 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F016808 |
| Family Type | Metagenome |
| Number of Sequences | 244 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPRLKKKKKK |
| Number of Associated Samples | 176 |
| Number of Associated Scaffolds | 244 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 63.11 % |
| % of genes near scaffold ends (potentially truncated) | 17.62 % |
| % of genes from short scaffolds (< 2000 bps) | 79.10 % |
| Associated GOLD sequencing projects | 152 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.803 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (16.803 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.541 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.197 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 244 Family Scaffolds |
|---|---|---|
| PF01555 | N6_N4_Mtase | 5.74 |
| PF03237 | Terminase_6N | 2.46 |
| PF05063 | MT-A70 | 2.05 |
| PF08291 | Peptidase_M15_3 | 1.64 |
| PF03354 | TerL_ATPase | 0.82 |
| PF02195 | ParBc | 0.82 |
| PF06147 | DUF968 | 0.82 |
| PF08401 | ArdcN | 0.41 |
| PF01381 | HTH_3 | 0.41 |
| PF02018 | CBM_4_9 | 0.41 |
| PF00589 | Phage_integrase | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 244 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 5.74 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 5.74 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 5.74 |
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 4.10 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.82 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.80 % |
| All Organisms | root | All Organisms | 33.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 16.80% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 15.16% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.89% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.48% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.92% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.10% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.28% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.28% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.28% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.87% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.87% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.46% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.46% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 2.46% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.64% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.23% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.23% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.23% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.82% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.82% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.82% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.82% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat | 0.41% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.41% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.41% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.41% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.41% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.41% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.41% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.41% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.41% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.41% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006620 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ10 time point | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011262 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, total | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019701 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_1-2_MG | Environmental | Open in IMG/M |
| 3300019703 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_7-8_MG | Environmental | Open in IMG/M |
| 3300019707 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_0-1_MG | Environmental | Open in IMG/M |
| 3300019714 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_2-3_MG | Environmental | Open in IMG/M |
| 3300019732 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MG | Environmental | Open in IMG/M |
| 3300019742 | Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_8_MG | Environmental | Open in IMG/M |
| 3300019747 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_5-6_MG | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300019938 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026125 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027077 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032254 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100954541 | 3300000101 | Marine | MIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKRN |
| DelMOSum2010_101396193 | 3300000101 | Marine | MIDNIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKK* |
| DelMOSum2010_102095962 | 3300000101 | Marine | MIDQFFYRLFGMIDNCMGYLFDRFISDVPKKKKKK* |
| DelMOSum2010_102732722 | 3300000101 | Marine | MIDKFFYIFFGAVDDAMGYLFDRFISDAPKKKKKK* |
| DelMOSum2011_100295352 | 3300000115 | Marine | MIDNIIYRLFGVIDNFFGYLFDKFISDDPSLKKRKKKK* |
| DelMOSum2011_101163421 | 3300000115 | Marine | MIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKRNK* |
| DelMOSum2011_102034173 | 3300000115 | Marine | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKKK* |
| DelMOSpr2010_100201545 | 3300000116 | Marine | MIDKFFYMLFGSIDDAMGYLFDRFISDAPKKKKKK* |
| DelMOSpr2010_101149182 | 3300000116 | Marine | MIDRLFYRFFGMIDDCMGYLFDRFISDAPKKKKK* |
| DelMOWin2010_100383693 | 3300000117 | Marine | MAKRVXSMIDNIIYXVFGIVDNFMGYLFDRFVSDDPRLKKKKKKK* |
| DelMOWin2010_100400635 | 3300000117 | Marine | MIDNIIYKVFGMVDNFMGYLFDRFVSDAPKKKKKK* |
| DelMOWin2010_102122163 | 3300000117 | Marine | MIDKLIYKVFGIVDNFMGYLFDRFISDAPKKKNKK* |
| JGI20151J14362_100296085 | 3300001346 | Pelagic Marine | MAKRIQSMIDNIIYRVFGMVDNFMGYLFDRFVSDDPKFKKKKKR* |
| JGI20156J14371_100639653 | 3300001347 | Pelagic Marine | MAKRVQSMIDNIIYRVFGMVDNFMGYLFDRFVSDDPKFKKKKKR* |
| JGI20154J14316_101014541 | 3300001348 | Pelagic Marine | MIDQFFYRLFGFIDDAMGYLFDRFISDAPKKKKKK* |
| JGI20158J14315_100230184 | 3300001355 | Pelagic Marine | MAKRVQSMIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKKR* |
| Ga0073579_12408405 | 3300005239 | Marine | LIDKFFYIFFGAVDNAMGYLFDRFISDAPKKKKKNNYEQR* |
| Ga0074649_12539202 | 3300005613 | Saline Water And Sediment | MIDNIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKKK* |
| Ga0078893_1005196838 | 3300005837 | Marine Surface Water | MIDNFIYKFFGMVDNFMGYLFDRFVSDDPKLKKKKKK* |
| Ga0078893_101746911 | 3300005837 | Marine Surface Water | MIDNIIYRVFGIVDNFMGYLFDRFVFDDPRLKKKKKKK*EIL |
| Ga0075462_102700102 | 3300006027 | Aqueous | MIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKRNK* |
| Ga0075466_10338154 | 3300006029 | Aqueous | MAKRIQGMIDNIIYKVFGMVDDFMGYLFDRFVSDAPKKKKKK*EILKF* |
| Ga0075466_10643463 | 3300006029 | Aqueous | MIDKLIYKVFGIVDNFMSYLFDRFISDAPKKKKKK* |
| Ga0075466_11957932 | 3300006029 | Aqueous | MAKRVQSMIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKKK* |
| Ga0070744_102062161 | 3300006484 | Estuarine | MIDKFFYKMFEMVDDFMGYLFDRFISDAPKKKIKNIDSP |
| Ga0101444_1175635 | 3300006620 | Marine Surface Water | MIDNIIYRVFGIVDNFMGYLFDRFVFDDPRLKKKKKKK* |
| Ga0075461_101024954 | 3300006637 | Aqueous | MIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKKK* |
| Ga0098038_10454006 | 3300006735 | Marine | MIDQFFYRLFGMIDNCMGYLFDRFISDAPKKKKKK* |
| Ga0098038_11119014 | 3300006735 | Marine | MIDNIIYRVFGIIDNFMGYLFDRFVSDNPKLKKNKKK*EIQKF* |
| Ga0098038_11847973 | 3300006735 | Marine | MIDNIIYRFFGMIDNFFGYLFDKFISDNPKLKKKKKK* |
| Ga0098037_11410182 | 3300006737 | Marine | MIDNIIYRVFGIVDNFMGYLFDRFISDDPRLKKKKKKK* |
| Ga0098037_12280572 | 3300006737 | Marine | MIDNIIYRVFGMVDNFMGYLFDRFISDDPRLKKKKRKK*EILKF* |
| Ga0098042_10991912 | 3300006749 | Marine | MIDNIIYRVFGMVDNFMGYLFDRFISDDPRLKKKKRKK* |
| Ga0098042_11073901 | 3300006749 | Marine | NIIYRFFGMIDNFFGYLFDKFISDNPKLKKKKKK* |
| Ga0098042_11564232 | 3300006749 | Marine | MIDNFIYKFFGMVDNFMGYLFDRFISDDPKLKKKKKK* |
| Ga0098042_11837641 | 3300006749 | Marine | MIDNIIYRLFGVIDNFFGYLFDKFISDDPNLKKRKKKK*EILKY* |
| Ga0098048_12559133 | 3300006752 | Marine | MIDNFIYRLFGLIDNTMGYLFDRFISDAPKKKKKK* |
| Ga0098054_10147071 | 3300006789 | Marine | MIDNMFYKFFGMVDNFMGYLFDRFVSDDPRLKKKKRKK* |
| Ga0098054_10481312 | 3300006789 | Marine | MIDNMFYKFFGMVDNFMGYLFDRFVSDDHRLKKKKRKK* |
| Ga0098054_10586982 | 3300006789 | Marine | MIDKLIYKVFGIVDNFMSYLFDRFVSDAPKKKKKK* |
| Ga0098055_10282893 | 3300006793 | Marine | MIDNIIYKLFGIVDNFMGYLFDRFVSDDPRLKKKKKK* |
| Ga0098055_11601543 | 3300006793 | Marine | MIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKRKK* |
| Ga0098055_12905322 | 3300006793 | Marine | MIDNIIYRLFGIIDNFFGYLFDKFISDDPSLKKRKKKK* |
| Ga0070749_103408212 | 3300006802 | Aqueous | MAKRVQSMIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKKK* |
| Ga0070749_106181382 | 3300006802 | Aqueous | MIDNIIYRVFGIVDNFMGYLFDRFVSNDPKLKKKKKK* |
| Ga0075467_101557967 | 3300006803 | Aqueous | MIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKKK*LKTLKIL* |
| Ga0070754_101984133 | 3300006810 | Aqueous | MIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKKK* |
| Ga0075475_104556972 | 3300006874 | Aqueous | MAKRVQSMIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKRNK* |
| Ga0098060_10808004 | 3300006921 | Marine | MIDKLIYKMFGMVDNFMGYLFDRFVSDAPKKKKKK* |
| Ga0098060_11784512 | 3300006921 | Marine | MIDNIIYKFFGMVDNFMGYLFDRFVSDDPRLKKKKRKK* |
| Ga0098060_11994162 | 3300006921 | Marine | MAKRIQSMIDNMFYKFFGMVDNFMGYLFDRFVSDDHRLKKKKRKK* |
| Ga0098045_10636555 | 3300006922 | Marine | MIDNMFYKFFGMVDNFMGYLFDRFVSDDPRLKKKK |
| Ga0098046_10698112 | 3300006990 | Marine | MIDNIIYRLFGVIDNFFGYLFDKFISDDPNLKKRKKKK* |
| Ga0070752_11636042 | 3300007345 | Aqueous | MIDKLIYKMFGMVDNFMGYLFDRFVSDAPKKKEKK* |
| Ga0102948_11588851 | 3300007623 | Water | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKRKK* |
| Ga0102899_10622022 | 3300007706 | Estuarine | MAKRIQGMIDNIIYRLFGMVDNFMGYLFDRFVSDAPKKKKKK* |
| Ga0102951_10358852 | 3300007725 | Water | MIDNIIYRLFGIIDRFFGYLFDKFISDDPRLKKKKRKK* |
| Ga0102954_100151411 | 3300007778 | Water | MIDNIIYRLFGIIDRFFGYLFDKFISDDPRLKKKKKKK* |
| Ga0102954_10125007 | 3300007778 | Water | MIDNIIYRVFGIIDNFMGYLFDRFVSDNPRLKKKKKKK* |
| Ga0099850_14023031 | 3300007960 | Aqueous | SIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKKK* |
| Ga0114910_11801772 | 3300008220 | Deep Ocean | MIDNIIYRVFGLVDNFMGYLFDRFVSDDPKLKKKKKK* |
| Ga0102960_10059434 | 3300009000 | Pond Water | MIDNIIYRLFGMMDRFFGYLFDKFISDDPRLKKKKKKK* |
| Ga0102960_10738132 | 3300009000 | Pond Water | MIDNIMYRLFGIVDNFMGYLFDRFVSDDPRLKKKKRKK* |
| Ga0102960_11831672 | 3300009000 | Pond Water | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPRLKKKKKKNERY* |
| Ga0115549_11152593 | 3300009074 | Pelagic Marine | MIDNIIYKVFGMVDNFMGYLFDRFISDAPKKKKKK* |
| Ga0115550_12404882 | 3300009076 | Pelagic Marine | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPKLKKKKKKK* |
| Ga0102812_101217222 | 3300009086 | Estuarine | MIDKFFYMFFGALDDAMGYLFDRFISDAPKKKKKK* |
| Ga0114995_100371694 | 3300009172 | Marine | MIDKIFYTLFGSIDNAMGYLFDRFISDAPKKKKKK* |
| Ga0115551_15128182 | 3300009193 | Pelagic Marine | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPKFKKKKKR* |
| Ga0114994_107043692 | 3300009420 | Marine | MIDRLFYRFFGMIDDCMGYLFDKFISDAPKKKKK* |
| Ga0115548_10533325 | 3300009423 | Pelagic Marine | VQSMIDNIIYKVFGMVDNFMGYLFDRFISDAPKKKKKK* |
| Ga0115548_10786663 | 3300009423 | Pelagic Marine | MIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKKR* |
| Ga0115548_11402091 | 3300009423 | Pelagic Marine | NIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKKK* |
| Ga0114915_10151272 | 3300009428 | Deep Ocean | MIDRLFYRFFGMIDDCMGYLFDKFISDAPRCKCKKKKK* |
| Ga0115545_10364966 | 3300009433 | Pelagic Marine | MIDNIIYRVFGIVDNFMGYLFDRFISDDPRLKKKKKK* |
| Ga0115545_13350382 | 3300009433 | Pelagic Marine | MIDKLIYKVFGMVDNFMGYLFDRFVSDAPKKNKKK* |
| Ga0115546_10315631 | 3300009435 | Pelagic Marine | KRVQSMIDNIIYKVFGMVDNFMGYLFDRFISDAPKKKKKK* |
| Ga0115546_10471532 | 3300009435 | Pelagic Marine | MIDNIIYKVFGMIDNFMGYLFDRFVSDDPRLKKKKKR* |
| Ga0115008_102244966 | 3300009436 | Marine | MIDRLFYKFFGMIDNCMGYLFDKFISDAPKKKKK* |
| Ga0115556_10557031 | 3300009437 | Pelagic Marine | MVDKFFYIFFGAVDDAMGYLFDRFISDAPKKKKKK* |
| Ga0115556_11156462 | 3300009437 | Pelagic Marine | MIDNIIYKVFGMVDDFMGYVFDRFISDAPKKKKKK* |
| Ga0115556_13268863 | 3300009437 | Pelagic Marine | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKKKK* |
| Ga0115556_13575752 | 3300009437 | Pelagic Marine | MIDNIIYKVFGMVDNFMGYLFDRFISDDPRLKKKKKKK* |
| Ga0115563_11128102 | 3300009442 | Pelagic Marine | MIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKKKK* |
| Ga0115553_13716483 | 3300009445 | Pelagic Marine | MIDNIIYKVFGMVDNFMGYLFDRFVSDDPKFKKKKKR |
| Ga0115558_12228221 | 3300009449 | Pelagic Marine | MIDNIIYKMFGIVDNFMGYLFDRFVSDDPRLKKKKKK* |
| Ga0115558_13913781 | 3300009449 | Pelagic Marine | MIDNIIYRVFGKVDNFMGYLFDRFISDAPKKKKKK* |
| Ga0115554_11240185 | 3300009472 | Pelagic Marine | MIDNIIYKMFGIVDNFMGYLFDRFVSDDPRLKKKK |
| Ga0115570_101079991 | 3300009496 | Pelagic Marine | MIDKFFYIFFGAVDEAMGYLFDRFISDAPKKKKKK* |
| Ga0115569_101117234 | 3300009497 | Pelagic Marine | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPKLKKKKKKK* |
| Ga0115568_103384752 | 3300009498 | Pelagic Marine | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPRLKKKKKK* |
| Ga0115572_101448484 | 3300009507 | Pelagic Marine | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPRLKKKKKR* |
| Ga0115567_100320486 | 3300009508 | Pelagic Marine | MIDNIIYKVFGMVDNFMGYLFDRFVSDDPKLKKKKKKK* |
| Ga0114919_100694793 | 3300009529 | Deep Subsurface | MIDSIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKKK* |
| Ga0115001_104472992 | 3300009785 | Marine | MIDRLFYRFFGMIDNCMGYLFDKFISDAPKKKKK* |
| Ga0115012_120228402 | 3300009790 | Marine | MIDNIIYRVFGIIDNFMGYLFDRFVSDNPKLKKNKKK* |
| Ga0098043_10359103 | 3300010148 | Marine | MIDNIIYRVFGIVDNFMGYLFDRFISDDPRLKKKKRKK* |
| Ga0098049_11375673 | 3300010149 | Marine | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPRLKKKKRKK* |
| Ga0098059_102283110 | 3300010153 | Marine | MIDNMFYKFFGIVDNFMGYLFDRFVSDDPRLKKKKRKK* |
| Ga0129351_10780021 | 3300010300 | Freshwater To Marine Saline Gradient | MIDNIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKK*LKILKI |
| Ga0129351_13042931 | 3300010300 | Freshwater To Marine Saline Gradient | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKRNK* |
| Ga0118733_1009248936 | 3300010430 | Marine Sediment | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPKLKKKKKK* |
| Ga0151672_1080561 | 3300011129 | Marine | MIDNLFYRLFGMVDNFIGYLFDKFISDAPKKKKK* |
| Ga0151674_10243352 | 3300011252 | Marine | MAKRVQSMIDNIIYRVFGMIDNFMGYLFDKFVSDDPRLKKKKKK* |
| Ga0151668_10336373 | 3300011262 | Marine | MIDNIIYKVFGMVDNFMGYLFDRFISDDPRLKKKKKR* |
| Ga0180120_100409683 | 3300017697 | Freshwater To Marine Saline Gradient | LIDKFFYIFFGAVDDAMGYLFDRFISDAPKKKKKK |
| Ga0181369_10065602 | 3300017708 | Marine | MIDNIIYRLFGMIDNFFGYLFDKFISDDPRLKKKKRKK |
| Ga0181387_10566361 | 3300017709 | Seawater | NIIYRVFGIVDNFMGYLFDRFISDDPRLKKKKKKK |
| Ga0181391_10109519 | 3300017713 | Seawater | MIDNIIYKLFGMVDNFMGYLFDRFISDAPKKKKKK |
| Ga0181391_10137356 | 3300017713 | Seawater | MIDNIIYKVFGIVDNFMGYLFDRFVSDAPKKKKKK |
| Ga0181390_11756963 | 3300017719 | Seawater | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKK |
| Ga0181373_10105301 | 3300017721 | Marine | MIDNMIYRLFGMVDNFMGYLFDRFVSDDPRLKKKKRKK |
| Ga0181381_11016203 | 3300017726 | Seawater | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKKKKXEILKF |
| Ga0181401_10245641 | 3300017727 | Seawater | MIDNIIYRVFGIVDNFMGYLFDRFISDDPKKNKIKNV |
| Ga0181401_11486283 | 3300017727 | Seawater | MIDNIIYRVFGMVDNFIGYLFDRFVSDDPRLKKKKKKK |
| Ga0181419_10832544 | 3300017728 | Seawater | DNIIYRVFGIVDNFMGYMYDRFISDDLRLKKKKRKK |
| Ga0181419_11110862 | 3300017728 | Seawater | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPKLKNKKKKXEIIKF |
| Ga0181415_10953562 | 3300017732 | Seawater | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPKLKKKKKKXEIIKF |
| Ga0181426_10028484 | 3300017733 | Seawater | MIDNIIYRDFGMVDNFMGYLFDRFVSDDPKLKKKKKK |
| Ga0181433_10325514 | 3300017739 | Seawater | MIDNIIYRVFGMVDNFMGYLFDRFISDDPRLKKKKRKKXEI |
| Ga0181433_10582115 | 3300017739 | Seawater | MIDNIIYRVFGIVDNFMGYLFDRFISDDPKLKKKKKKK |
| Ga0181389_11304073 | 3300017746 | Seawater | MAKRIQGMIDNIIYKVFGMVDNFMGYLFDRFVSDAPKKKKKKXEIL |
| Ga0181407_10139936 | 3300017753 | Seawater | MIDNIIYRLFGMIDRFFGYLFDKFISDDPRFKKKKRKK |
| Ga0181407_11235092 | 3300017753 | Seawater | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPRLKKKKKNK |
| Ga0187217_11290671 | 3300017770 | Seawater | DNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKKKKXEILKF |
| Ga0181430_10681441 | 3300017772 | Seawater | MIDNIIYRLFGMVDNFMDYLFDRFVSDAPKKKKKK |
| Ga0181386_11519574 | 3300017773 | Seawater | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPRLKKKKK |
| Ga0181394_10361746 | 3300017776 | Seawater | MMDNFFYKLFGIVDNFMGYLFDRFVLDAPKKKKKR |
| Ga0181395_10355552 | 3300017779 | Seawater | MMDNFFYKLFGIVDNFMGYLFDRFVSDAPKKKKKR |
| Ga0181395_11499372 | 3300017779 | Seawater | MAKRIQSMIDNIIYKVFGIVDNFMGYLFDRFVSDAPKKKKKK |
| Ga0181395_12498692 | 3300017779 | Seawater | MIDNIIYRVFGMVDNFMGYLFDRFISDDPRLKKKKKKK |
| Ga0181423_10394848 | 3300017781 | Seawater | IQSMIDNIIYRVFGMVDNFMGYLFDRFISDDPRFKKKKRKK |
| Ga0181552_100064028 | 3300017824 | Salt Marsh | MIDSIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKKKXEIPKY |
| Ga0181552_105650353 | 3300017824 | Salt Marsh | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPKLKKKKKKXLKTLKIL |
| Ga0181607_100328903 | 3300017950 | Salt Marsh | MIDSIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKKK |
| Ga0181590_110133973 | 3300017967 | Salt Marsh | MIDNIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKK |
| Ga0181600_100297182 | 3300018036 | Salt Marsh | MIDSIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKK |
| Ga0181567_106792522 | 3300018418 | Salt Marsh | MIDNIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKKK |
| Ga0194015_10163851 | 3300019701 | Sediment | IMIDSIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKK |
| Ga0194021_10130114 | 3300019703 | Sediment | MAKRVQSMIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKKK |
| Ga0193989_10421012 | 3300019707 | Sediment | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKKK |
| Ga0193975_10288291 | 3300019714 | Sediment | MIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKKKXLKTLKIL |
| Ga0194014_10670432 | 3300019732 | Sediment | MIDQFFYRLFGMIDNCMGYLFDRFISDVPKKKKKK |
| Ga0193965_10612792 | 3300019742 | Freshwater Microbial Mat | MIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKKK |
| Ga0193978_10177404 | 3300019747 | Sediment | DNIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKK |
| Ga0194029_10603213 | 3300019751 | Freshwater | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKKKXL |
| Ga0194029_10694392 | 3300019751 | Freshwater | MIDKLFYKFFGMVDNFMSYLFDKFISDDPRLKKKKKK |
| Ga0194024_11639992 | 3300019765 | Freshwater | MIDNIIYKVFGMVDNFMGYLFDRFVSDAPKKKKKK |
| Ga0194032_10150323 | 3300019938 | Freshwater | MIDNIIYRLFGVIDNFFGYLFDKFISDDPSLKKRKKKK |
| Ga0206125_102580243 | 3300020165 | Seawater | MIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKKK |
| Ga0211504_10132018 | 3300020347 | Marine | MIDQFFYRLFGMIDNCMGYLFDRFISDAPKKKKKK |
| Ga0211678_100693064 | 3300020388 | Marine | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKRKK |
| Ga0211678_101945811 | 3300020388 | Marine | MIDNIIYRLFGVIDNFFGYLFDKFISDDPSLKKRKKKKXEILKY |
| Ga0211576_1002237211 | 3300020438 | Marine | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPRLKKKKKKK |
| Ga0213867_10879652 | 3300021335 | Seawater | MIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKRNK |
| Ga0213862_100064701 | 3300021347 | Seawater | MIDNIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKKXLKILKIL |
| Ga0213862_100404412 | 3300021347 | Seawater | MIDNMIYRLFGMVDNFMGYLFDRFVSDDPRLKKKKKK |
| Ga0213860_1000254110 | 3300021368 | Seawater | MIDKFFYKLFGMVDNFMSYLFDRFISDDPKLKKKKKK |
| Ga0213863_103620452 | 3300021371 | Seawater | MAKRIQGMIDNIIYKVFGMVDNFMGYLFDRFVSDAPKKKKKK |
| Ga0213869_102808421 | 3300021375 | Seawater | MIDQFFYKLFGMIDNCMGYLFDRFISDVPKKKKKK |
| Ga0213861_100262466 | 3300021378 | Seawater | MIDSIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKKKXEILKY |
| Ga0213861_103266884 | 3300021378 | Seawater | MAKRVQSMIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKKKXLK |
| Ga0213861_104800252 | 3300021378 | Seawater | MIDNIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKRKKXEIPKY |
| Ga0222717_103949482 | 3300021957 | Estuarine Water | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPRLKKKKRNK |
| Ga0222717_105557871 | 3300021957 | Estuarine Water | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKR |
| Ga0222718_105310633 | 3300021958 | Estuarine Water | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPKLKKKKRNK |
| Ga0222716_101786853 | 3300021959 | Estuarine Water | MIDNLFYRFFGMIDNCMGYLFDKFVSDAPKKKKKK |
| Ga0222719_104966291 | 3300021964 | Estuarine Water | MIDNIIYRFFGMVDNFMGYLFDRFVSDDPRLKKKKRNK |
| Ga0222719_105005271 | 3300021964 | Estuarine Water | MAKRVQSMIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKRNK |
| Ga0212030_10091721 | 3300022053 | Aqueous | MIDSIIYRLFGMIDRFFGYLFDKFISDNPRLKKKKKK |
| Ga0212025_10970551 | 3300022057 | Aqueous | MIDNIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKKXLN |
| Ga0212023_10411601 | 3300022061 | Aqueous | MIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKRND |
| Ga0212029_10340302 | 3300022063 | Aqueous | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPKLKKKKKK |
| Ga0224906_10880653 | 3300022074 | Seawater | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKKKK |
| Ga0224906_11246391 | 3300022074 | Seawater | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPKLKNKKKK |
| Ga0224906_11804593 | 3300022074 | Seawater | MIDNIIYRLFGIIDNFFGYLFDKFISDDPSLKKRKKKKXEILKY |
| Ga0196891_10504852 | 3300022183 | Aqueous | MAKGVQSMIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKKK |
| Ga0196901_10256732 | 3300022200 | Aqueous | MAKRVQSMIDNIIYRVFGIVDNFMGYLFDRFVSDDPKLKKKKKK |
| Ga0224504_102941803 | 3300022308 | Sediment | MAKRIQGMIDNIIYRLFGMVDNFMGYLFDRFVSDAPKKKKKK |
| (restricted) Ga0233432_101855703 | 3300023109 | Seawater | MIDKLIYKVFGIVDNFMSYLFDKFISDDPRLKKKKRNK |
| Ga0255761_103491111 | 3300023170 | Salt Marsh | MIDNIIYRLFGMIDRFFGYLFDKFISDDPRLKKKK |
| Ga0228653_10206163 | 3300024237 | Seawater | MIDNIIYRLFGIIDNFFGYLFDKFISDDPSLKKRKKKK |
| Ga0209986_100965251 | 3300024433 | Deep Subsurface | MIDSIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKRKKXEI |
| Ga0208667_10036786 | 3300025070 | Marine | MIDNIIYRVFGMVDNFMGYLFDRFISDDPRLKKKKRKK |
| Ga0208667_10164982 | 3300025070 | Marine | MIDKLIYKVFGIVDNFMSYLFDRFISDAPKKKKKK |
| Ga0208667_10613872 | 3300025070 | Marine | MIDNMFYKFFGMVDNFMGYLFDRFVSDDPRLKKKKRKK |
| Ga0208667_10720582 | 3300025070 | Marine | MIDNIIYRLFGVIDNFFGYLFDKFISDDPNLKKRKKKKXEILKY |
| Ga0208791_10155733 | 3300025083 | Marine | MIDNIIYRLFGVIDNFFGYLFDKFISDDPNLKKRKKKK |
| Ga0208298_10228094 | 3300025084 | Marine | MIDNMFYKFFGIVDNFMGYLFDRFVSDDPRLKKKKRKK |
| Ga0208669_10134289 | 3300025099 | Marine | MIDNMFYKFFGMVDNFMGYLFDRFVSDDHRLKKKKRKK |
| Ga0208793_10959883 | 3300025108 | Marine | RRNNINEISHTMIDNIIYKLFGIVDNFMGYLFDRFVSDDPRLKKKKKK |
| Ga0209348_10211157 | 3300025127 | Marine | MIDNIIYRLFGIIDNFFGYLFDKFISDDPRLKKKKKK |
| Ga0208148_10849123 | 3300025508 | Aqueous | MAKRIQGMIDNIIYKVFGMVDDFMGYLFDRFVSDAPKKKKKKXEILKF |
| Ga0208303_10564682 | 3300025543 | Aqueous | MAKRVQSMIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKKK |
| Ga0209304_11273192 | 3300025577 | Pelagic Marine | MAKRVQSMIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKKR |
| Ga0209195_10622173 | 3300025590 | Pelagic Marine | MIDNIIYKVFGMVDDFMGYLFDRFVSDAPKKKKKK |
| Ga0209405_11867363 | 3300025620 | Pelagic Marine | MIDKFFYIFFGAVDDAMGYLFDRFISDAPKKKKKK |
| Ga0209194_10146963 | 3300025632 | Pelagic Marine | MIDNIIYKVFGMVDNFMGYLFDRFISDAPKKKKKK |
| Ga0209194_10614954 | 3300025632 | Pelagic Marine | MIDNIIYRVFGIVDNFMGYLFDRFISDDPRLKKKKKKK |
| Ga0208643_11778652 | 3300025645 | Aqueous | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKKKXLKT |
| Ga0208795_10632324 | 3300025655 | Aqueous | MIDNIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKKKXLKI |
| Ga0208898_10482384 | 3300025671 | Aqueous | MIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKKNK |
| Ga0209306_11379014 | 3300025680 | Pelagic Marine | MDKFVYKFFGMVDNFMGYLFDRFVSDDPRLKKKKKK |
| Ga0208019_10260282 | 3300025687 | Aqueous | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPRLKKKKRNK |
| Ga0209715_11624843 | 3300025699 | Pelagic Marine | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPKLKKKKKKKXEILKF |
| Ga0208767_11068704 | 3300025769 | Aqueous | MIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKKKXLKILKILXFY |
| Ga0209193_10772742 | 3300025816 | Pelagic Marine | MIDNIIYRVFGIVDNFMGYLFDRFISDDPRLKKKKKK |
| Ga0209193_10844063 | 3300025816 | Pelagic Marine | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPKLKKKKKKK |
| Ga0209714_10666143 | 3300025822 | Pelagic Marine | MIDNIIYRVFGIVDNFMGYLFDRFVSDDPKLKKKKKKKXEILKF |
| Ga0209832_10609824 | 3300025830 | Pelagic Marine | MAKRVQSMIDNIIYKVFGMVDNFMGYLFDRFISDAPKKKKKK |
| Ga0209603_10557823 | 3300025849 | Pelagic Marine | MIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKKR |
| Ga0209603_12067202 | 3300025849 | Pelagic Marine | MAKRVQSMIDNIIYRVFGMVDNFMGYLFDRFVSDDPRLKKKKKK |
| Ga0208645_10959774 | 3300025853 | Aqueous | MIDNIIYRVFGIVDNFMGYLFDRFVSNDPKLKKKKKK |
| Ga0208645_11684393 | 3300025853 | Aqueous | MIDKLIYKMFGMVDNFMGYLFDRFVSDAPKKKEKKXEILKF |
| Ga0209666_10720334 | 3300025870 | Marine | MIDNFIYKIFGIVDNFMGYLFDKFVSDDPKLKKKKKK |
| Ga0209533_10074991 | 3300025874 | Pelagic Marine | MIDQFFYRLFGFIDDAMGYLFDRFISDAPKKKKKK |
| Ga0209223_100259617 | 3300025876 | Pelagic Marine | MAKRVQSMIDNIIYRVFGMVDNFMGYLFDRFVSDDPKFKKKKKR |
| Ga0209631_102558601 | 3300025890 | Pelagic Marine | MAKRVQSMIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKK |
| Ga0209425_101461041 | 3300025897 | Pelagic Marine | QSMAKRVQSMIDNIIYKVFGMVDNFMGYLFDRFISDAPKKKKKK |
| Ga0209962_10201514 | 3300026125 | Water | MIDNIIYRVFGMVDNFMGYLFDRFVSDDPRLKKKKRKK |
| Ga0209962_10203603 | 3300026125 | Water | MIDNIIYRLFGIIDRFFGYLFDKFISDDPRLKKKKRKK |
| Ga0209951_10016774 | 3300026138 | Pond Water | MIDNIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKRKK |
| Ga0209951_10458164 | 3300026138 | Pond Water | NIIYRVFGMVDNFMGYLFDRFVSDDPRLKKKKRKK |
| Ga0209932_10459832 | 3300026183 | Pond Water | MIDNIIYRLFGMMDRFFGYLFDKFISDDPRLKKKKKKK |
| Ga0209929_11410492 | 3300026187 | Pond Water | MIDNIIYRVFGIIDNFMGYLFDRFVSDNPRLKKKKKKK |
| Ga0209929_11735171 | 3300026187 | Pond Water | MAKRVQSMIDNIIYKVFGMVDNFMGYLFDRFVSDDPRLKKKKRKK |
| Ga0208941_10457072 | 3300027077 | Marine | MIDNIIYRLFGIIDNFFGYLFDKFISDDPSLKKKKKKK |
| Ga0209710_10346553 | 3300027687 | Marine | MIDKIFYTLFGSIDNAMGYLFDRFISDAPKKKKKK |
| (restricted) Ga0255041_103021422 | 3300027837 | Seawater | MIDNIIYRLFGMIDRFFGYLFDKFISDDPRLKKKKRNK |
| Ga0265306_102645953 | 3300028598 | Sediment | MIDNIISKVFGMVDNFMGYLFDRFVSDDPKLKKKKKK |
| Ga0185543_100067610 | 3300029318 | Marine | MIDNIIYRFFGMIDNFFGYLFDKFISDDPKLKKKKKK |
| Ga0183755_10130692 | 3300029448 | Marine | MIDNIIYRVFGLVDNFMGYLFDRFVSDDPKLKKKKKK |
| Ga0183755_10168463 | 3300029448 | Marine | MIDQFFYKLFGFVDDAMGYLFDRFISDAPKKKKKK |
| Ga0183755_10661022 | 3300029448 | Marine | MIDKFFYRLFEIVDNFMGYVFDRFISDAPKKKKKK |
| Ga0315322_109414243 | 3300031766 | Seawater | TMIDQFFYKLFGIVDNFMGYLFDRFISDAPKKKKKK |
| Ga0315331_107224853 | 3300031774 | Seawater | MIDKLFYKFFGMVDNFMGYIFDKFISDDPRLKKKKKKXEILKF |
| Ga0315320_1000596816 | 3300031851 | Seawater | MIDQFFYKLFGIVDNFMGYLFDRFISDAPKKKKKK |
| Ga0315320_100145288 | 3300031851 | Seawater | MIDNMIYRLFGMVDNFMGYLFDRFVSDAPKKKKKK |
| Ga0315320_100470984 | 3300031851 | Seawater | MIDNIIYRLFGMVDNFMGYLFDRFVSDAPKKKKKK |
| Ga0315320_106677082 | 3300031851 | Seawater | MIDKLIYKVFGIVDNFMSYLFDRFVSDAPKKKNKK |
| Ga0315330_101990975 | 3300032047 | Seawater | MIDKLFYKFFGMVDNFMGYLFDKFISDDPRLKKKKKK |
| Ga0316208_10281275 | 3300032254 | Microbial Mat | MAKRVQSMIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKRNK |
| Ga0348335_067533_1_108 | 3300034374 | Aqueous | MIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKR |
| Ga0348336_191157_30_167 | 3300034375 | Aqueous | MEKRVQSMIDNIIYKVFGIVDNFMGYLFDRFVSDDPRLKKKKKNK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |