRERER* |
| Ga0099829_114581742 | 3300009038 | Vadose Zone Soil | VSSLGFLAAVNVVIWVGLFFYLWRIDRRIAEKERES* |
| Ga0105095_101631662 | 3300009053 | Freshwater Sediment | VKSLGYLAAVNVVIWVGLYFYLWRLDRRLTESERKP* |
| Ga0099828_100383413 | 3300009089 | Vadose Zone Soil | VSSLGFLAAVNVVIWVGLFFYLWRIDRRIAEKERER* |
| Ga0099827_103292322 | 3300009090 | Vadose Zone Soil | VNSLAFLAAVNVVIWVGLFFYLWRIDRRIAEKEQGR* |
| Ga0114129_100657683 | 3300009147 | Populus Rhizosphere | VSSLAYLAAVNIVIWIGLFFYVWRLDRRLTERERNR* |
| Ga0105092_100067245 | 3300009157 | Freshwater Sediment | VGSLGYLAAVNVVIWVGLFVYLWRLDRRISEAERKS* |
| Ga0105092_102636983 | 3300009157 | Freshwater Sediment | VSSLGYLAAVNVVVWAGLFFYLWRLDRRLSEKEREP* |
| Ga0105104_104845642 | 3300009168 | Freshwater Sediment | MSSLGYLAAVNVVIWVGLFAYLWRLDRRLSEKESGR* |
| Ga0105241_121191711 | 3300009174 | Corn Rhizosphere | PLVSLVFLAAVNVIIWIGLFAYLWRLDRRISARERER* |
| Ga0126374_101064653 | 3300009792 | Tropical Forest Soil | VSSLAFLATVNVVIWAGLFFYLWRLDRRIAARERER* |
| Ga0105065_10262112 | 3300009803 | Groundwater Sand | VRSLGYLAAVNVVIWVGLFLYLWRLDRRIAESERER* |
| Ga0126380_122716262 | 3300010043 | Tropical Forest Soil | VSSLAYLAAVNVVIWVGLFFYLWRLDRRISQKGGDQ* |
| Ga0126384_102188012 | 3300010046 | Tropical Forest Soil | MNSLFFLAAVNVVIWVGLFFYIWRLDRRLAERERER* |
| Ga0126384_104572502 | 3300010046 | Tropical Forest Soil | MNSLAFLATVNVVIWVGLFLYLWRLDRRISARERER* |
| Ga0134071_101803161 | 3300010336 | Grasslands Soil | GLGEKDRRVSSLAYLAVVNIVIWAGLFLYLWRLDRRLTERERDR* |
| Ga0126370_108219162 | 3300010358 | Tropical Forest Soil | MNSLAFLAAVNVVIWVGLFFYLWRLDRRISARERER* |
| Ga0126370_116454981 | 3300010358 | Tropical Forest Soil | VSSLAYLAAVNLVIWVGLFFYLWRLDRRISQKGGDQ* |
| Ga0126376_109096832 | 3300010359 | Tropical Forest Soil | VGSLGYLAAVNVVIWVGLFVYLWRLDRRVSEGERKP* |
| Ga0126372_110144952 | 3300010360 | Tropical Forest Soil | VNSLAYLAAVNILIWVGLFAYLWRLDRRLALMEAEKEKER* |
| Ga0126378_107752353 | 3300010361 | Tropical Forest Soil | VSSLAYLALVNLVIWVGLFFYVWRLDRRVSRKESDQ* |
| Ga0126378_123048312 | 3300010361 | Tropical Forest Soil | VGSLGYLAAVNVVIWVGLFVYLWRLDRRVSDAERKP* |
| Ga0136847_1129873313 | 3300010391 | Freshwater Sediment | VSSLAYLAAANVVIWVGLFLYLWRLDRRISSKEREP* |
| Ga0126383_115538633 | 3300010398 | Tropical Forest Soil | MTSLGYLAAVNVVIWVGLFVYLWRLDRRVSEKERSR* |
| Ga0126383_133049111 | 3300010398 | Tropical Forest Soil | VGSLGYLAAVNVVIWVGLFFYLWRLDRRIAEIEKTERSAR* |
| Ga0134121_101455942 | 3300010401 | Terrestrial Soil | VNSLAFLAAVNLVIWTGLFVYLWRLDGKISEREREH* |
| Ga0137776_11673883 | 3300010937 | Sediment | VGSLGYLAAVNVVIWVGLFVYLWRLDRRLSDAERKS* |
| Ga0137391_102265593 | 3300011270 | Vadose Zone Soil | VNSLLFLAAVNVVIWVGLFFYLWRLDRRISAREGER* |
| Ga0137391_108176692 | 3300011270 | Vadose Zone Soil | MNSLFFLASVNVVIWVGLFFYLWRIDRRIAEKERGG* |
| Ga0137442_11346021 | 3300011414 | Soil | VSSLAYLATVNVVVWVGLFVYLWRLDRRISERERNR* |
| Ga0137352_10716022 | 3300012164 | Soil | VSSLAYLAAVNVVVWVGLFLYLWRIDRRIAEQERNR* |
| Ga0137365_100812763 | 3300012201 | Vadose Zone Soil | LVSSLAFLAAVNVVIWIGLFFYVWRLDRRLTERERNR* |
| Ga0137374_100346302 | 3300012204 | Vadose Zone Soil | MSSLAFLAAVNIVIWIGLFFYVWRLDRRLTQRERNR* |
| Ga0137374_101523163 | 3300012204 | Vadose Zone Soil | VNSLTFLAAVNVVIWVGLFGYLWWLDRRLTEREKQQ* |
| Ga0137380_100976602 | 3300012206 | Vadose Zone Soil | VSSLAFLAAVNVVIWIGLFFYVWRLDRRLTERERNR* |
| Ga0137380_111472582 | 3300012206 | Vadose Zone Soil | MNSLFFLASVNVVIWVGLFFYLWRIDRRIAEKERES* |
| Ga0137379_114351782 | 3300012209 | Vadose Zone Soil | MSSLAYLAVVNVVIWIGLFFYIWRLDRRVSRKESER* |
| Ga0137379_116244171 | 3300012209 | Vadose Zone Soil | MNSLFFLASVNVVIWVGLFFYLWRIDRRIAEKEREG* |
| Ga0137378_104639332 | 3300012210 | Vadose Zone Soil | MNSLFFLASVNVVIWVGLFFYLWRIDRRSAETEREG* |
| Ga0137377_104479643 | 3300012211 | Vadose Zone Soil | VNSLAFLAAVNVVIWVGLFFYLWRIDRRIAEKEKER* |
| Ga0137370_108739721 | 3300012285 | Vadose Zone Soil | VSSLAFLAAVNVVIWVGLFFYLWRIDRRIAEKEQER* |
| Ga0137372_105882392 | 3300012350 | Vadose Zone Soil | MSSLAFLAAVNAIIWVGLFFYLWRLDRRISARERER* |
| Ga0137367_101318172 | 3300012353 | Vadose Zone Soil | VSSLAFLAAVNIVIWIGLFFYVWRLDRRLAERERNR* |
| Ga0137367_103133881 | 3300012353 | Vadose Zone Soil | VSSLAFLAAVNIVIWIALFFYVWRLDRRLTQRERNR* |
| Ga0137366_100687623 | 3300012354 | Vadose Zone Soil | MSSLFFLAAVNVVIWVGLFFYLWRIDRRIAEKEQER* |
| Ga0137366_107822671 | 3300012354 | Vadose Zone Soil | MNSLAFLATVNVVIWVGLFFYLWRLDRRISARERER* |
| Ga0137369_104664912 | 3300012355 | Vadose Zone Soil | MSGLAFLATVNIVIWAGLFLYVWRLDRRLAERERNR* |
| Ga0137384_107259822 | 3300012357 | Vadose Zone Soil | MNSLFFLASVNVVIWVGLFFYLWRIDRRIAEKERER* |
| Ga0137368_101647893 | 3300012358 | Vadose Zone Soil | VSSLAFLAAVNIVVWVGLFFYVWRLDRRLTQRERNR* |
| Ga0137375_100745331 | 3300012360 | Vadose Zone Soil | NRSMSSLAFLAAVNIVIWIGLFFYVWRLDRRLTQRERNR* |
| Ga0137375_111585251 | 3300012360 | Vadose Zone Soil | SLAFLATVNVVIWVGLFFYLWRLDRRISTREREP* |
| Ga0137360_115468372 | 3300012361 | Vadose Zone Soil | VSLVFLAAVNVIIWIGLFAYLWRLDRRISARERER* |
| Ga0157355_10302912 | 3300012493 | Unplanted Soil | VNNSLAFLAAVNLVIWTGLFLYMWRLDRRISERERER* |
| Ga0153915_102981123 | 3300012931 | Freshwater Wetlands | VSSLAYLAVVNIVIWAGLFLYLWRLDRRLTERERNR* |
| Ga0126375_110867382 | 3300012948 | Tropical Forest Soil | MNSLAFLATVNVVIWVGLFFYLWRLDRRISAQERER* |
| Ga0164300_104676733 | 3300012951 | Soil | VSLTFLAAVNVVIWIGLFVYLWRIDRRLSARERER* |
| Ga0164303_106203601 | 3300012957 | Soil | MSSLGFLAVVNGVIWAGLFDHLKRLDQRIAGKEGKQK* |
| Ga0164303_110749292 | 3300012957 | Soil | VSLTFLAAVNVVIWIGLFVYLWRLDRRISARERER* |
| Ga0164301_103006193 | 3300012960 | Soil | MNSLGYLAAVNVVIWVGLFLYLWRLDRRLAEREKGPSR* |
| Ga0164302_108311282 | 3300012961 | Soil | MSSLAFLAVVNGVIWAGLFFHLRQIDRRITESEGTRK* |
| Ga0126369_103075083 | 3300012971 | Tropical Forest Soil | VSSLGYLAAVNVVVWFGLFFYLWRLDRRIDQLDRRRQETR* |
| Ga0134077_102498582 | 3300012972 | Grasslands Soil | LGEKDRRVSSLAYLAVVNIVIWAGLFLYLWRLDRRLTERERDR* |
| Ga0164305_110434562 | 3300012989 | Soil | VSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERSR* |
| Ga0163162_118546021 | 3300013306 | Switchgrass Rhizosphere | MSSLGFLAVVNGVIWGGLFCHLWRLDRRIAGKGTEK* |
| Ga0120111_11628571 | 3300013764 | Permafrost | VNSLGYLAAVNVVIWVGLFLYLWRLDRRISEGELREMKK* |
| Ga0134075_105483542 | 3300014154 | Grasslands Soil | LGLGEKDRRVSSLAYLAVVNIVIWAGLFLYLWRLDRRLTERERDR* |
| Ga0157380_127767152 | 3300014326 | Switchgrass Rhizosphere | VSSLAYLALVNVVVWVGIFLYLWRLERRITEQERSR* |
| Ga0180069_11867102 | 3300014882 | Soil | VSSLAFLAAVNVVVWVGLFLYLWRIDRRIAEQEQNR* |
| Ga0157376_120458491 | 3300014969 | Miscanthus Rhizosphere | PMNSLGYLAAVNVVIWVGLFAYLWRLDRRVSERERS* |
| Ga0167632_10479982 | 3300015085 | Glacier Forefield Soil | MNSLGFLAAVNVVVWAGLFLYLWRLDRRISERERER* |
| Ga0167634_10216622 | 3300015090 | Glacier Forefield Soil | MSSLAFLAAVNVVIWAGLFLYLWRLDRRISERERDR* |
| Ga0132258_100673727 | 3300015371 | Arabidopsis Rhizosphere | VSSLGYLAAVNVVVWVGLFLYLWRLDRRIEQLDRRR* |
| Ga0132258_101629263 | 3300015371 | Arabidopsis Rhizosphere | VSSLGYLAAVNVVIWVGLFFYLWRLDRRLTESERKP* |
| Ga0132258_108242443 | 3300015371 | Arabidopsis Rhizosphere | VNSLAFLAAVNLVIWTGLFAYLWRLDRRISERERER* |
| Ga0132256_1006894221 | 3300015372 | Arabidopsis Rhizosphere | VSSLAFLATVNVVIWAGLFFYLWRLDRRISARERER* |
| Ga0132257_1002705841 | 3300015373 | Arabidopsis Rhizosphere | SLGYLAAVNVVIWVGLFLYLWRLDRRISEAERKP* |
| Ga0132255_1013828911 | 3300015374 | Arabidopsis Rhizosphere | LNSLAFLAAVNIVIWIGLFFYLWRLDRKLSEKGREP* |
| Ga0132255_1036035613 | 3300015374 | Arabidopsis Rhizosphere | SGVSSLAFLATVNLVIWAGLFFYLWRLDRRISARERER* |
| Ga0134069_13163742 | 3300017654 | Grasslands Soil | VNSLVFLAAVNVVIWAGLFFYLWRLDRRISAREEER |
| Ga0187824_100379662 | 3300017927 | Freshwater Sediment | MTSLGYLAAVNVVIWIGLFVYLWRLDRRVSEKERSR |
| Ga0187825_100663472 | 3300017930 | Freshwater Sediment | MSSLAFLAAVNVVIWVGLFFYLWRLDRRVTEGERQK |
| Ga0187786_101977152 | 3300017944 | Tropical Peatland | VSSLGYLAAVNVVIWVGLFLYLWRLDRRISGKEREP |
| Ga0187785_102566843 | 3300017947 | Tropical Peatland | MTSLGYLAAVNVVIWVGLFAYLWRLDRRVSEKERSR |
| Ga0187779_100412683 | 3300017959 | Tropical Peatland | VSSLAYLAAVNLVIWGGLFFYLWRLDRRISGKESGR |
| Ga0187778_104165371 | 3300017961 | Tropical Peatland | VTSLAYLAAVNLVIWGGLFFYLWRLDRRISGKEGGR |
| Ga0187778_108062401 | 3300017961 | Tropical Peatland | NNGPVTSLAYLAAVNLVIWGGLFFYLWRLDRRISGKESGR |
| Ga0187778_110743861 | 3300017961 | Tropical Peatland | MGSLGYLAAVNVVIWVGLYLYLWRLDRRVSDAERKP |
| Ga0187776_101261433 | 3300017966 | Tropical Peatland | VSSLGYLAAVNVVIWVGLFLYLRRLDRRISGKEREP |
| Ga0187777_100072603 | 3300017974 | Tropical Peatland | VSSLAYLAVVNLVIWGGLFFYLWRLDRRISGKESGR |
| Ga0187777_101103423 | 3300017974 | Tropical Peatland | MGSLGYLAAVNVVIWVGLFLYLWRLDRRVSDAERKP |
| Ga0184610_12541963 | 3300017997 | Groundwater Sediment | PVSSLAYLAIVNVVVWVGLFFYLWRLDRRISERERNP |
| Ga0184604_100780521 | 3300018000 | Groundwater Sediment | VSSLAYLALVNVVVWVGLFLYLWRLDRRISEQERNR |
| Ga0184605_104368732 | 3300018027 | Groundwater Sediment | VNSLAFLAAVNVVIWVGLFFYLWRIDRRIAEKEQER |
| Ga0184634_100647931 | 3300018031 | Groundwater Sediment | MTSLAYLASVNVVIWAGLFFYLWRLDRRISEQERGR |
| Ga0184634_102024451 | 3300018031 | Groundwater Sediment | VRSLGYLAGVNVVIWVGLFFYLWRLDRRISELERKP |
| Ga0184634_102182302 | 3300018031 | Groundwater Sediment | VNSLAYLAAANVVIWVGLFFTLWRLDRRISEKERER |
| Ga0184638_10530613 | 3300018052 | Groundwater Sediment | VSSLAYLATVNVVVWVGLFVYLWRLDRRISERERNQ |
| Ga0184638_11373042 | 3300018052 | Groundwater Sediment | VSSLAFLAAVNIVIWIGLFFYVWRLDRRLTERERNR |
| Ga0184626_102142052 | 3300018053 | Groundwater Sediment | VLVSSLAYLATVNVVVWVGLFLYLWRLNRRISERELNR |
| Ga0184623_100232692 | 3300018056 | Groundwater Sediment | VSSLAYLAIVNVVVWVGLFFYLWRLDRRISERERNP |
| Ga0187766_100122833 | 3300018058 | Tropical Peatland | MVSSLAYLALVNLVIWVGLFFYVWRLDRRVSRKEGDS |
| Ga0187766_109395191 | 3300018058 | Tropical Peatland | VTSLAYLAAVNLVIWGGLFFYLWRLDRRISGKESGR |
| Ga0184615_100029683 | 3300018059 | Groundwater Sediment | VSSLAYLATVNVVVWVGLFVYLWRLDRRISEQERNR |
| Ga0187765_112555441 | 3300018060 | Tropical Peatland | VSSLGYLAAVNLVIWAGLFFYVWRLDRRISERERER |
| Ga0184619_103493002 | 3300018061 | Groundwater Sediment | VNSLAFLAAVNVVIWMGLFFYLWRIDRRIAEKEQER |
| Ga0184637_101034142 | 3300018063 | Groundwater Sediment | VNSLAYLASVNVVIWAGLFFYLWRLDRRISEQERGR |
| Ga0184636_12061082 | 3300018068 | Groundwater Sediment | VSSLGYLATVNVVVWVGLFVYLWRLDRRISEQERNR |
| Ga0184618_105053262 | 3300018071 | Groundwater Sediment | VSSLAYLATVNVVVWVGLFLYLWRLDRRISERERNR |
| Ga0184640_104324112 | 3300018074 | Groundwater Sediment | VRSLGYLAGVNVVIWVGLFFYLWRLDRRISESERKP |
| Ga0184633_100470243 | 3300018077 | Groundwater Sediment | VNSLAYLAAANVVIWVGLFFYLWRPDRPISERERGR |
| Ga0184639_100263633 | 3300018082 | Groundwater Sediment | VNSLAYLAAANVVIWVGLFFYLWRLDRRISEREEGR |
| Ga0184629_100079603 | 3300018084 | Groundwater Sediment | VSSLAYLAAVNVVVWVGLFLYLWRIDRRIAEQERNR |
| Ga0184629_102145072 | 3300018084 | Groundwater Sediment | VSSLGYLATVNVVVWVGLFVYLWRLDQRISQRERNR |
| Ga0190265_101782053 | 3300018422 | Soil | VNSLVYLAAVNIVIWSGLFIYLWRLDRRIGEQERNR |
| Ga0066655_111345702 | 3300018431 | Grasslands Soil | LFRGGNNPVVNSLVFLAGVNVVIWAGLFFYLWRLDRRISAREEER |
| Ga0066662_106589832 | 3300018468 | Grasslands Soil | VSSLAYLAAVNIVIWIGLFFYVWRLDRRLTERERNR |
| Ga0066669_100020747 | 3300018482 | Grasslands Soil | VSSLGFLAAVNIVIWIGLFFYVWRLDRRLTERERDR |
| Ga0210378_100182782 | 3300021073 | Groundwater Sediment | VSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERNR |
| Ga0210379_100155162 | 3300021081 | Groundwater Sediment | MTSLGYLAAVNVVIWIGLFAYLWRLDRRLTEKEGGR |
| Ga0182009_101120993 | 3300021445 | Soil | VGSLGYLAAVNVVIWVGLFLYLWRLDRRLAERERGERPLKG |
| Ga0187846_100359292 | 3300021476 | Biofilm | MAVNSLAYLAAANVVIWVGLFLYLWRLDRRISEAERRK |
| Ga0210402_100038154 | 3300021478 | Soil | MSSLGYLAAVNVVIWIGLFAYIWRLDRRVSEKERS |
| Ga0126371_104265313 | 3300021560 | Tropical Forest Soil | VGSLGYLAAVNVVIWVGLFVYLWRLDRRVSDAERKP |
| Ga0126371_105550063 | 3300021560 | Tropical Forest Soil | VNSLAFLAAVNVVIWVGLFFYLWRLDRRVTEREREK |
| Ga0126371_113069523 | 3300021560 | Tropical Forest Soil | VGSLGYLAAVNVVIWVGLFVYLWRLDRRVSDVERKS |
| Ga0247751_10591552 | 3300023069 | Soil | VGSLGYLAAVNVVVWVGLFLYLWRLDRRLAEAEKKELR |
| Ga0209640_100223214 | 3300025324 | Soil | VSSLASLAIVNVVIWSGLFLYLWRLDRRVSERERDR |
| Ga0209640_109278422 | 3300025324 | Soil | VSSLAYLAVVNIVIWAGLFLYLWRLDRRLTERERER |
| Ga0210131_10922612 | 3300025551 | Natural And Restored Wetlands | MSSLGYLAAVNVVIWVGLFAYLWRLDRRVSEKERP |
| Ga0207642_103067932 | 3300025899 | Miscanthus Rhizosphere | VSSLGYLAAVNVVVWVGLFFYLWRLDRRIEQLDRRR |
| Ga0207647_105528961 | 3300025904 | Corn Rhizosphere | TGSVRSLGYLAAVNVVIWVGLFLYLWRLDRRISEAERKP |
| Ga0207684_1000228219 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSLFFLASVNVVIWVGLFFYLWRIDRRIAEKEGGR |
| Ga0207684_100364743 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VNSLAFLAIVNVVIWVGLFFYLWRLDRRISARERER |
| Ga0207646_103937962 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSLAYLAAVNIVIWIGLFFYVWRLDRRLTERERNR |
| Ga0207646_104941972 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VRSLGYLAAVNVVIWVGLFFYLWRLDRRISEKERSR |
| Ga0207646_115850302 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSLAFLAAVNVVIWVGLFFYLWRLDRRIAERERER |
| Ga0207670_109314021 | 3300025936 | Switchgrass Rhizosphere | VSSLAYLAAVNVVVWVGLFLYLWRLDRRISARERTR |
| Ga0207665_106305931 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSLAYLAAVNVVIWIGLFWYLWRLDRRISQKESDR |
| Ga0207689_114936252 | 3300025942 | Miscanthus Rhizosphere | GSVRSLGYLAAVNVVIWVGLFLYLWRLDRRISEAERKP |
| Ga0207651_112428401 | 3300025960 | Switchgrass Rhizosphere | GPGGNNHFVSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERTR |
| Ga0207678_103698073 | 3300026067 | Corn Rhizosphere | RLGGVGSLGYLAAVNVVIWVGLFLYLWRLDRRLAETEKRQG |
| Ga0207648_112951572 | 3300026089 | Miscanthus Rhizosphere | VSSLAYLALVNVVVWVGLFLYLWRLERRISEQERNR |
| Ga0209863_100861862 | 3300026281 | Prmafrost Soil | VNSLAFLAAVNVVIWVGLFVYLWRLDRRISERERDR |
| Ga0209839_100973312 | 3300026294 | Soil | MNSLAFLAAVNLVIWLGLFLFLWRLDRKISERERNR |
| Ga0209131_12100102 | 3300026320 | Grasslands Soil | VSLVFLAAVNVIIWIGLFAYLWRLDRRISARERER |
| Ga0256823_10374202 | 3300026350 | Sediment | MSSLGYLAAVNVVIWIGLFAYLWRLDRRVSEKEQSR |
| Ga0209056_102535712 | 3300026538 | Soil | VNSLFFLAAVNVVIWVGLFFYLWRLDRRISAREGER |
| Ga0209973_10336021 | 3300027252 | Arabidopsis Thaliana Rhizosphere | VSSLAFLAVVNIVIWAGLFFYVWRLDRRLAEMEKNR |
| Ga0209983_10906892 | 3300027665 | Arabidopsis Thaliana Rhizosphere | VSSLAYLAVVNIVIWSGLFLYLWRLDRRVSDREKGR |
| Ga0209009_10002007 | 3300027667 | Forest Soil | MSSLAFLASVNAVIWVGLFFYLWRLDRRISARERER |
| Ga0209819_100282933 | 3300027722 | Freshwater Sediment | VGSLGYLAAVNVVIWVGLFVYLWRLDRRISEAERKS |
| Ga0209811_102372052 | 3300027821 | Surface Soil | VSSLAFLATVNLVIWAGLFFYLWRLDRRISARERER |
| Ga0209048_1000068910 | 3300027902 | Freshwater Lake Sediment | MSSLGYLAAVNVVIWIGLFAYLWRLDRRVSEKERSS |
| Ga0209048_100286502 | 3300027902 | Freshwater Lake Sediment | MSSLGYLAAVNVVIWVGLFAYLWRLDRRLTEKERAR |
| Ga0268266_109985221 | 3300028379 | Switchgrass Rhizosphere | MTSLGYLAAVNVVIWIGLFVYLWRLDRRVSEKERAR |
| Ga0268264_126038392 | 3300028381 | Switchgrass Rhizosphere | VSLTFLAAVNVVIWIGLFVYLWRIDRRLSARERER |
| Ga0299906_105142002 | 3300030606 | Soil | VSSLAYLAVVNIVIWAGLFLYLWRLDRRLTERERNR |
| Ga0302046_103602953 | 3300030620 | Soil | VSSLGFLAIVNIVIWAGLFVYVWRLDRRLTERERNR |
| Ga0265330_101207402 | 3300031235 | Rhizosphere | MSSLGYLAAVNVVIWIGLFAYVWSLDRRVSEKERSR |
| Ga0265332_102322263 | 3300031238 | Rhizosphere | TQPMSSLGYLAAVNVVIWIGLFAYVWSLDRRVSEKERSR |
| Ga0318555_103971132 | 3300031640 | Soil | MNSLAFLAAVNVVIWVGLFAYLWRIDRRLSEREKQP |
| Ga0310813_116302973 | 3300031716 | Soil | GNNHFVSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERTR |
| Ga0307469_100781805 | 3300031720 | Hardwood Forest Soil | VSSLAYLAAVNLVIWVGLFFYLWRLDRRISQKGGDP |
| Ga0307469_105950252 | 3300031720 | Hardwood Forest Soil | MSSLAFLAGVNVVIWVGLFFYLWRLDRRISTREREP |
| Ga0307469_122571552 | 3300031720 | Hardwood Forest Soil | VSLVFLAAVNVIIWTGLFVYLWRLDRRISAREKER |
| Ga0307468_1001940402 | 3300031740 | Hardwood Forest Soil | VSLVFLAAVNVIIWTGLFVYLWRLDRRISARERER |
| Ga0307468_1002976552 | 3300031740 | Hardwood Forest Soil | VSSLGFLAAVNVVVWVGLFLYLWRLDRRISEAERERPRP |
| Ga0307473_108933341 | 3300031820 | Hardwood Forest Soil | NNSRVSLVFLAAVNVIIWTGLFVYLWRLDRRISARERER |
| Ga0307473_110110631 | 3300031820 | Hardwood Forest Soil | MSSLAFLATVNVVIWAGLFFYLWRLDRRISARERER |
| Ga0315290_104861892 | 3300031834 | Sediment | MTSLGYLAAVNVVIWIGLFAYLWRLDRRVSEKERS |
| Ga0318533_114105112 | 3300032059 | Soil | TLSVGSLGYLAAVNVVIWVGLFVYLWRLDRRVSDAERKP |
| Ga0307470_112539652 | 3300032174 | Hardwood Forest Soil | VSSLGYLAAVNLVIWAGLFFYVWRLDRRISEKEREP |
| Ga0307471_1001618972 | 3300032180 | Hardwood Forest Soil | VSSLAYLAAVNLVIWVGLFFYLWRLDRRISQKGGDQ |
| Ga0307471_1009747262 | 3300032180 | Hardwood Forest Soil | MSSLAFLAIVNMVIWAGLFFYVWRLDRRLAEREKGR |
| Ga0307471_1013698582 | 3300032180 | Hardwood Forest Soil | VNSLAYLAAANVVIWLGLFFYLWRLDRRISAKERER |
| Ga0307471_1040623072 | 3300032180 | Hardwood Forest Soil | VSSLGYLAAVNVVIWAGLFLYLWRLDRRIDQMERRR |
| Ga0307472_1002175612 | 3300032205 | Hardwood Forest Soil | MASVNSLAFLAAVNVVIWIGLWAYLWRLDRRLSERERGK |
| Ga0307472_1022516072 | 3300032205 | Hardwood Forest Soil | VHSLRYLAAVNVVVWAGLFFYLWRLDRRITERERRDGEES |
| Ga0335085_100303674 | 3300032770 | Soil | MNSLAFLAAVNVVIWVGLFAYLWRIDRRLSEREKQQ |
| Ga0335079_104444782 | 3300032783 | Soil | VSSLGYLAAVNLVIWGGLFFYVWRLDRRISEKEREP |
| Ga0335080_105579961 | 3300032828 | Soil | VGSLAYLAAVNVVIWVGLFVYLWRLDRRISDAERKP |
| Ga0335084_101043253 | 3300033004 | Soil | VGSLGYLAAVNLVIWAGLFFYVWRLDRRISEREREP |
| Ga0335084_119858182 | 3300033004 | Soil | VGSLGYLAAVNVVIWVGLFLYLWRLDRRITEAERKP |
| Ga0316605_109375561 | 3300033408 | Soil | VKSLGYLAAVNVVIWVGLFYYLWRLDRRLSESERKS |
| Ga0316620_115655922 | 3300033480 | Soil | MTSLGYLAAVNVVIWVGLFLYLWRLDRRIAEKERGR |
| Ga0316628_1000597743 | 3300033513 | Soil | VSSLAYLAAVNVVIWAGLFFYLWRLDRRISGKEREP |
| Ga0247829_104839011 | 3300033550 | Soil | EGETSVSSLAFLAVVNIVIWAGLFLYVWRLDRRLAEMEKNR |
| Ga0247829_107548902 | 3300033550 | Soil | VSSLAYLAAVNVVIWVGLFLYLWRLDGRISAAESRKP |
| Ga0314862_0148203_111_221 | 3300033803 | Peatland | VSSLGYLAAVNLVIWFGIFLYLWRLDRRIGEKERSR |
| Ga0364930_0151294_233_343 | 3300033814 | Sediment | MSSLAYLAVVNIVIWAGLFFYVWRLDRRIAERERDQ |
| Ga0364946_152610_216_326 | 3300033815 | Sediment | VSSLAYLATVNVVVWVGLFVYLWRLDRRISERERIR |
| Ga0364931_0328924_198_308 | 3300034176 | Sediment | VSSLAYLAVVNIVIWIGLFLYLWRLDRRLTERERNR |
| ⦗Top⦘ |