| Basic Information | |
|---|---|
| Family ID | F016827 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 244 |
| Average Sequence Length | 48 residues |
| Representative Sequence | AAAVFFFVVKPVNALLQRFRSPAEEGMPDEERRHQELLAALKAR |
| Number of Associated Samples | 200 |
| Number of Associated Scaffolds | 244 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.74 % |
| % of genes near scaffold ends (potentially truncated) | 89.34 % |
| % of genes from short scaffolds (< 2000 bps) | 90.16 % |
| Associated GOLD sequencing projects | 194 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.672 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.049 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.705 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 244 Family Scaffolds |
|---|---|---|
| PF05173 | DapB_C | 31.15 |
| PF01661 | Macro | 6.56 |
| PF10823 | DUF2568 | 4.10 |
| PF05193 | Peptidase_M16_C | 3.28 |
| PF01557 | FAA_hydrolase | 2.87 |
| PF01416 | PseudoU_synth_1 | 2.87 |
| PF07883 | Cupin_2 | 1.64 |
| PF00701 | DHDPS | 1.64 |
| PF01565 | FAD_binding_4 | 1.64 |
| PF00266 | Aminotran_5 | 1.64 |
| PF01741 | MscL | 1.23 |
| PF01887 | SAM_HAT_N | 1.23 |
| PF08031 | BBE | 1.23 |
| PF00296 | Bac_luciferase | 1.23 |
| PF07676 | PD40 | 1.23 |
| PF08240 | ADH_N | 1.23 |
| PF00557 | Peptidase_M24 | 0.82 |
| PF13673 | Acetyltransf_10 | 0.82 |
| PF02798 | GST_N | 0.82 |
| PF01738 | DLH | 0.82 |
| PF00140 | Sigma70_r1_2 | 0.82 |
| PF00106 | adh_short | 0.82 |
| PF06831 | H2TH | 0.82 |
| PF02817 | E3_binding | 0.41 |
| PF03713 | DUF305 | 0.41 |
| PF09438 | DUF2017 | 0.41 |
| PF02152 | FolB | 0.41 |
| PF13380 | CoA_binding_2 | 0.41 |
| PF01176 | eIF-1a | 0.41 |
| PF01625 | PMSR | 0.41 |
| PF13417 | GST_N_3 | 0.41 |
| PF12850 | Metallophos_2 | 0.41 |
| PF02687 | FtsX | 0.41 |
| PF12893 | Lumazine_bd_2 | 0.41 |
| PF01266 | DAO | 0.41 |
| PF13193 | AMP-binding_C | 0.41 |
| PF14224 | DUF4331 | 0.41 |
| PF07366 | SnoaL | 0.41 |
| PF13365 | Trypsin_2 | 0.41 |
| PF02381 | MraZ | 0.41 |
| PF04020 | Phage_holin_4_2 | 0.41 |
| PF03060 | NMO | 0.41 |
| PF00196 | GerE | 0.41 |
| PF01321 | Creatinase_N | 0.41 |
| PF06736 | TMEM175 | 0.41 |
| PF09391 | DUF2000 | 0.41 |
| PF03364 | Polyketide_cyc | 0.41 |
| PF00353 | HemolysinCabind | 0.41 |
| PF00903 | Glyoxalase | 0.41 |
| PF13239 | 2TM | 0.41 |
| PF00004 | AAA | 0.41 |
| PF00535 | Glycos_transf_2 | 0.41 |
| PF00041 | fn3 | 0.41 |
| PF08818 | DUF1801 | 0.41 |
| PF14518 | Haem_oxygenas_2 | 0.41 |
| PF14696 | Glyoxalase_5 | 0.41 |
| PF03992 | ABM | 0.41 |
| PF13517 | FG-GAP_3 | 0.41 |
| PF04237 | YjbR | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 244 Family Scaffolds |
|---|---|---|---|
| COG0289 | 4-hydroxy-tetrahydrodipicolinate reductase | Amino acid transport and metabolism [E] | 31.15 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 6.56 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 3.28 |
| COG0101 | tRNA U38,U39,U40 pseudouridine synthase TruA | Translation, ribosomal structure and biogenesis [J] | 2.87 |
| COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 1.23 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.23 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.23 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.23 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.82 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.82 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.41 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.41 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.41 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.41 |
| COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 0.41 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.41 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.41 |
| COG2001 | MraZ, DNA-binding transcriptional regulator and inhibitor of RsmH methyltransferase activity | Translation, ribosomal structure and biogenesis [J] | 0.41 |
| COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 0.41 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.41 |
| COG1539 | Dihydroneopterin aldolase | Coenzyme transport and metabolism [H] | 0.41 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.41 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.00 % |
| Unclassified | root | N/A | 25.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000044|ARSoilOldRDRAFT_c011700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
| 3300000858|JGI10213J12805_10108981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1333 | Open in IMG/M |
| 3300000891|JGI10214J12806_10473808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
| 3300000891|JGI10214J12806_12421420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
| 3300000956|JGI10216J12902_102061159 | Not Available | 803 | Open in IMG/M |
| 3300002122|C687J26623_10228961 | Not Available | 516 | Open in IMG/M |
| 3300004114|Ga0062593_102617583 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300004156|Ga0062589_100414193 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300004156|Ga0062589_102799727 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300004157|Ga0062590_100481078 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300004157|Ga0062590_102648495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300004463|Ga0063356_101936288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 890 | Open in IMG/M |
| 3300004463|Ga0063356_102301918 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300004643|Ga0062591_101484797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
| 3300004643|Ga0062591_102655713 | Not Available | 529 | Open in IMG/M |
| 3300004643|Ga0062591_102725819 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005327|Ga0070658_11902806 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005329|Ga0070683_100389494 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300005329|Ga0070683_102269476 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005334|Ga0068869_100724863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
| 3300005334|Ga0068869_100784876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300005337|Ga0070682_100641997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
| 3300005339|Ga0070660_100959262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300005343|Ga0070687_100641532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300005347|Ga0070668_100766273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 855 | Open in IMG/M |
| 3300005354|Ga0070675_100153828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1973 | Open in IMG/M |
| 3300005406|Ga0070703_10128916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
| 3300005435|Ga0070714_100896235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
| 3300005438|Ga0070701_11221438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300005441|Ga0070700_101980939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300005445|Ga0070708_101291409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300005456|Ga0070678_100284258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1400 | Open in IMG/M |
| 3300005456|Ga0070678_100753724 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005459|Ga0068867_100680401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 906 | Open in IMG/M |
| 3300005459|Ga0068867_101475351 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005467|Ga0070706_100431084 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300005535|Ga0070684_100438280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1207 | Open in IMG/M |
| 3300005536|Ga0070697_100809905 | Not Available | 829 | Open in IMG/M |
| 3300005544|Ga0070686_100539941 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300005544|Ga0070686_100877702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 728 | Open in IMG/M |
| 3300005564|Ga0070664_101800563 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005616|Ga0068852_102398000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300005718|Ga0068866_10174706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1264 | Open in IMG/M |
| 3300005764|Ga0066903_104582286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
| 3300005840|Ga0068870_10593661 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300005843|Ga0068860_101979813 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005937|Ga0081455_10474514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
| 3300006059|Ga0075017_100097591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2043 | Open in IMG/M |
| 3300006196|Ga0075422_10428089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300006575|Ga0074053_11124296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
| 3300006576|Ga0074047_11999114 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300006844|Ga0075428_100303951 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300006844|Ga0075428_100812162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 994 | Open in IMG/M |
| 3300006852|Ga0075433_11447747 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006876|Ga0079217_11744324 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006894|Ga0079215_11409268 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006904|Ga0075424_102613028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300006914|Ga0075436_100288453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 1175 | Open in IMG/M |
| 3300006918|Ga0079216_10717392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| 3300006953|Ga0074063_12535516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300007076|Ga0075435_100486680 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300009089|Ga0099828_10526419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1066 | Open in IMG/M |
| 3300009090|Ga0099827_10000704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15958 | Open in IMG/M |
| 3300009156|Ga0111538_11229183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
| 3300009157|Ga0105092_10239937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1017 | Open in IMG/M |
| 3300009789|Ga0126307_10445210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1045 | Open in IMG/M |
| 3300009811|Ga0105084_1011679 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300009811|Ga0105084_1104848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300009823|Ga0105078_1044210 | Not Available | 577 | Open in IMG/M |
| 3300010038|Ga0126315_10482430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 789 | Open in IMG/M |
| 3300010040|Ga0126308_11070032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300010041|Ga0126312_10255693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1231 | Open in IMG/M |
| 3300010045|Ga0126311_10013446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4672 | Open in IMG/M |
| 3300010045|Ga0126311_10336662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1146 | Open in IMG/M |
| 3300010045|Ga0126311_10502270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
| 3300010166|Ga0126306_10347344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1152 | Open in IMG/M |
| 3300010391|Ga0136847_10264443 | Not Available | 599 | Open in IMG/M |
| 3300010400|Ga0134122_11538339 | Not Available | 686 | Open in IMG/M |
| 3300010999|Ga0138505_100053799 | Not Available | 584 | Open in IMG/M |
| 3300011119|Ga0105246_10332264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1239 | Open in IMG/M |
| 3300011270|Ga0137391_10742641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
| 3300012014|Ga0120159_1095449 | Not Available | 858 | Open in IMG/M |
| 3300012356|Ga0137371_11139040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300012358|Ga0137368_10447353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
| 3300012529|Ga0136630_1126998 | Not Available | 931 | Open in IMG/M |
| 3300012531|Ga0136640_10409570 | Not Available | 568 | Open in IMG/M |
| 3300012668|Ga0157216_10276771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
| 3300012682|Ga0136611_10149642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1618 | Open in IMG/M |
| 3300012898|Ga0157293_10293974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300012901|Ga0157288_10096979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 794 | Open in IMG/M |
| 3300012901|Ga0157288_10105822 | Not Available | 773 | Open in IMG/M |
| 3300012903|Ga0157289_10198486 | Not Available | 653 | Open in IMG/M |
| 3300012907|Ga0157283_10127380 | Not Available | 720 | Open in IMG/M |
| 3300012910|Ga0157308_10208152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300012910|Ga0157308_10414414 | Not Available | 527 | Open in IMG/M |
| 3300012915|Ga0157302_10298017 | Not Available | 625 | Open in IMG/M |
| 3300012925|Ga0137419_11935811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300012951|Ga0164300_11136256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300012958|Ga0164299_10715876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
| 3300012961|Ga0164302_10845238 | Not Available | 696 | Open in IMG/M |
| 3300012985|Ga0164308_10170336 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300012989|Ga0164305_11288469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300012989|Ga0164305_11640444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300013096|Ga0157307_1048744 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300013104|Ga0157370_11407442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300013297|Ga0157378_10736268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1008 | Open in IMG/M |
| 3300014052|Ga0120109_1103346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300014267|Ga0075313_1178966 | Not Available | 555 | Open in IMG/M |
| 3300014320|Ga0075342_1252085 | Not Available | 514 | Open in IMG/M |
| 3300014326|Ga0157380_10064942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2931 | Open in IMG/M |
| 3300014968|Ga0157379_12230484 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300015200|Ga0173480_10466190 | Not Available | 749 | Open in IMG/M |
| 3300015245|Ga0137409_10756395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
| 3300015262|Ga0182007_10304913 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300015371|Ga0132258_10316320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3846 | Open in IMG/M |
| 3300015371|Ga0132258_12061130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1434 | Open in IMG/M |
| 3300015371|Ga0132258_13102087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1149 | Open in IMG/M |
| 3300015372|Ga0132256_100267856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1783 | Open in IMG/M |
| 3300015372|Ga0132256_102567156 | Not Available | 610 | Open in IMG/M |
| 3300015373|Ga0132257_100538128 | Not Available | 1437 | Open in IMG/M |
| 3300015373|Ga0132257_101978079 | Not Available | 751 | Open in IMG/M |
| 3300015373|Ga0132257_102136503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300015373|Ga0132257_103039637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300015374|Ga0132255_101084610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1203 | Open in IMG/M |
| 3300015374|Ga0132255_103065472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300017657|Ga0134074_1302390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300017787|Ga0183260_10934225 | Not Available | 536 | Open in IMG/M |
| 3300017792|Ga0163161_11694982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300017997|Ga0184610_1312655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300018032|Ga0187788_10417513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300018051|Ga0184620_10147575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
| 3300018056|Ga0184623_10399716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 605 | Open in IMG/M |
| 3300018061|Ga0184619_10052410 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300018061|Ga0184619_10459787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300018061|Ga0184619_10500287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300018063|Ga0184637_10444980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| 3300018072|Ga0184635_10162878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
| 3300018077|Ga0184633_10618377 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300018083|Ga0184628_10236567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
| 3300018429|Ga0190272_11697542 | Not Available | 653 | Open in IMG/M |
| 3300018432|Ga0190275_10493143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1257 | Open in IMG/M |
| 3300018432|Ga0190275_10812841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 999 | Open in IMG/M |
| 3300018466|Ga0190268_10158702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1168 | Open in IMG/M |
| 3300018466|Ga0190268_12007283 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300018469|Ga0190270_10234363 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300018481|Ga0190271_12251959 | Not Available | 650 | Open in IMG/M |
| 3300019269|Ga0184644_1741412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1004 | Open in IMG/M |
| 3300020003|Ga0193739_1103756 | Not Available | 715 | Open in IMG/M |
| 3300020016|Ga0193696_1143984 | Not Available | 592 | Open in IMG/M |
| 3300020016|Ga0193696_1175072 | Not Available | 515 | Open in IMG/M |
| 3300021374|Ga0213881_10238979 | Not Available | 806 | Open in IMG/M |
| 3300022737|Ga0247747_1043171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300022756|Ga0222622_10006354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5372 | Open in IMG/M |
| 3300022756|Ga0222622_10277295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1146 | Open in IMG/M |
| 3300022756|Ga0222622_11176493 | Not Available | 564 | Open in IMG/M |
| 3300022915|Ga0247790_10213766 | Not Available | 516 | Open in IMG/M |
| 3300023066|Ga0247793_1081881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300023102|Ga0247754_1025271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1316 | Open in IMG/M |
| 3300023263|Ga0247800_1082710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300023266|Ga0247789_1012572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1350 | Open in IMG/M |
| 3300024055|Ga0247794_10330501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300025318|Ga0209519_10411844 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300025322|Ga0209641_10401375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 989 | Open in IMG/M |
| 3300025322|Ga0209641_10414463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 969 | Open in IMG/M |
| 3300025327|Ga0209751_10534844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 952 | Open in IMG/M |
| 3300025327|Ga0209751_10874574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300025792|Ga0210143_1026255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1015 | Open in IMG/M |
| 3300025888|Ga0209540_10465269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → unclassified Thiocapsa → Thiocapsa sp. KS1 | 673 | Open in IMG/M |
| 3300025899|Ga0207642_10752689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300025904|Ga0207647_10234657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1055 | Open in IMG/M |
| 3300025907|Ga0207645_10811992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300025916|Ga0207663_10566085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 890 | Open in IMG/M |
| 3300025918|Ga0207662_11206088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300025930|Ga0207701_11329224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300025934|Ga0207686_10550050 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300025981|Ga0207640_11872482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300025981|Ga0207640_12088258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300025986|Ga0207658_11948090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300026121|Ga0207683_10944030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300026142|Ga0207698_10943458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
| 3300026332|Ga0209803_1125977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1018 | Open in IMG/M |
| 3300026786|Ga0207497_104395 | Not Available | 548 | Open in IMG/M |
| 3300026995|Ga0208761_1029446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300028589|Ga0247818_10785646 | Not Available | 664 | Open in IMG/M |
| 3300028715|Ga0307313_10066956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1069 | Open in IMG/M |
| 3300028718|Ga0307307_10018015 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300028719|Ga0307301_10209936 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300028744|Ga0307318_10137044 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 837 | Open in IMG/M |
| 3300028754|Ga0307297_10138080 | Not Available | 825 | Open in IMG/M |
| 3300028771|Ga0307320_10052349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1508 | Open in IMG/M |
| 3300028778|Ga0307288_10034772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1683 | Open in IMG/M |
| 3300028787|Ga0307323_10188251 | Not Available | 746 | Open in IMG/M |
| 3300028787|Ga0307323_10322577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
| 3300028809|Ga0247824_10955800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300028811|Ga0307292_10196889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
| 3300028812|Ga0247825_10541258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 831 | Open in IMG/M |
| 3300028814|Ga0307302_10010733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4104 | Open in IMG/M |
| 3300028814|Ga0307302_10533610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300028824|Ga0307310_10546899 | Not Available | 586 | Open in IMG/M |
| 3300028872|Ga0307314_10172273 | Not Available | 637 | Open in IMG/M |
| 3300028875|Ga0307289_10267416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300028875|Ga0307289_10398021 | Not Available | 566 | Open in IMG/M |
| 3300028881|Ga0307277_10332484 | Not Available | 676 | Open in IMG/M |
| 3300028884|Ga0307308_10112197 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300030006|Ga0299907_10198453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1656 | Open in IMG/M |
| 3300030336|Ga0247826_11425600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300030606|Ga0299906_10275717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1318 | Open in IMG/M |
| 3300031239|Ga0265328_10161717 | Not Available | 844 | Open in IMG/M |
| 3300031241|Ga0265325_10285362 | Not Available | 739 | Open in IMG/M |
| 3300031251|Ga0265327_10031355 | All Organisms → cellular organisms → Bacteria | 2987 | Open in IMG/M |
| 3300031344|Ga0265316_10009520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8943 | Open in IMG/M |
| 3300031547|Ga0310887_10456490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 763 | Open in IMG/M |
| 3300031547|Ga0310887_11081476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300031548|Ga0307408_101389898 | Not Available | 661 | Open in IMG/M |
| 3300031562|Ga0310886_10935887 | Not Available | 553 | Open in IMG/M |
| 3300031576|Ga0247727_10287074 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300031740|Ga0307468_100956720 | Not Available | 749 | Open in IMG/M |
| 3300031834|Ga0315290_10065350 | All Organisms → cellular organisms → Bacteria | 2993 | Open in IMG/M |
| 3300031834|Ga0315290_10743251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
| 3300031835|Ga0318517_10547832 | Not Available | 520 | Open in IMG/M |
| 3300031847|Ga0310907_10892606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300031858|Ga0310892_10553737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
| 3300032002|Ga0307416_102321099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300032010|Ga0318569_10082487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1434 | Open in IMG/M |
| 3300032013|Ga0310906_10516418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 811 | Open in IMG/M |
| 3300032143|Ga0315292_10358726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1221 | Open in IMG/M |
| 3300032163|Ga0315281_11576345 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300033551|Ga0247830_11334153 | Not Available | 573 | Open in IMG/M |
| 3300034147|Ga0364925_0180540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
| 3300034176|Ga0364931_0020251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1872 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.28% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.28% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.05% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.64% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.64% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.64% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.23% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.23% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.23% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.82% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.82% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.82% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.41% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.41% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.41% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.41% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.41% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.41% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.41% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.41% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.41% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.41% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.41% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.41% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.41% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.41% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
| 3300012531 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ864 (21.06) | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012682 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06) | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026786 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ARSoilOldRDRAFT_0117002 | 3300000044 | Arabidopsis Rhizosphere | VFFFVVKPMDSIMSRVRKPAEEEVSDEERRHQELLAALRARA* |
| JGI10213J12805_101089813 | 3300000858 | Soil | AAITFVSTAAAIFFFVVRPMNALMTRMKRPEGEAVADEERRHQELLAALEGLKR* |
| JGI10214J12806_104738081 | 3300000891 | Soil | AAAIFFFVVKPVNALMARRRQPEEEVVSDEERRHQELLVALEALRR* |
| JGI10214J12806_124214202 | 3300000891 | Soil | ATAAAVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR* |
| JGI10216J12902_1020611591 | 3300000956 | Soil | FFFVVKPVQAMLERRRREPVEEGMPDEERRHQELLAALRARA* |
| C687J26623_102289611 | 3300002122 | Soil | VVKPLNALTARMKKPEEDAVPDEERRHQELLAALRSRG* |
| Ga0062593_1026175831 | 3300004114 | Soil | SITFVATAAAIFFFVVKPMGAIMARMKKPEEEAVADEERRHQELLAAIRNIGR* |
| Ga0062589_1004141931 | 3300004156 | Soil | FVAIGAAVFFFVVKPMQMMAARGQKEPIEEGMPDEERRHRELLAALSARN* |
| Ga0062589_1027997272 | 3300004156 | Soil | AFLTDLIQFAAIGAAVFFFIVKPVQMMLERSRKEPIEEGMPDEERRHQELLAALRASN* |
| Ga0062590_1004810781 | 3300004157 | Soil | ISFVAIAAAVFFFVVKPMNAIMKRVSKPTDEEISDEERRHQELLAALRAR* |
| Ga0062590_1026484952 | 3300004157 | Soil | AFLTDLIQFAAIGAAVFFFIVKPVQMMLERSRKGPIEEGMPDEERRHQELLAALRASR* |
| Ga0063356_1019362881 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VSTAAAIFFFVVKPVNALMARRRQPHEEVVADEERRHHELLAALEGLRR* |
| Ga0063356_1023019181 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LAVAAAVFFFVVKPMNALRDRRAGGAEEEGLPDEERRHQELLAALRETRA* |
| Ga0062591_1014847972 | 3300004643 | Soil | VSTAAAIFFFVVKPVNALMARRRQPEEEVVSDEERRHQELLVALEALRR* |
| Ga0062591_1026557131 | 3300004643 | Soil | TDLIQFAAIGAAVFFFIVKPVQMMLDRSRKEPIEEGMPDEERRHQELLAALRASN* |
| Ga0062591_1027258191 | 3300004643 | Soil | LSVAAAVFFFVVKPMNALRDRRAGGAEEEGLPDEERRHQELLAALRETRA* |
| Ga0070658_119028061 | 3300005327 | Corn Rhizosphere | FITSAITFLATAAAIFLFVVKPYDALTSRFAKPAEGAVDDEERRHQELLAALRESRA* |
| Ga0070683_1003894941 | 3300005329 | Corn Rhizosphere | STAAAIFFFVVKPANALKSRFETQEEAAVSDEERRHQELLAALARVGR* |
| Ga0070683_1022694762 | 3300005329 | Corn Rhizosphere | AAAVFFFVVKPMDAIRKRMTKEEEASISDEERRHQELLAALRSRP* |
| Ga0068869_1007248633 | 3300005334 | Miscanthus Rhizosphere | AAVFFFVVKPMNMLRERRAGGAEEEGLPDEERRHQELLAALRESRA* |
| Ga0068869_1007848762 | 3300005334 | Miscanthus Rhizosphere | TFVATAAAVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR* |
| Ga0070682_1006419972 | 3300005337 | Corn Rhizosphere | AAVFFFVVKPMDAIKQHMTRAEEATISDEERRHQELLAALRVRS* |
| Ga0070660_1009592621 | 3300005339 | Corn Rhizosphere | VAAAVFFFVVKPMNMLRERRAGGAEEEGLPDEERRHQELLAVLRESRA* |
| Ga0070687_1006415322 | 3300005343 | Switchgrass Rhizosphere | FFVVKPMNAIMKRVSKPTDEEISDEERRHQELLAALRAR* |
| Ga0070668_1007662731 | 3300005347 | Switchgrass Rhizosphere | FFFVVKPMNALMTRFEKPEEEAVADEERRHQELLAALRAR* |
| Ga0070675_1001538281 | 3300005354 | Miscanthus Rhizosphere | FVSTAAAIFFFVVKPANALNSRFETPEEAAVSDEERRHQELLAALERLGR* |
| Ga0070703_101289161 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | TDVISFVAIAAAVFFFVVKPMDALTKRRAKPTEEEVSDEERRHQELLAALRAR* |
| Ga0070714_1008962352 | 3300005435 | Agricultural Soil | VIQFVAIAAAVFSFVVRQVNALPPRYRSPAEEGLPDEERRHQELLAALRGGQP* |
| Ga0070701_112214382 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | FVSTAAAIFFFVVKPTNALRARFEAPDEAAVSDEERRHQELLAALERLGR* |
| Ga0070700_1019809391 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | FVATAAAVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR* |
| Ga0070708_1012914091 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AVFFFVVKPMDALMKRVAKPTEEEVSDEERRHQELLAALRAR* |
| Ga0070678_1002842581 | 3300005456 | Miscanthus Rhizosphere | AAVFFFVVKPMQMMAARGQKEPIEEGMPDEERRHQELLAALRARP* |
| Ga0070678_1007537242 | 3300005456 | Miscanthus Rhizosphere | VIQFVAIAAAVFFFVVKPMRVLEARRARGEELVVSDEERRHQELLEALRSLSRSA* |
| Ga0068867_1006804013 | 3300005459 | Miscanthus Rhizosphere | AAIFVFVVKPYGALTSRFAKSAEEAVDVEERRHQELLAALRAR* |
| Ga0068867_1014753512 | 3300005459 | Miscanthus Rhizosphere | ISFVAIAAAVFFFVVKPMNAIMSRVRKPAEEEISDDERRHQELLAALRARG* |
| Ga0070706_1004310843 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | IQFVAIAAAVFFFVVKPIQAMLERRRKEPIEEGMPDEERRHQELLAALRARS* |
| Ga0070684_1004382803 | 3300005535 | Corn Rhizosphere | FFVVKPMDSIMSRVRKPAEEEVSDEERRHQELLAALRARA* |
| Ga0070697_1008099051 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GSVFFFVVKPVNALMTRFRSPAEEALPDEERRHQELLAALRGS* |
| Ga0070686_1005399413 | 3300005544 | Switchgrass Rhizosphere | FVSTAAAIFFFVVKPANALNSRFETPEEAAVSDEERRHQELLAALARLGR* |
| Ga0070686_1008777023 | 3300005544 | Switchgrass Rhizosphere | FFFVVRPVNALLGRFRSPAEEGMPDEERRHQELLAALRGASAPEAG* |
| Ga0070664_1018005631 | 3300005564 | Corn Rhizosphere | AAVFFFVVKPMDAIKKRMTREEEAEISDEERRHQELLAALASRT* |
| Ga0068852_1023980001 | 3300005616 | Corn Rhizosphere | AAVFFFVVKPMTILRERRAGGAEEEGLPDEERRHQELLAALRESRA* |
| Ga0068864_1012371221 | 3300005618 | Switchgrass Rhizosphere | PMQMMAARGKEPIEEGMPDEERRHQELLAALRPRA* |
| Ga0068866_101747063 | 3300005718 | Miscanthus Rhizosphere | FFFVVKPMNALMARMSKPEEEALSDEERRHQELLAALRAR* |
| Ga0066903_1045822861 | 3300005764 | Tropical Forest Soil | ITFVAIAAAVFFFVVKPTDMIAARRAKGEPEAIPDDERRHQELLAALRAHA* |
| Ga0068870_105936611 | 3300005840 | Miscanthus Rhizosphere | TDVISFVAIAAAVFFFVVKPMDALTKRVEKPTEEEVSDEERRHQELLAALRAR* |
| Ga0068860_1019798133 | 3300005843 | Switchgrass Rhizosphere | AAAVFFFVVKPMNALRERRAGGAQEEGLPDEERRHQELLAALRESRA* |
| Ga0081455_104745143 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VFFFVVKPMNALMSRVRKPADEEVSDEERRHQELLAALRARG* |
| Ga0075017_1000975911 | 3300006059 | Watersheds | AAVFLLVVKPMNALKARTAKEEAETISDEERRHRELLEALRSRG* |
| Ga0075422_104280893 | 3300006196 | Populus Rhizosphere | AIAAAVFFFVVKPVQAMMARRAEPVEEGMPDEERRHQELLAALRESRA* |
| Ga0074053_111242961 | 3300006575 | Soil | AIAAAVFFFVVKPMDALMKRVAKPTEEEVSDEERRHQELLAVLRAR* |
| Ga0074047_119991142 | 3300006576 | Soil | FVAIAAAVFFFVVKPVQAMLARTQRTPVEEGMPDEERRHQELLSALRAAGSR* |
| Ga0075428_1003039513 | 3300006844 | Populus Rhizosphere | VFFFVVKPMQSIIARTHSPAEEGMPDEERRHQEVLAALNRIAA* |
| Ga0075428_1008121621 | 3300006844 | Populus Rhizosphere | AAAIFFFVVKPANAMMTRFTKPGEEAVDDEERRHQELLAAIRESR* |
| Ga0075433_114477471 | 3300006852 | Populus Rhizosphere | AIAAAVFFFVVKPVNALLKRYRTPAEEGMPDEERRHQELLAALRGASSPSTS* |
| Ga0079217_117443242 | 3300006876 | Agricultural Soil | IQFVAIADAVFFFVVKPVQAMLARGRRTPVEDGMPDEERRHQELLAALRTQRS* |
| Ga0079215_114092681 | 3300006894 | Agricultural Soil | AAAVFFFVVKPVNALLQRFRSPAEEGMPDEERRHQELLAALKAR* |
| Ga0075426_106206322 | 3300006903 | Populus Rhizosphere | RPVDMLIARLQRTAPEEGMPDEERRHQELLAALDRVALR* |
| Ga0075424_1026130281 | 3300006904 | Populus Rhizosphere | AIAAAVFFFVVKPMDSIMSRVRKPAEEEVSDEERRHQELLAALRARA* |
| Ga0075436_1002884531 | 3300006914 | Populus Rhizosphere | SAISFVAIAAVVFFFVVKPMNAIMSRVRKPAEEEISDDERRHQELLAALRARG* |
| Ga0079216_107173921 | 3300006918 | Agricultural Soil | ITFLATAAAIFFFVVKPVNAIMARMTTPAGDEVTDEERRHHELLAALEGLRR* |
| Ga0074063_125355161 | 3300006953 | Soil | ALITFVAIAAAVFFFVIKPYDAIKARMSRGEEAAIDDEERRHQELLAALRAR* |
| Ga0075435_1004866801 | 3300007076 | Populus Rhizosphere | VFFFVVRPVDMLIARLQRTAPEEGMPDEERRHQELLAALDRVALR* |
| Ga0099828_105264194 | 3300009089 | Vadose Zone Soil | AFLTDLIQFVAIGAAVFFFIVKPVQMMLARNRREPIEEGVPDEERRHQELLAALRASR* |
| Ga0099827_100007041 | 3300009090 | Vadose Zone Soil | AIAAAVFFFVVKPVNALLKRFRSPAEEGMPDEERRHQELLAALRGSSASAR* |
| Ga0111538_112291832 | 3300009156 | Populus Rhizosphere | VITFIAVGAAVFFFVVKPMQMMAARGQKEPIEEGMPDEERRHQELLAALEGLRR* |
| Ga0105092_102399373 | 3300009157 | Freshwater Sediment | AVFFFIVKPTQAILARRKAPVEEGMPDEERRHQELLAALAQVGSR* |
| Ga0126307_104452103 | 3300009789 | Serpentine Soil | FVVKPLNALLSRLQRTPAEEGMPDEERRHQELLAALATVRGR* |
| Ga0105084_10116791 | 3300009811 | Groundwater Sand | VFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRASN* |
| Ga0105084_11048482 | 3300009811 | Groundwater Sand | VIQFVAIAAAVFFFIVKPVQAMTARSRREPVEEGMPDEERRHQELLAALGRVSR* |
| Ga0105078_10442101 | 3300009823 | Groundwater Sand | AVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRASN* |
| Ga0126315_104824302 | 3300010038 | Serpentine Soil | VFFFIVKPVQAMLARPRREPVEEGMPDEERRHQELLAALGQLQR* |
| Ga0126308_110700322 | 3300010040 | Serpentine Soil | FVVKPVQAMMARFQRTPVEEGMPDEERRHQELLGALRGLAQ* |
| Ga0126312_102556932 | 3300010041 | Serpentine Soil | VFFFVVKPVNALMTRLRSPVQKGMPDEERRHQELLAALGRLGTR* |
| Ga0126311_100134467 | 3300010045 | Serpentine Soil | GASVFFFVVKPIDAMLSRSRRTPVEEGMPDEERRHQELLAALQARP* |
| Ga0126311_103366621 | 3300010045 | Serpentine Soil | GASVFFFVVKPIDAMLSRSRRTPVEEGMPDEERRHQELLAALQAARP* |
| Ga0126311_105022703 | 3300010045 | Serpentine Soil | AAVFFFIVKPVQMMLARGGREPVEEGMPDEERRHQELLAALRANR* |
| Ga0126306_103473442 | 3300010166 | Serpentine Soil | FFFVVKPINMIRTHRRGAAEEGLPDEERRHQELLAALAELRTG* |
| Ga0136847_102644432 | 3300010391 | Freshwater Sediment | FFFVVKPLNALMARMQKPGEEVVSDEERRHQELLAAIRESAR* |
| Ga0134122_115383393 | 3300010400 | Terrestrial Soil | FFVVKPMNALRERRAGGAQEEGLPDEERRHQELLAALRESRA* |
| Ga0138505_1000537992 | 3300010999 | Soil | DLLTFVAVAGAVFFFVVKPVNALTNRLHSPVEEGMPDEERRHQELLAALGQIRTSSR* |
| Ga0105246_103322643 | 3300011119 | Miscanthus Rhizosphere | TAAITFVSTAAAIFFFVVKPANALKSRFETQEEAAVSDEERRHQELLAALARVGR* |
| Ga0137391_107426411 | 3300011270 | Vadose Zone Soil | TDLIQFVAIGAAVFFVIVKPVQMMLARSRSEPTEEGMPDEERRHQELLAALRASR* |
| Ga0120159_10954491 | 3300012014 | Permafrost | VFFFIVKPVQMMLARRRRGPIEEGMPDEERRHQELLAAIRGLSR* |
| Ga0136631_104223491 | 3300012043 | Polar Desert Sand | PVQGMLERRRREPIEEGMPDEERRHQELLAALRARGA* |
| Ga0136638_101145541 | 3300012094 | Polar Desert Sand | KPVQMMLARGRREPIEEGMPDEERRHQELLAALRASN* |
| Ga0137380_108969261 | 3300012206 | Vadose Zone Soil | KPVQMMLVRRRKEPVEEGMPDEERRHQELLAALRASH* |
| Ga0137371_111390402 | 3300012356 | Vadose Zone Soil | FFFIVKPVNMLLQRFRSPAEEGLPDEERRHQELLAALRAAH* |
| Ga0137368_104473533 | 3300012358 | Vadose Zone Soil | AIQFVAIAAAVFLFVVKPVNALLQRFRSPAEEGMPDEERRHQELLAALRAAPTR* |
| Ga0136630_11269981 | 3300012529 | Polar Desert Sand | TDVIQFAAIAAAVFFFVVKPVQAMLERRRTEPIEEGMPDEERRHQELLAALRTRGA* |
| Ga0136640_104095701 | 3300012531 | Polar Desert Sand | IQFVAIGVAVFFFIVKPVQMMLARGRREPIEEGMPDEERRHQELLAALRASN* |
| Ga0157216_102767713 | 3300012668 | Glacier Forefield Soil | STITFVAIAAAVFFFVVKPMNVVMGRLRKPEADVVTEEERRHQELLAALEGLRR* |
| Ga0136611_101496422 | 3300012682 | Polar Desert Sand | FFIVKPVQMMLARGRREPIEEGMPDEERRHQELLAALRASN* |
| Ga0157293_102939741 | 3300012898 | Soil | AAVFFFIVKPMNALTARFVKPDEEEVPDEERRHQELLAALRAR* |
| Ga0157288_100969792 | 3300012901 | Soil | VFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR* |
| Ga0157288_101058223 | 3300012901 | Soil | AAAVFFFVVKPMDAIRKRMTKEEEATISDDERRHQELLAALRERNA* |
| Ga0157289_101984861 | 3300012903 | Soil | FFFVVKPIDALLKRTRGPVEEGMPDEERRHQELLRALREVSAR* |
| Ga0157283_101273801 | 3300012907 | Soil | KPIDALLKRTRGPVEEGMPDEERRHQELLRALREVSAR* |
| Ga0157308_102081522 | 3300012910 | Soil | VSTAAAIFFFVVKPANALNSRFETPEEAAVSDEERRHQELLAALARVGR* |
| Ga0157308_104144143 | 3300012910 | Soil | AVFFFVVKPMNMLRERRAGSAEEERLPDEERRHQELLAALRERRA* |
| Ga0157302_102980171 | 3300012915 | Soil | ITDVIQFLAIAAAVFFFIVKPVQAMLARSRREPIEEGMPDEERRHQELLAALGSIRR* |
| Ga0137419_119358112 | 3300012925 | Vadose Zone Soil | AVFFFIVKPVQMMLAAGRRDPVEEGIPDEERRHQELLAALRTRS* |
| Ga0164300_111362562 | 3300012951 | Soil | TAAITFVATAAAIFFFVVKPMGAIMARMRKSEDEVVSDEERRHQELLAAIRESAR* |
| Ga0164299_107158762 | 3300012958 | Soil | AAAVFFFVVKPVNAIVARSRGPEDEPVSDEERRHQELLAALRELDR* |
| Ga0164302_108452381 | 3300012961 | Soil | TNVIPFAAIAAAVFFFIVKPVDALLRRHRSPAEEGMPDEERRHQELLAALRGASAR* |
| Ga0164308_101703364 | 3300012985 | Soil | AAALFFFVVKPIDAIKSRMAKPTETEVTDEERRHQELLAALARIER* |
| Ga0164305_112884691 | 3300012989 | Soil | TFIATAAAVFFFVVKPMNAITARVRKRDEEEISDDERRHQELLAALRARA* |
| Ga0164305_116404442 | 3300012989 | Soil | VKPYDALTSRFAKPAEGAVDDEERRHQELLAALRAR* |
| Ga0157307_10487441 | 3300013096 | Soil | ITDAITFVATAAAVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRESRA* |
| Ga0157370_114074422 | 3300013104 | Corn Rhizosphere | AVFFFVVKPMDALTKRVEKPTEEEVSDEERRHQELLAALRAR* |
| Ga0157378_107362682 | 3300013297 | Miscanthus Rhizosphere | ITFVATAAAIFFFVVKPMGAIMARMRKSEDEVVSDEERRHQELLAAIRESGR* |
| Ga0120154_11504192 | 3300013501 | Permafrost | VKPVQMMLARSRREPIEEGMPDEERRHQELLAALRASK* |
| Ga0120109_11033463 | 3300014052 | Permafrost | VVKPYELYMARVRGPQEEVVPDEERRHQELLAAIRGLGR* |
| Ga0075313_11789661 | 3300014267 | Natural And Restored Wetlands | AAVFFFIVKPMSAIMARMRKPGEEEVTDEERRHQELLEAVRGISR* |
| Ga0075342_12520852 | 3300014320 | Natural And Restored Wetlands | VTTAAAIFFFVVKPVSTLMARMAKPDEVEVTDEERRHQELLAALRARQPR* |
| Ga0157380_100649421 | 3300014326 | Switchgrass Rhizosphere | ITFIAPAAAIFFFVVRPMNALMARFQKPEEETVSDEERRHQELLAALRAR* |
| Ga0157379_122304842 | 3300014968 | Switchgrass Rhizosphere | VFFFVVKPMDAIKARMSKAEEATIDDDERRHQELLAALAARN* |
| Ga0173480_104661903 | 3300015200 | Soil | AAAVFFFVVKPMNMLRERRAGSVEEEGLPDEERRHQELLAALGSIRR* |
| Ga0137409_107563951 | 3300015245 | Vadose Zone Soil | IGAAVFFFILKPVQMMLARNRREPIEEGVPDEECRHQELLAALRASR* |
| Ga0182007_103049132 | 3300015262 | Rhizosphere | AVYFFVVKPVEAMMARFKREPIEEGMPDEERRHQELLAALGRLAAR* |
| Ga0132258_103163204 | 3300015371 | Arabidopsis Rhizosphere | FITDVISFVAIAAAVFLFVVKPMDALMSRARKPAEDEVSDVERRHQELLAALRTRG* |
| Ga0132258_120611304 | 3300015371 | Arabidopsis Rhizosphere | AVITFIAIAAAVFFFVVKPMDAIKARMSKAEEATIDDDERRHQELLAALAARN* |
| Ga0132258_131020871 | 3300015371 | Arabidopsis Rhizosphere | AAVFFFVVKPMDAIKKRMTKEEEAAVSDEERRHQELLAALRERNA* |
| Ga0132258_136476231 | 3300015371 | Arabidopsis Rhizosphere | QMMAARGQKEPIEEGMPDEERRHQELLAALRARP* |
| Ga0132256_1002678565 | 3300015372 | Arabidopsis Rhizosphere | AVFFFVVKPMNALRERRAGGAEEEGLPDEERRHQELLAALRESRA* |
| Ga0132256_1025671561 | 3300015372 | Arabidopsis Rhizosphere | VSTAAAIFFFVVKPVNAIVARGHRPEDEPVSDEERRHQELLVALREVSR* |
| Ga0132257_1005381284 | 3300015373 | Arabidopsis Rhizosphere | FFFVVKPVAAMAARRAAPIEAGMPDEERRHQELLAALGSLSR* |
| Ga0132257_1019780792 | 3300015373 | Arabidopsis Rhizosphere | VFFFVVKPVNALTARFQSPVEEGTPDEERRHQELLAALRESRA* |
| Ga0132257_1021365032 | 3300015373 | Arabidopsis Rhizosphere | VFFFIVKPVQMMLERSRKEPIEEGMPDEERRHQELLAALRASR* |
| Ga0132257_1027258531 | 3300015373 | Arabidopsis Rhizosphere | PVQAMMARRAAPVEEGMPDEERRHQEVLAALGRLSR* |
| Ga0132257_1030396371 | 3300015373 | Arabidopsis Rhizosphere | ITFVSTAAAIFFFVVKPANALKSRFETPEEAAVSDEERRHQELLVALERLGR* |
| Ga0132255_1010846103 | 3300015374 | Arabidopsis Rhizosphere | IAIAAAVFFFVVKPMDAIKARMSKAEEATIDDDERRHQELLAALAARN* |
| Ga0132255_1030654721 | 3300015374 | Arabidopsis Rhizosphere | VIQFVAIAAAVFFFVVKPVSALMARFQSPVEERTPDEERRHQELLAALRESRA* |
| Ga0134074_13023901 | 3300017657 | Grasslands Soil | VKPVNVLLQRFLSPAEEGMPDEERRHQELLAALRSSSSQAS |
| Ga0183260_109342252 | 3300017787 | Polar Desert Sand | QFLAIGAAVFFFVVKPVQEMLARSRRTPVEEGMPDEERRHQELLAALQTRT |
| Ga0136617_102801811 | 3300017789 | Polar Desert Sand | VKPVQMMLARGRREPIEEGMPDEERRHQELLAALRASN |
| Ga0163161_116949821 | 3300017792 | Switchgrass Rhizosphere | AVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR |
| Ga0184610_12282462 | 3300017997 | Groundwater Sediment | VVKPVQAMLARGRGEPGDEGMPDEERRHQELLAALRASN |
| Ga0184610_13126551 | 3300017997 | Groundwater Sediment | TFVAIAAAVFFVVVKPMQAITARRKKDEPDVVPDEERRHQELLAALRAR |
| Ga0187788_104175131 | 3300018032 | Tropical Peatland | IITFVSIAAAVFFFVVRPYEAIKARRSPEEEAAVDDDERRHLELVEAIRGIRA |
| Ga0184620_101475751 | 3300018051 | Groundwater Sediment | FITDVIQFVAIAAAVFFFIVKPVQLARAQRSGRDAEEEAPSDEERRHQELLAALRAG |
| Ga0184623_103997161 | 3300018056 | Groundwater Sediment | GAFITDVIQFLAIGAAVYFFVVKPVQMMLERSRRTPVEEGMPDEERRHQELLAALRGRG |
| Ga0184619_100524102 | 3300018061 | Groundwater Sediment | MTNVIKFVAIAAAVFFSIVKPVNVLLQRFQSPSEEGMPDEERRHQELLAALRSSSS |
| Ga0184619_104597871 | 3300018061 | Groundwater Sediment | VFFFVVKPVNALLKRFRSPAEEGMPDEERRHQELLAALRGASSPAAG |
| Ga0184619_105002871 | 3300018061 | Groundwater Sediment | MTNVIKFVAIAAAVFFSIVKPVNVLLQRFRSPAEEGMPDEERRHQQLLAALRSSSS |
| Ga0184637_104449801 | 3300018063 | Groundwater Sediment | AAVFFFVVKPMNALVGRMQAPGEAAISDEERRHQELLQAINGLGR |
| Ga0184635_101628781 | 3300018072 | Groundwater Sediment | VSVAAAVFFFVVKPINSLMGRFRSPVEEGMPDEERRHQELLAALKAR |
| Ga0184633_106183771 | 3300018077 | Groundwater Sediment | IAFVAIAAAVFFFVVKPVGAMVARMKKPGEEAVSDEERRHQELLAALRARG |
| Ga0184628_102365672 | 3300018083 | Groundwater Sediment | AAVFFFVVKPVQAMMARSERTPVEEGMPDDERRHQELLSALRAVGSR |
| Ga0190272_116975421 | 3300018429 | Soil | TAVFFFVVKPVQAMLERRREPIEEGMPDEERRHQELLAALRARS |
| Ga0190275_104931431 | 3300018432 | Soil | AAAIFFFVVRPMGGLMARMRKPDATEVTDEERRHQELLAALRARA |
| Ga0190275_108128412 | 3300018432 | Soil | AAVFFFVVKPVQAMLARSGRTPVEEGMPDDERRHQELLSALRAAGSR |
| Ga0190268_101587022 | 3300018466 | Soil | VIQFVSIAAAVFFFVVKPVNALLQRIRSPVEEGMPDEERRHQELLAALKAR |
| Ga0190268_120072832 | 3300018466 | Soil | FFFIVKPMNALQGRFAKPEDEVVSDEERRHQELLAALRAN |
| Ga0190270_102343635 | 3300018469 | Soil | AVFFFVVKPVNALLDRLRSPAEEGMPDEERRHQELLTALRARP |
| Ga0190271_122519591 | 3300018481 | Soil | IAAAVFFFVVRPMKMLMERRAKDEPEVVSDEERRHQELLAALRART |
| Ga0184644_17414122 | 3300019269 | Groundwater Sediment | VFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRASN |
| Ga0190267_110092402 | 3300019767 | Soil | VVKPVQMMLARGRKEPIEEGMPDEERRHQELLAALRARA |
| Ga0193739_11037562 | 3300020003 | Soil | AVFFCFVKPVTAMMRRRGPEPIEEGMPDDERRHQELLAALSQISSR |
| Ga0193696_11439842 | 3300020016 | Soil | AAIFFFVVKPMVAIQERRKRGEEEVVTDEERRHRELIAAIERART |
| Ga0193696_11750721 | 3300020016 | Soil | FITDAIAFLAIAAALFFFVVKPMNMIMERRRGPGEEVVSDEERRHQELLAALRAAR |
| Ga0213881_102389793 | 3300021374 | Exposed Rock | AVFFFIVKPVQMVLARRTQRDAEEEAPSDEERRHQELLAALAALQR |
| Ga0247747_10431711 | 3300022737 | Soil | AAVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR |
| Ga0222622_100063548 | 3300022756 | Groundwater Sediment | LAIAAALFFFVVKPMNMIMERRRGPGEEVVSDEERRHQELLAALRAAR |
| Ga0222622_102772953 | 3300022756 | Groundwater Sediment | FFCVVKPVNALKARLTPPAEAELSDEERRHRELLAALEGLKR |
| Ga0222622_111764932 | 3300022756 | Groundwater Sediment | ITDLITFLAIAAAVFFFIVKPVDMISKRRRLEGPEADEISDEERRHQELLAALRARA |
| Ga0247790_102137661 | 3300022915 | Soil | VVKPVNAMLRRFRGPVEEGMPDEERRHQELLAALKASRA |
| Ga0247793_10818811 | 3300023066 | Soil | FFFVVKPMNAIMKRVSKPTDEEISDEERRHQELLAALRAR |
| Ga0247754_10252711 | 3300023102 | Soil | ITDVISFVAIAAAVFFFVVKPMNAIMKRVSKPTDEEISDEERRHQELLAALRAR |
| Ga0247800_10827102 | 3300023263 | Soil | FFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR |
| Ga0247789_10125723 | 3300023266 | Soil | PRDRRAVFFFVVKPMDSIMSRVRKPAEEEVSDEERRHQELLAALRARA |
| Ga0247794_103305011 | 3300024055 | Soil | STAAAIFFFVVKPANALNSRFETPEEAAVSDEERRHQELLAALERLGR |
| Ga0209519_104118441 | 3300025318 | Soil | FVVKPLNALTARMKKPEEDAVPDEERRHQELLAALRSRG |
| Ga0209641_104013753 | 3300025322 | Soil | IAFVAVAAAIFFFVVKPMQALMSRLKKPEEVVISDEERRHQELLTALRAAR |
| Ga0209641_104144631 | 3300025322 | Soil | TAAAIFFVVVKPMNALAERIQKPGEEALSDEERRHQELLAAIRESARQRS |
| Ga0209751_105348441 | 3300025327 | Soil | FVIIAAAIFFVVKPASMTLERLKGKEEEAVPDEERRHQELLAALRTRG |
| Ga0209751_108745741 | 3300025327 | Soil | IVAVITFVAIAAAVFFFIVKPVDAITARTKRPGEEATPDEERRHQELLAAIKEMSR |
| Ga0210143_10262551 | 3300025792 | Natural And Restored Wetlands | AFLTDAIAFLGVAVAVFFFVVKPINALRERRGGSAEEEGLPDEERRHQELLAALRETRA |
| Ga0209540_104652692 | 3300025888 | Arctic Peat Soil | TAVFFFIVKPVDTAKARFAKPGEEELSDEERRHQELLSALQIVGK |
| Ga0207642_107526892 | 3300025899 | Miscanthus Rhizosphere | TFIATAAAIFFFVVKPMNALMARMSKPEEEALSDEERRHQELLAALRAR |
| Ga0207647_102346573 | 3300025904 | Corn Rhizosphere | ITDVISFVAIAAAVFFFVVKPMDALTKRVEKPTEEEVSDEERRHQELLAALRAR |
| Ga0207645_108119922 | 3300025907 | Miscanthus Rhizosphere | TDVISFVAIAAAVFFFVVKPMDALTKRVEKPTEEEVSDEERRHQELLAALRAR |
| Ga0207663_105660852 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | YYGAFLTDLVQFAAIGAAVFFFIVKPVQMMQARNRQEPVEEGMPDEERRHQELLAALQAN |
| Ga0207662_112060881 | 3300025918 | Switchgrass Rhizosphere | FITSAITFLATAAAIFLFVVKPYDALTSRFAKPAEGAVDDEERRHQELLAALQAR |
| Ga0207701_113292242 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | FFFVVKPMDAIKQRMTREEEATISDEERRHQELLAALGARN |
| Ga0207686_105500501 | 3300025934 | Miscanthus Rhizosphere | IAAAVFFFVVKPMDAMKKRMTRAEEATISDEERRHQELLAALRSRP |
| Ga0207640_118724822 | 3300025981 | Corn Rhizosphere | IAAAVFFFVVKPMDALTKRRAKPTEEEVSDEERRHQELLAALRAR |
| Ga0207640_120882581 | 3300025981 | Corn Rhizosphere | AITFVATAAAVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR |
| Ga0207658_119480901 | 3300025986 | Switchgrass Rhizosphere | SFVAIAAAVFFFVVKPMNAIMKRVSKPTDEEISDEERRHQELLAALRAR |
| Ga0207683_109440301 | 3300026121 | Miscanthus Rhizosphere | VAIAAAVFFFVVKPMDAMKKRMTRAEEATISDEERRHQELLAALRSRP |
| Ga0207698_109434583 | 3300026142 | Corn Rhizosphere | AIAFVAVAAAVFFFVVKPMTILRERRAGGAEEEGLPDEERRHQELLAALRESRA |
| Ga0209803_11259773 | 3300026332 | Soil | IVKPVNMLLQRFRSPAEEGLPDEERRHQELLAALRAAH |
| Ga0207497_1043952 | 3300026786 | Soil | FVVKPVNAMLRRFRGPVEEGMPDEERRHQELLAALKGSRA |
| Ga0208761_10294461 | 3300026995 | Soil | FVVKPMNALTSRFVKPGEEEIPDEERRHQELLAALRARA |
| Ga0247818_107856462 | 3300028589 | Soil | TDLIQFIAIGLAVFFFIVKPVQMALARRKGREAEEEAPSDEERRHQELLAALRARG |
| Ga0307313_100669561 | 3300028715 | Soil | QFVAIGAAVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRASN |
| Ga0307307_100180151 | 3300028718 | Soil | AFLTDLIQFVAIGAAVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRASN |
| Ga0307301_102099361 | 3300028719 | Soil | VFFFIVKPVQAMIARMMRKPIEEGMPDEERRHQELLAALGRVWR |
| Ga0307318_101370442 | 3300028744 | Soil | AAAIFFFVVKPVNAVMSRMQKPAEDEVTDDERRHQELLAALRSR |
| Ga0307297_101380801 | 3300028754 | Soil | ITDVIQFLAIAAAVFFFIVKPVQAMLARSRREPIEEGMPDEERRHQELLAALGSIRR |
| Ga0307320_100523491 | 3300028771 | Soil | AIFFFVVKPMNVLRERRAGGAEEEGLPDEERRHLELLAALREIRA |
| Ga0307288_100347723 | 3300028778 | Soil | NLIQFIAIAASVFFFVVKPVNALLQRHKSPAEEGMPDEERRHQELLAALHASR |
| Ga0307323_101882512 | 3300028787 | Soil | ITDAIAFLAIAAALFFFVVKPMNMIMERRRGPGEEVVSDEERRHQELLAALRAAR |
| Ga0307323_103225771 | 3300028787 | Soil | AVFFFIVKPMQMMLARRRGGPIEEGMPDEERRHQELLAALRASN |
| Ga0247824_109558002 | 3300028809 | Soil | IAAAVFFFVVRPMDAIMTRVRKPADAEVSDEERRHQELLAALRARA |
| Ga0307292_101968891 | 3300028811 | Soil | FFVVKPVNALKARFITPAETELADEERRHRELLTALEGLKR |
| Ga0307292_102109321 | 3300028811 | Soil | PVTAMMNRSRREPIEEGMPDEERRHQELLAALGQPSR |
| Ga0247825_105412582 | 3300028812 | Soil | VTAAAIFFFVVKPMNALMARVRKPAEDEITDEERRHQELLAAIKGLGR |
| Ga0307302_100107331 | 3300028814 | Soil | TDAIAFLAIAAALFFFVVKPMNMIMERRRGPGEEVVSDEERRHQELLAALRAAR |
| Ga0307302_105336101 | 3300028814 | Soil | LIQFVAIAASVFFFIVKPVDALLKRHKSAAEEGMPDEERRHQELLAALHASR |
| Ga0307310_105468992 | 3300028824 | Soil | TDLITFLAIAAAVFFFIVKPVDMISKRRRLEGPEADEISDEERRHQELLAALRARA |
| Ga0307314_101722731 | 3300028872 | Soil | AFLAIAAALFFFVVKPMNMIMERRRGPGEEVVSDEERRHQELLAALRAAR |
| Ga0307289_102674162 | 3300028875 | Soil | FVAIAASVFFFIVKPVDALLKRHKSAAEEGMPDEERRHQELLAALHASR |
| Ga0307289_103980211 | 3300028875 | Soil | IQFVAIAAAVFFFVVKPVNALMARFHSPAEEGMPDEERRHQELLTALRESRA |
| Ga0307277_103324842 | 3300028881 | Soil | TDLIQFVAIGAAVFFFIVKPVQMMLERSRREPIEEGMPDEERRHQELLAALRASN |
| Ga0307308_101121974 | 3300028884 | Soil | AGAVFFFVVKPVNALLQRFRSPAEEGMPDEERRHQELLAALRSSSA |
| Ga0299907_101984533 | 3300030006 | Soil | FLTAVITFLTTALAIFFFVVKPVGAVMARTEKPTEEEVTDEERRHQELLAALARR |
| Ga0247826_114256002 | 3300030336 | Soil | AIQFVAIAAAVFFFVVRPLDAIMGRVRKPTEEGISDEERRHQELLAALRARA |
| Ga0299906_102757173 | 3300030606 | Soil | TAAIQFLAIAAAVFFFIVKPMTAIMARMRKPDAEEVTDEERHHRELLEAIRGISR |
| Ga0299913_108869851 | 3300031229 | Soil | VVKPVNAMLTRRRGPVEEGMPDEERRHQEVLAALGRIGAR |
| Ga0265328_101617171 | 3300031239 | Rhizosphere | FITDLTQFAAIGAAVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRARS |
| Ga0265325_102853621 | 3300031241 | Rhizosphere | DLIQFAAIGAAVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRARS |
| Ga0265327_100313554 | 3300031251 | Rhizosphere | AIGAAVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRARS |
| Ga0265316_100095201 | 3300031344 | Rhizosphere | AFITDLIQFAAIGAAVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRARS |
| Ga0310887_104564901 | 3300031547 | Soil | VATAAAIFFFVVKPMNALMARVKKPEEEVVSDEERRHQELLAALRAR |
| Ga0310887_110814761 | 3300031547 | Soil | AAVFFFVVKPMDSIMSRVRKPAEEEVSDEERRHQELLAALRARA |
| Ga0307408_1013898981 | 3300031548 | Rhizosphere | ITDVISFVAIAAAVFFFVVKPMNALMKRVSKPTEEEVSDEERRHQELLAALRART |
| Ga0310886_109358871 | 3300031562 | Soil | ITDVIQFLAIAAAVFLFIVKPVQGMVARREAPVEEGMPDEERRHQELLAALGQVGSR |
| Ga0247727_102870742 | 3300031576 | Biofilm | MITFIAIAAAVFFFVVKPVQAALAGTRQPAGEDVSGEERRHQELLATIRGIGR |
| Ga0307469_123381281 | 3300031720 | Hardwood Forest Soil | IVKPVQAMVARREAPVEEGMPDEERRHQELLAALGQVGSR |
| Ga0307468_1009567202 | 3300031740 | Hardwood Forest Soil | VFLFIVKPVQAMVARREAPVEEGMPDEERRHQELLAALGQVGSR |
| Ga0315290_100653504 | 3300031834 | Sediment | MVITFLVIAAAVFFFVVKPLEAIKARRKQEEEEVVSDEERRHQELLAARKARN |
| Ga0315290_107432512 | 3300031834 | Sediment | IFFFVVKPMNALMLRMEKPGEAAVPDEERRHQELLAAIKEISR |
| Ga0318517_105478321 | 3300031835 | Soil | AAVFFFIVKPIDALRARRAKGEDEAPLSDEERRHQELLAALRAS |
| Ga0310907_108926061 | 3300031847 | Soil | IAAAVFFFVVKPMNAIMARGRKPTDEVVSDEERRHQELLAALRARG |
| Ga0310892_105537371 | 3300031858 | Soil | AAVFFFVVKPMDALMKRVAKPTDEEVSDEERRHQELLAALRTR |
| Ga0307416_1023210991 | 3300032002 | Rhizosphere | VQFLAVAAAVFFFVVKPVQAMMARRRREPIEEGMPDEERRHQELLTALGRMAR |
| Ga0318569_100824871 | 3300032010 | Soil | FFIVKPIDALRARRAKGEDEAPLSDEERRHQELLAALRAS |
| Ga0310906_105164181 | 3300032013 | Soil | AAITFVSTAVAIFFFVVKPANALKTRFTPAEEAAISDEERRHQELLAALERLGR |
| Ga0315292_103587263 | 3300032143 | Sediment | AAAVFFFVVKPMDAIKARTAKQEEAAVSDEERRHQELLAALRSRN |
| Ga0315281_115763452 | 3300032163 | Sediment | MVITFPVIAAAVFFFVVKPLEAIKARRKQEEEEVVSDEERRHQELLAARKARN |
| Ga0247830_113341532 | 3300033551 | Soil | VAIAAAVFFFVVKPIDALTSRRRPAAAEDEVPDEERRHLELLAALGQLSR |
| Ga0364925_0180540_2_157 | 3300034147 | Sediment | LITFIATAAAIFFFVVKPVNAVMSRMKKPAEDEVTDEERRHQELLAALRSR |
| Ga0364931_0020251_1713_1871 | 3300034176 | Sediment | ITFVATAAALFFVDVRPMNALVGRMQAPGEAAISDEERRHQELLQANKGLGR |
| ⦗Top⦘ |