Basic Information | |
---|---|
Family ID | F016608 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 246 |
Average Sequence Length | 42 residues |
Representative Sequence | RAFLQENNVPYLVKPFEVADLISQARRLLQKAHAASAS |
Number of Associated Samples | 203 |
Number of Associated Scaffolds | 246 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 96.34 % |
% of genes from short scaffolds (< 2000 bps) | 82.11 % |
Associated GOLD sequencing projects | 191 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.959 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.195 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.358 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.967 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.42% β-sheet: 0.00% Coil/Unstructured: 57.58% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 246 Family Scaffolds |
---|---|---|
PF12840 | HTH_20 | 30.89 |
PF02811 | PHP | 12.60 |
PF05036 | SPOR | 8.54 |
PF00174 | Oxidored_molyb | 6.91 |
PF07733 | DNA_pol3_alpha | 2.44 |
PF01145 | Band_7 | 2.03 |
PF01957 | NfeD | 1.63 |
PF00082 | Peptidase_S8 | 0.81 |
PF01022 | HTH_5 | 0.81 |
PF13313 | DUF4082 | 0.81 |
PF14579 | HHH_6 | 0.81 |
PF01494 | FAD_binding_3 | 0.81 |
PF09411 | PagL | 0.41 |
PF07730 | HisKA_3 | 0.41 |
PF13531 | SBP_bac_11 | 0.41 |
PF02518 | HATPase_c | 0.41 |
PF03255 | ACCA | 0.41 |
PF12804 | NTP_transf_3 | 0.41 |
PF00144 | Beta-lactamase | 0.41 |
PF01554 | MatE | 0.41 |
PF07700 | HNOB | 0.41 |
PF01566 | Nramp | 0.41 |
PF14559 | TPR_19 | 0.41 |
PF11154 | DUF2934 | 0.41 |
PF00486 | Trans_reg_C | 0.41 |
PF07992 | Pyr_redox_2 | 0.41 |
PF05362 | Lon_C | 0.41 |
PF09278 | MerR-DNA-bind | 0.41 |
PF08281 | Sigma70_r4_2 | 0.41 |
PF13426 | PAS_9 | 0.41 |
PF13432 | TPR_16 | 0.41 |
PF00092 | VWA | 0.41 |
COG ID | Name | Functional Category | % Frequency in 246 Family Scaffolds |
---|---|---|---|
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 6.91 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 6.91 |
COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 2.44 |
COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 2.44 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.63 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.81 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.81 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.81 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.41 |
COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.41 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.41 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.41 |
COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.41 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.41 |
COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.41 |
COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.41 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.41 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.41 |
COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.41 |
COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.41 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.96 % |
Unclassified | root | N/A | 15.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_101468590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1775 | Open in IMG/M |
3300001471|JGI12712J15308_10171297 | Not Available | 565 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100599997 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100890220 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101504832 | Not Available | 568 | Open in IMG/M |
3300004092|Ga0062389_100525634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1335 | Open in IMG/M |
3300004157|Ga0062590_101609237 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300004633|Ga0066395_10924724 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300004635|Ga0062388_102586429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300005331|Ga0070670_100973583 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300005339|Ga0070660_100077794 | All Organisms → cellular organisms → Bacteria | 2600 | Open in IMG/M |
3300005435|Ga0070714_100597662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
3300005436|Ga0070713_101761839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300005445|Ga0070708_100521907 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
3300005450|Ga0066682_10714148 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300005454|Ga0066687_10387206 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300005541|Ga0070733_10480634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 830 | Open in IMG/M |
3300005542|Ga0070732_10551765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 699 | Open in IMG/M |
3300005547|Ga0070693_100453449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 900 | Open in IMG/M |
3300005554|Ga0066661_10538767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
3300005555|Ga0066692_10181766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1307 | Open in IMG/M |
3300005560|Ga0066670_10753415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
3300005576|Ga0066708_10238809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1152 | Open in IMG/M |
3300005602|Ga0070762_10095731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1710 | Open in IMG/M |
3300005614|Ga0068856_101204298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
3300005764|Ga0066903_103417553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 857 | Open in IMG/M |
3300005842|Ga0068858_100275955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1600 | Open in IMG/M |
3300005921|Ga0070766_11040338 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300006028|Ga0070717_10100536 | All Organisms → cellular organisms → Bacteria | 2455 | Open in IMG/M |
3300006028|Ga0070717_10767421 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300006028|Ga0070717_11931755 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300006052|Ga0075029_101205963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300006086|Ga0075019_10052683 | All Organisms → cellular organisms → Bacteria | 2298 | Open in IMG/M |
3300006102|Ga0075015_100824962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300006174|Ga0075014_100853044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → unclassified Caulobacter → Caulobacter sp. 17J65-9 | 542 | Open in IMG/M |
3300006176|Ga0070765_100526065 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300006800|Ga0066660_11606605 | Not Available | 515 | Open in IMG/M |
3300006893|Ga0073928_10632831 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300006904|Ga0075424_100628404 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300007982|Ga0102924_1211091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
3300009089|Ga0099828_11139534 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300009090|Ga0099827_10809340 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300009522|Ga0116218_1070332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1593 | Open in IMG/M |
3300009641|Ga0116120_1088967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
3300009644|Ga0116121_1009292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3263 | Open in IMG/M |
3300009700|Ga0116217_10231158 | Not Available | 1206 | Open in IMG/M |
3300009792|Ga0126374_11740580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300009824|Ga0116219_10203050 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300010048|Ga0126373_10354968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1479 | Open in IMG/M |
3300010048|Ga0126373_11866666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 664 | Open in IMG/M |
3300010320|Ga0134109_10038684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1545 | Open in IMG/M |
3300010329|Ga0134111_10010679 | All Organisms → cellular organisms → Bacteria | 2934 | Open in IMG/M |
3300010339|Ga0074046_10526542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
3300010361|Ga0126378_10232079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1933 | Open in IMG/M |
3300010366|Ga0126379_11579431 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300010371|Ga0134125_10123517 | All Organisms → cellular organisms → Bacteria | 2882 | Open in IMG/M |
3300010371|Ga0134125_12253487 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300010379|Ga0136449_100938419 | Not Available | 1403 | Open in IMG/M |
3300010379|Ga0136449_103710177 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300010876|Ga0126361_10885232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
3300011072|Ga0138563_1022279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 783 | Open in IMG/M |
3300011269|Ga0137392_10122785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2073 | Open in IMG/M |
3300012125|Ga0154006_1046098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300012203|Ga0137399_11456927 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300012211|Ga0137377_11091364 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300012351|Ga0137386_10637964 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300012356|Ga0137371_11359289 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300012361|Ga0137360_10211207 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
3300012683|Ga0137398_10464773 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300012918|Ga0137396_11215117 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300012922|Ga0137394_10219390 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
3300012923|Ga0137359_11669389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300012925|Ga0137419_10348229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1145 | Open in IMG/M |
3300012927|Ga0137416_11255649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
3300012927|Ga0137416_11509982 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300012927|Ga0137416_12223218 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300012930|Ga0137407_10612694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1022 | Open in IMG/M |
3300012930|Ga0137407_11236830 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300012937|Ga0162653_100086717 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300012957|Ga0164303_11286139 | Not Available | 540 | Open in IMG/M |
3300012971|Ga0126369_10173598 | Not Available | 2052 | Open in IMG/M |
3300012971|Ga0126369_10336507 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
3300012988|Ga0164306_11961680 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300012989|Ga0164305_11838510 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300013100|Ga0157373_10627303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
3300014169|Ga0181531_10052738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2378 | Open in IMG/M |
3300014489|Ga0182018_10272702 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300014495|Ga0182015_10045407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3250 | Open in IMG/M |
3300014501|Ga0182024_12716702 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300014969|Ga0157376_10118812 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
3300014969|Ga0157376_10295344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1532 | Open in IMG/M |
3300015242|Ga0137412_10350509 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300015242|Ga0137412_10961556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300015372|Ga0132256_100082167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3087 | Open in IMG/M |
3300015374|Ga0132255_104311308 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300017823|Ga0187818_10528530 | Not Available | 531 | Open in IMG/M |
3300017924|Ga0187820_1223484 | Not Available | 595 | Open in IMG/M |
3300017943|Ga0187819_10322066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 896 | Open in IMG/M |
3300017943|Ga0187819_10654237 | Not Available | 594 | Open in IMG/M |
3300017947|Ga0187785_10007512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3644 | Open in IMG/M |
3300017948|Ga0187847_10107556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1535 | Open in IMG/M |
3300017959|Ga0187779_10741951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300017994|Ga0187822_10298315 | Not Available | 568 | Open in IMG/M |
3300018006|Ga0187804_10033576 | Not Available | 1943 | Open in IMG/M |
3300018006|Ga0187804_10172851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
3300018012|Ga0187810_10209836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
3300018019|Ga0187874_10312699 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300018032|Ga0187788_10203871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
3300018034|Ga0187863_10012783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5350 | Open in IMG/M |
3300018034|Ga0187863_10022823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3793 | Open in IMG/M |
3300018034|Ga0187863_10333335 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300018035|Ga0187875_10036557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2914 | Open in IMG/M |
3300018058|Ga0187766_10319066 | Not Available | 1010 | Open in IMG/M |
3300018062|Ga0187784_10308885 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300018085|Ga0187772_10868743 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300018085|Ga0187772_11195509 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300018085|Ga0187772_11449697 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300018086|Ga0187769_10480157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 937 | Open in IMG/M |
3300018086|Ga0187769_11275246 | Not Available | 556 | Open in IMG/M |
3300018090|Ga0187770_10968802 | Not Available | 684 | Open in IMG/M |
3300018468|Ga0066662_10552983 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300019786|Ga0182025_1133755 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300019888|Ga0193751_1098314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300020579|Ga0210407_10793976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
3300020580|Ga0210403_10430152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1076 | Open in IMG/M |
3300020581|Ga0210399_10523317 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300020583|Ga0210401_11167690 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300021088|Ga0210404_10446685 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300021170|Ga0210400_11191852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300021171|Ga0210405_11004200 | Not Available | 629 | Open in IMG/M |
3300021178|Ga0210408_10792044 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300021178|Ga0210408_11397769 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300021181|Ga0210388_10663721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
3300021181|Ga0210388_10999700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
3300021401|Ga0210393_10127629 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
3300021401|Ga0210393_11529862 | Not Available | 530 | Open in IMG/M |
3300021403|Ga0210397_10735940 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300021406|Ga0210386_10456990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1103 | Open in IMG/M |
3300021420|Ga0210394_11604596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300021432|Ga0210384_10316861 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
3300021432|Ga0210384_10323673 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
3300021433|Ga0210391_11297152 | Not Available | 562 | Open in IMG/M |
3300021475|Ga0210392_11466433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300021476|Ga0187846_10387455 | Not Available | 575 | Open in IMG/M |
3300021478|Ga0210402_10314137 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
3300021479|Ga0210410_10878053 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300022733|Ga0224562_1011133 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300024179|Ga0247695_1049094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300025907|Ga0207645_10044003 | All Organisms → cellular organisms → Bacteria | 2858 | Open in IMG/M |
3300025910|Ga0207684_10057014 | All Organisms → cellular organisms → Bacteria | 3314 | Open in IMG/M |
3300025914|Ga0207671_10796042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Fastidiosipila → Fastidiosipila sanguinis | 750 | Open in IMG/M |
3300025916|Ga0207663_10077325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 2166 | Open in IMG/M |
3300025925|Ga0207650_10215840 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
3300025928|Ga0207700_10182977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1756 | Open in IMG/M |
3300025934|Ga0207686_10489221 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300025939|Ga0207665_10093197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 2091 | Open in IMG/M |
3300025961|Ga0207712_11825667 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300026035|Ga0207703_10241582 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
3300026307|Ga0209469_1074241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1028 | Open in IMG/M |
3300026318|Ga0209471_1056946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1790 | Open in IMG/M |
3300026333|Ga0209158_1055371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1606 | Open in IMG/M |
3300026334|Ga0209377_1067766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1544 | Open in IMG/M |
3300026538|Ga0209056_10359205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 947 | Open in IMG/M |
3300027073|Ga0208366_1036210 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300027076|Ga0208860_1030320 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300027110|Ga0208488_1041773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
3300027376|Ga0209004_1061302 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300027629|Ga0209422_1057442 | Not Available | 928 | Open in IMG/M |
3300027729|Ga0209248_10065419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1108 | Open in IMG/M |
3300027825|Ga0209039_10298154 | Not Available | 635 | Open in IMG/M |
3300027842|Ga0209580_10384828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 699 | Open in IMG/M |
3300027846|Ga0209180_10617520 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300027853|Ga0209274_10053550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1919 | Open in IMG/M |
3300027862|Ga0209701_10375921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 798 | Open in IMG/M |
3300027867|Ga0209167_10075106 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
3300027898|Ga0209067_10044522 | Not Available | 2261 | Open in IMG/M |
3300027908|Ga0209006_10331197 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
3300027908|Ga0209006_11345219 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300027911|Ga0209698_10881918 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300028023|Ga0265357_1020352 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300028379|Ga0268266_11301863 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300028776|Ga0302303_10292713 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300028780|Ga0302225_10529627 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300028906|Ga0308309_11236159 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300028906|Ga0308309_11666280 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300029636|Ga0222749_10224512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 947 | Open in IMG/M |
3300029939|Ga0311328_10558850 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300029952|Ga0311346_10772412 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300029984|Ga0311332_10567977 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300030045|Ga0302282_1222747 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300030057|Ga0302176_10210982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
3300030518|Ga0302275_10371002 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300030737|Ga0302310_10581444 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300031090|Ga0265760_10284761 | Not Available | 582 | Open in IMG/M |
3300031231|Ga0170824_127792988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 609 | Open in IMG/M |
3300031234|Ga0302325_11422822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 900 | Open in IMG/M |
3300031236|Ga0302324_100162331 | All Organisms → cellular organisms → Bacteria | 3639 | Open in IMG/M |
3300031525|Ga0302326_11473828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 914 | Open in IMG/M |
3300031525|Ga0302326_11501982 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300031525|Ga0302326_11700385 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300031573|Ga0310915_11239625 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300031711|Ga0265314_10525783 | Not Available | 619 | Open in IMG/M |
3300031715|Ga0307476_10014846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4949 | Open in IMG/M |
3300031715|Ga0307476_10842405 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300031715|Ga0307476_11227596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300031718|Ga0307474_11105236 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300031718|Ga0307474_11253839 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300031740|Ga0307468_100900076 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300031796|Ga0318576_10247252 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300031879|Ga0306919_10818686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
3300031912|Ga0306921_10883549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
3300031941|Ga0310912_10006418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7168 | Open in IMG/M |
3300031941|Ga0310912_10086693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2283 | Open in IMG/M |
3300031947|Ga0310909_10901116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 726 | Open in IMG/M |
3300032076|Ga0306924_12560090 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300032174|Ga0307470_10227656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1214 | Open in IMG/M |
3300032180|Ga0307471_101110995 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300032180|Ga0307471_103596923 | Not Available | 548 | Open in IMG/M |
3300032180|Ga0307471_103600701 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300032515|Ga0348332_13014124 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
3300032805|Ga0335078_10099081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4211 | Open in IMG/M |
3300032805|Ga0335078_10312807 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
3300032828|Ga0335080_10700760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1055 | Open in IMG/M |
3300032892|Ga0335081_10171744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3056 | Open in IMG/M |
3300032892|Ga0335081_10855173 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300032893|Ga0335069_10074206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4366 | Open in IMG/M |
3300032893|Ga0335069_10105668 | All Organisms → cellular organisms → Bacteria | 3550 | Open in IMG/M |
3300032893|Ga0335069_10829149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1039 | Open in IMG/M |
3300032893|Ga0335069_12068897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 598 | Open in IMG/M |
3300032897|Ga0335071_10037955 | All Organisms → cellular organisms → Bacteria | 4771 | Open in IMG/M |
3300032954|Ga0335083_10019824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7795 | Open in IMG/M |
3300032954|Ga0335083_10616923 | Not Available | 891 | Open in IMG/M |
3300033134|Ga0335073_11075780 | Not Available | 822 | Open in IMG/M |
3300033158|Ga0335077_10091430 | Not Available | 3590 | Open in IMG/M |
3300033808|Ga0314867_142931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella paludicola | 560 | Open in IMG/M |
3300033888|Ga0334792_115755 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300033983|Ga0371488_0068885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2080 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.20% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.28% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.28% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.47% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.47% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.88% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.66% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.44% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.44% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.44% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.22% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.22% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.22% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.63% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.63% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.41% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.41% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.41% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.41% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.41% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.41% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.41% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.41% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.41% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.41% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.41% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.41% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.41% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.41% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.41% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.41% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.41% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.41% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.41% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.81% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.81% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011072 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012125 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL090 MetaG | Host-Associated | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027425 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2-10 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1014685901 | 3300000364 | Soil | AYLQQHQLSSLVKPFEIADLISQARRLLQKAHAAAAAAQ* |
JGI12712J15308_101712972 | 3300001471 | Forest Soil | SNGVEPGAGRRFLQENNVPFLVKPFEVAELIAQARHLLQLAQAAAAGAS* |
JGI12627J18819_100605014 | 3300001867 | Forest Soil | VTFSSLADQEARKFLQENNVPLLVKPFEVGDLINHARRLLQKVEAASAS* |
JGIcombinedJ26739_1005999974 | 3300002245 | Forest Soil | SNVEQNDERAFLQENKIPFLVKPFEVADLISQARRLLQTAQAAAASAS* |
JGIcombinedJ26739_1008902201 | 3300002245 | Forest Soil | FLNNHNVPYLVKPFEVGDLIAHARRLLQKTLAATAG* |
JGIcombinedJ26739_1015048321 | 3300002245 | Forest Soil | DPGDGRAFLRENNVASLVKPFEVAELIAQARRLLHQTQAVGAGAS* |
Ga0062389_1005256342 | 3300004092 | Bog Forest Soil | IRNFLQEKNVPYLVKPFEVADLISHARRLLQKVQAAAAS* |
Ga0062590_1016092372 | 3300004157 | Soil | SDGRAFVQENNVPYLVRPFEVAELISQARKLLQKALAAEAGGD* |
Ga0066395_109247242 | 3300004633 | Tropical Forest Soil | GRTFLQENGIPYLVKPFEVAELISQARKLLQKAQAAAGGAD* |
Ga0062388_1025864292 | 3300004635 | Bog Forest Soil | FSNSVEQGDDRAFLQENNIPYLVKPFEVAELISQARKLLPKAQAAAAGLS* |
Ga0070670_1009735831 | 3300005331 | Switchgrass Rhizosphere | EIRDFLHHNNIPYLVKPFEVGDLISQARRLLQKTQSAVAG* |
Ga0070660_1000777943 | 3300005339 | Corn Rhizosphere | LEPEIRDFLHHNNIPYLVKPFEVGDLISQARRLLQKTQSAVAG* |
Ga0070661_1013790531 | 3300005344 | Corn Rhizosphere | FSSALEPEIRDFLHHHNVPYLVKPFEVGDLISQARRLLQKTQSAVAS* |
Ga0070714_1005976622 | 3300005435 | Agricultural Soil | FSAGVEPSDGRAFVQENNVPYLVRPFEVAELISQARKLLQKALAAGAGGN* |
Ga0070713_1017618391 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EQDIRNYLQANGIASLVKPFEVVDLISQARRLLQRSQAAVAK* |
Ga0070711_1000374152 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MFTFSTAVEPEIRAFLHDNNVPYLVKPFEVGDLISQARRLLQKTQAAVAG* |
Ga0070708_1005219071 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SVTEPETRAFLHDNNLPYLVKPFEVADLISQARRLLQKTQAAVAG* |
Ga0066682_107141481 | 3300005450 | Soil | EPGDGRAFLQENSIPYLVKPFEVAELISQARKLLQKAQAAGAGAD* |
Ga0066687_103872061 | 3300005454 | Soil | PETRAFLHDNNVPYLVKPFEVGDLISQARRLLQKAVAATAD* |
Ga0070733_104806342 | 3300005541 | Surface Soil | PSDERAFLQQNNVPYLVKPFEVAELITQARKLLQKAHAAAAGAGSD* |
Ga0070732_105517651 | 3300005542 | Surface Soil | RAFLQENNVSYLVKPFEVAELISQARRLLQKARAASASAG* |
Ga0070693_1004534493 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LPEPEIRDFLQQHNLPSLVKPFEVADLIAQAKRLLQKTQAASAG* |
Ga0066661_105387671 | 3300005554 | Soil | LQESGIPYLVKPFEVAELIAQSRRLLQNAQAASAGAS* |
Ga0066692_101817662 | 3300005555 | Soil | FLQENSIPYLVKPFEVAELINQARKLLQKAQAAGAGAD* |
Ga0066670_107534152 | 3300005560 | Soil | GFLQENNVPFLVKPFEVAELIAQARRLLLKAQAAGAD* |
Ga0066708_102388091 | 3300005576 | Soil | PEPETRAFLQENKVASLVKPFEVADLISHARRLLQKSHAAVAG* |
Ga0070762_100957315 | 3300005602 | Soil | RAFLQENNIPYLVKPFEVAELISQARRLLQKSKGTASGAN* |
Ga0068856_1012042982 | 3300005614 | Corn Rhizosphere | FVQENNVPYLVRPFEVAELISQARKLLQKALAAEAGGD* |
Ga0066903_1034175531 | 3300005764 | Tropical Forest Soil | FLQENGIPYLVKPFEVAELISQARKLLQKAQAAAGGAD* |
Ga0068858_1002759554 | 3300005842 | Switchgrass Rhizosphere | TLPEPEIRDFLQQHNLPSLVKPFEVADLIAQAKRLLQKTQAASAG* |
Ga0070766_110403382 | 3300005921 | Soil | FSHGVAQGDERAFLQENNVPFLVKPFEVAELISQARRLLQKAQAAAASAG* |
Ga0070717_101005361 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GVEQGDERAFLQENNVPYLVKPFEVAELILQARRLLQKAHAAAAGAS* |
Ga0070717_107674213 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QGEIRVFLEESNIPYLVKPFEVADLISRARRLLQKASVAAAN* |
Ga0070717_119317552 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FLQENSVPYLVKPFEVAELIAQARKLLQKAHAAAAGAGSD* |
Ga0075029_1012059631 | 3300006052 | Watersheds | DERTFLQENNVSYLVKPFEVAELITQARKLLQKAQAAAAGLS* |
Ga0075019_100526833 | 3300006086 | Watersheds | TFSHGVEQADERSFLQENNVPYLVKPFEVAELIAQTRRLLPKAQAAGAGAN* |
Ga0075015_1008249622 | 3300006102 | Watersheds | VDPGDGRAFLQENNVPYLVKPFEVAELITQARKLLQKAQAAGASAS* |
Ga0070715_103431913 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | TFSSAVEPEIRGFLHDNNVPYLVKPFEVGDLISQARRLLQKTQAAVAG* |
Ga0075014_1008530441 | 3300006174 | Watersheds | FSNGVEPGNGRAYLQENNVPCLVKPFEVAELIAQTRKLLQKAQAAGAGAN* |
Ga0070765_1005260651 | 3300006176 | Soil | VPEPETRSFLHEKNVPSLVKPFEVADLIAQTRRLLPKAQAASAS* |
Ga0066660_116066052 | 3300006800 | Soil | QENNIPYLVKPFEVAELISQARKLLQKAQAAGAGAD* |
Ga0073928_106328311 | 3300006893 | Iron-Sulfur Acid Spring | NNIPYLVKPFEVAELISQARRLLQKAQAAAAGAS* |
Ga0075424_1006284041 | 3300006904 | Populus Rhizosphere | EIRAFLHDNNLPYLVKPFEVADLISQARRLLVKTQAATAG* |
Ga0102924_12110912 | 3300007982 | Iron-Sulfur Acid Spring | YLQEHSIPCLVKPFEVGELIAQARKLLQQAQAVTAGAD* |
Ga0099828_111395343 | 3300009089 | Vadose Zone Soil | GLEQGETRVFLEESNIPYLVKPFEVADLILRARRLLQKTNAATAN* |
Ga0099827_108093403 | 3300009090 | Vadose Zone Soil | ETRAFLQENKVASLVKPFEVADLISHARRLLRKSHAAVAG* |
Ga0116218_10703321 | 3300009522 | Peatlands Soil | RSFLQEKNVPCLVKPFEVADLIAHARRLMQKAHAASAS* |
Ga0116120_10889671 | 3300009641 | Peatland | VEQSDDRQFLQENHIPYLVKPFEVADLISQARRLLQKAQAAAASAS* |
Ga0116121_10092921 | 3300009644 | Peatland | DERAFLQENNVPYLVKPFEVAELISQARRLLQKAHAAAASAS* |
Ga0116217_102311581 | 3300009700 | Peatlands Soil | DSGIPYLVKPFEVADLISQARRLLQKAQAAAAGVS* |
Ga0126374_117405802 | 3300009792 | Tropical Forest Soil | RNYLQGNGIASLVKPFEVVDLISQARRILQRGQAAVAK* |
Ga0116219_102030501 | 3300009824 | Peatlands Soil | FLQENNVPYLVKPFEVAELISQARRLLQKAHAAAASAS* |
Ga0126373_103549681 | 3300010048 | Tropical Forest Soil | VLYTFSNTVEPGEGRAFLQENSIPYLVKPFEVAELISQARKLLLKAQAAGAGAD* |
Ga0126373_118666661 | 3300010048 | Tropical Forest Soil | EGRTFLQENNVPYLVKPFEVAELISQARKLLQKTQAAAAGGD* |
Ga0134109_100386844 | 3300010320 | Grasslands Soil | VRDFLAQNNLPHLVKPFEVADLIAQARRLLQKTHAVAAS* |
Ga0134111_100106795 | 3300010329 | Grasslands Soil | LAQNNLPHLVKPFEVADLIAQARRLLQKTHAAAAS* |
Ga0074046_105265422 | 3300010339 | Bog Forest Soil | RTFLQDSGVPYLVKPFEVADLISQARRLLQKAQAAAAGLS* |
Ga0126378_102320791 | 3300010361 | Tropical Forest Soil | DPTDGRSFLQVNGVPFLVKPFEVAELITQARKLLPKARAAGAD* |
Ga0126379_115794312 | 3300010366 | Tropical Forest Soil | VRNYLQSNGVPSLVKPFEVVDLISQARRLLQKTQAAIAN* |
Ga0134125_101235171 | 3300010371 | Terrestrial Soil | LEPEIRDFLHNNNVPYLVKPFEVGDLISQARRLLQKTQAAVAG* |
Ga0134125_122534871 | 3300010371 | Terrestrial Soil | FLQQHNLPSLVKPFEVADLIAQAKRLLQKTQAASAG* |
Ga0136449_1009384192 | 3300010379 | Peatlands Soil | QESNVPYLVKPFEVAELIAQARKLLQKAQVAAAGLS* |
Ga0136449_1037101771 | 3300010379 | Peatlands Soil | EQGDERAFLQENNVPYLVKPFEVAELILQARRLLQKSKAAASGS* |
Ga0126361_108852321 | 3300010876 | Boreal Forest Soil | PGAGRRFLQENNVPFLVKPFEVAELIAQARHLLQLAQVAAAGAG* |
Ga0138563_10222791 | 3300011072 | Peatlands Soil | PEVRSFMQEKGVSHLVKPFEVADLITHARRLMQKAQAATAN* |
Ga0137392_101227851 | 3300011269 | Vadose Zone Soil | LQENNVPYLVKPFEVAELISQSRRLLQKAHAAAASAD* |
Ga0154006_10460982 | 3300012125 | Attine Ant Fungus Gardens | SSLADQEARKFLQENNVPLLVKPFEVGDLINHARRLLQKAEAASAS* |
Ga0137399_114569271 | 3300012203 | Vadose Zone Soil | RAFLHDHNLPYLVKPFEVGDLISHARRLLQKTLAATAG* |
Ga0137377_110913641 | 3300012211 | Vadose Zone Soil | SFLQEKNLPYLVKPFEVADLIAQARRLSQKTQAASAG* |
Ga0137386_106379642 | 3300012351 | Vadose Zone Soil | DFLQQHNLPHLVKPFEVADLIAQARRLLQKTHAAVAS* |
Ga0137371_113592891 | 3300012356 | Vadose Zone Soil | FLQEKNLPYLVKPFEVADLIAQARRLSQKALAATAG* |
Ga0137360_102112071 | 3300012361 | Vadose Zone Soil | NAVEPEIRSFLHDNNIPYLVKPFEVGDLISQARRLLQKTLAATAG* |
Ga0137398_104647733 | 3300012683 | Vadose Zone Soil | GDERAFLQENNVPYLVKPFEVAELISQSRRLLQKAQAATASAD* |
Ga0137396_112151173 | 3300012918 | Vadose Zone Soil | IRVFLQESNIPYLVKPFEVAELISRARHLLQKANAATAN* |
Ga0137394_102193901 | 3300012922 | Vadose Zone Soil | IAESDIRNYLQANGVPSLVKPFEVVDLISHARRLVQKTQAAIAK* |
Ga0137359_116693892 | 3300012923 | Vadose Zone Soil | TFSNSPSDERAFLQENSVPYLVKPFEVAELITQARKLLQKAHAAAAGSD* |
Ga0137419_103482293 | 3300012925 | Vadose Zone Soil | SHGLEQGEIRVFLEESNIPYLVKPFEVADLISQARRLLQKAHAATSN* |
Ga0137416_112556491 | 3300012927 | Vadose Zone Soil | AFLHDHNLPYLVKPFEVGDLISHARRLLQKTLAASAG* |
Ga0137416_115099821 | 3300012927 | Vadose Zone Soil | AFLHDHNLPYLVKPFEVGDLISHARRLLQKTLAATAG* |
Ga0137416_122232182 | 3300012927 | Vadose Zone Soil | FLQENNVPCLVKPFEVGDLISQARRLLHKEQAAAAASSAS* |
Ga0137407_106126943 | 3300012930 | Vadose Zone Soil | ENSVACLVKPFEVGDLISQARRLLQKEQAAAASAS* |
Ga0137407_112368302 | 3300012930 | Vadose Zone Soil | AESDIRNYLQANGVPSLVKPFEVVDLISQARRLVQKTQAAIAK* |
Ga0162653_1000867171 | 3300012937 | Soil | EPEIRDFLQQHNLPSLVKPFEVADLIAQAKRLLQKTQAASAG* |
Ga0164303_105083121 | 3300012957 | Soil | TFSSALEPEIRDFLHHNNIPYLVKPFEVGDLISQARRLLQKTQSAVAG* |
Ga0164303_112861392 | 3300012957 | Soil | VDHSEGRTYLQECGIPYLVKPFEVAELISQARKLLQKTQAAGVGSD* |
Ga0126369_101735981 | 3300012971 | Tropical Forest Soil | ENGIPYLVKPFEVAELISQARKLLQKAQAASGGAD* |
Ga0126369_103365073 | 3300012971 | Tropical Forest Soil | KDYLQANGIASLVKPFEVVDLISQARRLLQKTQAAIAN* |
Ga0164306_119616801 | 3300012988 | Soil | PEIRDFLHNNNVPYLVKPFEVGDLISQARRLLQKTQAAVAG* |
Ga0164305_118385102 | 3300012989 | Soil | LQDNNLPCLVKPFEVADLINQARSLTQKVQAAGAS* |
Ga0157373_106273031 | 3300013100 | Corn Rhizosphere | QENNVPYLVRPFEVAELISQARKLLQKALAAGAGGT* |
Ga0181531_100527385 | 3300014169 | Bog | LQENNVPYLVKPFEVADLISHARRLLQKALAVAASSGS* |
Ga0182018_102727021 | 3300014489 | Palsa | DERAFLHENNVPYLVKPFEVAELISHARRLLQKAQAAAASAS* |
Ga0182015_100454076 | 3300014495 | Palsa | GDERAFLQENNVPYLVKPFEVAELISHARRLLQKAQAAAASAS* |
Ga0182024_127167022 | 3300014501 | Permafrost | SNGVEQTDEWAFLQENNIPYLVKPFEVADLITQARRLLQKAHAAAASAS* |
Ga0157376_101188121 | 3300014969 | Miscanthus Rhizosphere | SAVEPEIRSFLHDNNIPYLVKPFEVSDLISQARRLLQKTQAAVAGVT* |
Ga0157376_102953441 | 3300014969 | Miscanthus Rhizosphere | ENNVSFLVKPFEVAELISQARRLLPKAQAAGAGSD* |
Ga0137412_103505091 | 3300015242 | Vadose Zone Soil | LQENDIPYLIKPFEVVELISQTRRLLQKAHTAAAGAS* |
Ga0137412_109615561 | 3300015242 | Vadose Zone Soil | GRAFLQENNVPYLVKPFEVAELITQTRRLLQKEQAAAAAGI* |
Ga0132256_1000821671 | 3300015372 | Arabidopsis Rhizosphere | VRAYLQQHQLSSLVKPFEIADLITQARRLLQKAHAAAASAK* |
Ga0132255_1043113081 | 3300015374 | Arabidopsis Rhizosphere | VAEHDVRAYLQQHQLSSLVKPFEIADLITQARRLLQKAHAAAASAK* |
Ga0187818_105285301 | 3300017823 | Freshwater Sediment | TFLQENSIPYLVKPFEVAELISQARKLLQKAQAAGAGLS |
Ga0187820_12234841 | 3300017924 | Freshwater Sediment | TDERTFLQENSVPYLVKPFEVAELIAQTRRLLPKAQAAGAGSD |
Ga0187819_103220661 | 3300017943 | Freshwater Sediment | RGFLQENNVPYLVKPFEVADLISHARRLLQKTQAATAD |
Ga0187819_106542372 | 3300017943 | Freshwater Sediment | AAELEMRNFLQDNNIPSLLKPFEVADLIMQTRLLLQKAQAVGAN |
Ga0187785_100075125 | 3300017947 | Tropical Peatland | SNVAELEVRNFLQENHVPYLVKPFEVADLISHARRLLQKAQAAAAS |
Ga0187847_101075561 | 3300017948 | Peatland | DERAFLQENNVPYLVKPFEVAELISQARRLLQKAHAAAASAS |
Ga0187779_107419512 | 3300017959 | Tropical Peatland | AFLQENGIPYLVKPFEVAELIAQTRKLLQKAQAAGAS |
Ga0187822_102983151 | 3300017994 | Freshwater Sediment | FLQENGTPYLVKPFEVAELIAQARKLLQKALGASAGAD |
Ga0187804_100335763 | 3300018006 | Freshwater Sediment | EPEVRSFMQEKNVPCLVKPFEVADLIAHARRLMQKAHAASA |
Ga0187804_101728512 | 3300018006 | Freshwater Sediment | LQENHVPYLVKPFEVADLISHARRLLHKAQAAGAS |
Ga0187810_102098361 | 3300018012 | Freshwater Sediment | EVRSFLQGKGVPYLVKPFEVADLIVHTRRLMQKAQAASAS |
Ga0187874_103126991 | 3300018019 | Peatland | VEPGNGRAYLQENSVPCLVKPFEVAELISQARRLLQQTQAAAAGAS |
Ga0187788_102038711 | 3300018032 | Tropical Peatland | AEPEIRTFLQENNIPCLLKPFEVGDFISQARRLLQKTQAVGAS |
Ga0187863_100127838 | 3300018034 | Peatland | LQENNVPYLVKPFEVAELISQARRLLQKAHAAAASAS |
Ga0187863_100228231 | 3300018034 | Peatland | SCLQENHVPYLVKPFEVGELIEQARKLMQKAQSASAR |
Ga0187863_103333351 | 3300018034 | Peatland | SGVEQGDERAFLQENNLPYLVKPFEVAELILQARRLLQKAQAAAAGA |
Ga0187875_100365571 | 3300018035 | Peatland | SDERAFLQENKIPFLVKPFEVADLISHARRLLQKAQAAAASAS |
Ga0187766_103190661 | 3300018058 | Tropical Peatland | RTFLQENNVPYLVKPFEVADLITHARQLLTKAQAAGAS |
Ga0187784_103088853 | 3300018062 | Tropical Peatland | SFLQEKNVPMLVKPFEVADLIAQVRRLSQKAEGASAS |
Ga0187772_108687431 | 3300018085 | Tropical Peatland | NGVEQSDGRAFLQENSVPSLVKPFEVAELISQARKLLQKTQAASAGTD |
Ga0187772_111955092 | 3300018085 | Tropical Peatland | SSGVEQGNDRIFLQENNVPYLVKPFEVAELITQARRLLQKAHAAAASAS |
Ga0187772_114496971 | 3300018085 | Tropical Peatland | HGDSRSFLQDSTVPYLVKPFEVAELISQARRLLQKTQAAAVGTD |
Ga0187769_104801572 | 3300018086 | Tropical Peatland | LQENNVPSLVKPFEVADLISQARRLLQKTQAASAGTS |
Ga0187769_112752461 | 3300018086 | Tropical Peatland | ENSVPSLVKPFEVGELIAQARRLLQKSQTAAAGTD |
Ga0187770_109688022 | 3300018090 | Tropical Peatland | TFLQDNSIPYLVKPFEVAELISQARKLLQKTQTAAAGN |
Ga0066662_105529831 | 3300018468 | Grasslands Soil | RGFLQSNDLPFLVKPFEVADFITAARSLLQKTQAAAAAGT |
Ga0182025_11337551 | 3300019786 | Permafrost | KQRPFLQQNNVPYLVKPFEVADLISQARRLLQKAHAAAASAS |
Ga0193751_10983141 | 3300019888 | Soil | NGVELSDGRAFLQENGVACLVKPFEVAELIAHARRLLQRAQAAAAGAS |
Ga0210407_107939762 | 3300020579 | Soil | AYLQENNVPCLIKPFEVAELIAQARRLLQQAQAAAASAS |
Ga0210403_104301522 | 3300020580 | Soil | ANGLGDERAFLQENSIPYLVKPFEVAELIAQARKLLQKAHAAAASAS |
Ga0210399_105233171 | 3300020581 | Soil | FSNGVEQGDERAFLQENNLPYLVKPFEVAELISQARRLLQKSKGTASGAN |
Ga0210401_111676902 | 3300020583 | Soil | DVKNYLQSNGVPSLVKPFEVVDLISQARRLLQRTQAAIAN |
Ga0210404_104466851 | 3300021088 | Soil | PEVRTFLQEKNIPCLVKPFEVADLITHARRLMQKAQAASAT |
Ga0210400_111918522 | 3300021170 | Soil | HGVEQSNERAFLQENNVPYLVKPFEVADLISQARRLLQKAQAAAASAS |
Ga0210405_110042001 | 3300021171 | Soil | SFLQEKSVPCLVKPFEVADLIAHARRLMQKAHAASAS |
Ga0210408_107920441 | 3300021178 | Soil | AFLQENNVPYLVKPFEVGELISQARRLLLKTHAAAASAD |
Ga0210408_113977691 | 3300021178 | Soil | GDERAFLQENNVPYLVKPFEVAELISQARRLLQKTRAASAS |
Ga0210388_106637212 | 3300021181 | Soil | LQDKSVPCLVKPFEVADLITHARRLMQKAQAASAS |
Ga0210388_109997001 | 3300021181 | Soil | SDERAFLQQNNVPYLVKPFEVAELITQARKLLQKAHYAAAGSS |
Ga0210388_117430101 | 3300021181 | Soil | VTFASVAEPEVREFLQNNQVPYLVKPFEVGDLIGQARRLLQKASAAASSL |
Ga0210393_101276291 | 3300021401 | Soil | SFLQEKSIPCLVKPFEVADLIAHARRLMQKVQAASAS |
Ga0210393_115298621 | 3300021401 | Soil | FLEENHVPYLAKPFEVAELITQTRKLLQKAQAAGAGAS |
Ga0210397_107359401 | 3300021403 | Soil | ETRAFLHRNNLPYLVKPFEVADLISQARRLLQKSRATAAG |
Ga0210386_104569901 | 3300021406 | Soil | AEPDVRSFLQDKSVPCLVKPFEVADLITHARRLMQKAQAASAS |
Ga0210394_116045961 | 3300021420 | Soil | RAFLQENNVPYLVKPFEVADLISQARRLLQKAHAASAS |
Ga0210384_103168613 | 3300021432 | Soil | NGLGDERAFLQENSIPYLVKPFEVAELIAQARKLLQKAHAAAASAS |
Ga0210384_103236731 | 3300021432 | Soil | VVETETRAFLNNHNVPYLVKPFEVGDLIAHARRLLQKTLAATAG |
Ga0210391_112971521 | 3300021433 | Soil | QENNVPFLVKPFEVAELIAQARHLLQLAQAAAAGAS |
Ga0210392_114664331 | 3300021475 | Soil | SFLQEKNVPCLVKPFEVADLIAHARRLMQKAQAAGAS |
Ga0187846_103874552 | 3300021476 | Biofilm | QENTIPYLVKPFEVAELISQARKLLQKTQAAGAGAD |
Ga0210402_103141374 | 3300021478 | Soil | YLQSNGIASLVKPFEVVDLISQARRLLQRTQAAVAN |
Ga0210410_108780532 | 3300021479 | Soil | FSSAVEPEIRGFLHDNNVPYLVKPFEVGDLISQARRLLQKTQAAVAG |
Ga0224562_10111331 | 3300022733 | Soil | NGVEQGDERAFLQENNVPYLVKPFEVAELISQARRLLQKAHAAAASAS |
Ga0247695_10490942 | 3300024179 | Soil | NSVEPGEGRSFLQENSVPYLVKPFEVAELISQARKLLVKAQAAGAGAD |
Ga0207645_100440034 | 3300025907 | Miscanthus Rhizosphere | IRDFLHHNNIPYLVKPFEVGDLISQARRLLQKTQSAVAG |
Ga0207684_100570142 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VEPGNGRAYLQENSVPCLVKPFEVAELISQARRLLQQAQAAAASAD |
Ga0207671_107960422 | 3300025914 | Corn Rhizosphere | FSAGVEPSDGRAFVQENNVPYLVRPFEVAELISQARKLLQKALAAGAGAD |
Ga0207663_100773252 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LYTFSNSVEPGEGRSFLQENSVPYLVKPFEVAELISQARKLLVKAQAAGAGAD |
Ga0207663_101343712 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MFTFSTAVEPEIRAFLHDNNVPYLVKPFEVGDLISQARRLLQKTQAAVTG |
Ga0207650_102158404 | 3300025925 | Switchgrass Rhizosphere | PDVRAFLSDNNLPSLVKPFEVADLISHARKLVQKTQSAAAGS |
Ga0207700_101829772 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VEPSDGRAFVQENNVPYLVRPFEVAELISQARKLLQKALAAEAGGD |
Ga0207686_104892211 | 3300025934 | Miscanthus Rhizosphere | RDFLQQHDLPSLVKPFEVADLIAQAKRLLQKTQAASAG |
Ga0207665_100931971 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | PGEGRSFLQENSVPYLVKPFEVAELISQARKLLVKAQAAGAGAD |
Ga0207712_118256672 | 3300025961 | Switchgrass Rhizosphere | VRAFLSDNNLPSLVKPFEVADLISHARKLVQKTQSAAAGS |
Ga0207703_102415821 | 3300026035 | Switchgrass Rhizosphere | TLPEPEIRDFLQQHNLPSLVKPFEVADLIAQAKRLLQKTQAASAG |
Ga0209469_10742413 | 3300026307 | Soil | MRTFLQVKNVPSLVKPFEVADLISQTRRLLQKARAVAV |
Ga0209471_10569461 | 3300026318 | Soil | QGDERAFLQENSVPYLVKPFEVAELISQARRLLQKALATAASAD |
Ga0209158_10553713 | 3300026333 | Soil | EKNIPCLVKPFEVADLIAQARRLLQKSAAATASSS |
Ga0209377_10677661 | 3300026334 | Soil | VPEPEVRAVLQENNSASLVKPFEIAELISQARRLLQKAQAATAG |
Ga0209056_103592051 | 3300026538 | Soil | LQENKVASLVKPFEVADLISHARRLLQKSHAAVAG |
Ga0208366_10362101 | 3300027073 | Forest Soil | DVRNYLQSNGVPSLVKPFEVVDLISQARRLLQKTQAAIAN |
Ga0208860_10303202 | 3300027076 | Forest Soil | TKNYLQANGIASLVKPFEVVDLIAQARRLLQKTQAAAN |
Ga0208488_10417732 | 3300027110 | Forest Soil | DIRTFLLEKSVPCLVKPFEVADLINHARRLMQKSQAASAS |
Ga0209004_10613022 | 3300027376 | Forest Soil | DVKNYLQSNGVASLVKPFEVVDLISQARRLLQKTQAAIAK |
Ga0207522_1034361 | 3300027425 | Soil | MFTFSSALEPEIRDFLHHNNVPYLVKPFEVGDLISQARRLLQKTHSAVAG |
Ga0209422_10574421 | 3300027629 | Forest Soil | FLQEKNVPCLVKPFEVADLIAHARRLMQKAHAAAAS |
Ga0209248_100654191 | 3300027729 | Bog Forest Soil | TFLLEKSVPCLVKPFEVADLINHARRLMQKSQAASAS |
Ga0209039_102981541 | 3300027825 | Bog Forest Soil | FLQENSVPSLVKPFEVAELISQARSLLQKTQAAATGAD |
Ga0209580_103848283 | 3300027842 | Surface Soil | RAFLQENNVSYLVKPFEVAELISQARRLLQKARAASASAG |
Ga0209180_106175201 | 3300027846 | Vadose Zone Soil | SVAEPEIRSFLHENNLPCLVKPFEVADLISQARRLLQKTQTAAAG |
Ga0209274_100535501 | 3300027853 | Soil | LQDNDVAHLVKPFEVADLIAQARRLLQAHASAASAS |
Ga0209701_103759213 | 3300027862 | Vadose Zone Soil | ETRTFLHENNLPYLVKPFQVADLISRARRLLQKTRTATAG |
Ga0209167_100751064 | 3300027867 | Surface Soil | SDERAFLQQNNVPYLVKPFEVAELITQARKLLQKAHAAAAGAGSD |
Ga0209067_100445221 | 3300027898 | Watersheds | SHGVEQADERSFLQENNVPYLVKPFEVAELIAQTRRLLPKAQAAGAGAN |
Ga0209006_103311971 | 3300027908 | Forest Soil | RAFLNNHNVPYLVKPFEVGDLIAHARRLLQKTLAATAG |
Ga0209006_113452193 | 3300027908 | Forest Soil | EPEIREFLQNNQVPYLVKPFEVGDLIGHARRLLQKASAAAAS |
Ga0209698_108819183 | 3300027911 | Watersheds | NSVEPADGRTFLQESSIPYLVKPFEVAELISQARKLLQKAQAAGAGAD |
Ga0265357_10203522 | 3300028023 | Rhizosphere | FSNGVDLGDGRAYLQENNVPCLIKPFEVAELIAQARRLLQQAQAAAASAS |
Ga0268266_113018631 | 3300028379 | Switchgrass Rhizosphere | SFLHDNNIPYLVKPFEVSDLISQARRLLQKTQAAVAGVT |
Ga0302303_102927131 | 3300028776 | Palsa | GDARSFLQDNNITHLVKPFEVADLIAQARLLLQKSHASAASAS |
Ga0302225_105296271 | 3300028780 | Palsa | DERAFLQENNVPYLVKPFEVAELISHARRLLQKAQAAAASAS |
Ga0308309_112361591 | 3300028906 | Soil | MRKFLKENNVTYLVKPFEVGDLIAQARRLLQKTQAAVAG |
Ga0308309_116662801 | 3300028906 | Soil | SNGVEPGDERAFLQENDIPYLVKPFEVAELIAQARRLLQKAKASAAGAN |
Ga0222749_102245122 | 3300029636 | Soil | LFTFANGLGDERAFLQENSIPYLVKPFEVAELIAQARKLLQKAHAAAASAS |
Ga0311328_105588502 | 3300029939 | Bog | TFSNGVEQGDERAFLQENNVPYLVKPFEVAELISQARRLLQKAHAAAASA |
Ga0311346_107724121 | 3300029952 | Bog | GVEQGDERAFLEKNDVPYLVKPFEVADLISHARRLLQKAHAAAASAS |
Ga0311332_105679773 | 3300029984 | Fen | RAFLNHHNIACLVKPFEVADLISQARRLLVKTQAAGAS |
Ga0302282_12227473 | 3300030045 | Fen | RAFLEKNDVPYLVKPFEVADLISHARRLLQKAHAAAASAS |
Ga0302176_102109823 | 3300030057 | Palsa | RENNVPYLVKPFEVAELISQARRLLQKAHAAAGAG |
Ga0302275_103710021 | 3300030518 | Bog | RSFLQENNVPYLVKPFEVAELIAQARRLLQKAQAAAAGAG |
Ga0302310_105814441 | 3300030737 | Palsa | LQENNVPFLVKPFEVAELISQARRLLQKAHAAAAAAG |
Ga0265760_102847611 | 3300031090 | Soil | RAFLQENNVPCLVKPFEVAELIAQARRLLQQAQAAAASAS |
Ga0170824_1277929881 | 3300031231 | Forest Soil | NGVETGNGRAYLQENNVPCLVKPFEVAELISQARRLLQQAQAAAAGTD |
Ga0302325_114228223 | 3300031234 | Palsa | GDTRAFLQENNIPYLVKPFEVGELISHARSLLRKELASAASAD |
Ga0302324_1001623311 | 3300031236 | Palsa | FLRENNVPYLVKPFEVAELISQARRLLQKAHAAAGAG |
Ga0302326_114738281 | 3300031525 | Palsa | RAFLQENNIPYLVKPFEVGELISHARSLLRKELASAASAD |
Ga0302326_115019821 | 3300031525 | Palsa | LQENNVPYLVKPFEVADLISHARRLLQKALAVAASSGS |
Ga0302326_117003851 | 3300031525 | Palsa | RAFLQENNVPYLVKPFEVAELISHARRLLQKAQAAAASAS |
Ga0310915_112396251 | 3300031573 | Soil | EIRTFLQENNIPCLLKPFEVGDFISQARRLLQKTQAVGAS |
Ga0265314_105257831 | 3300031711 | Rhizosphere | SNGPSDEKAFLQENNIHYLVKPFEVAELIAQARRLLQKAQAAGAGAD |
Ga0307476_100148461 | 3300031715 | Hardwood Forest Soil | VEQGDERAFLQENNIPYLVKPFEVADLISQARRLLQKAHAATASA |
Ga0307476_108424053 | 3300031715 | Hardwood Forest Soil | GDERAFLQENNLPYLVKPFEVAELISQARRLLQKSKGTASGAN |
Ga0307476_112275961 | 3300031715 | Hardwood Forest Soil | RSFLHDNNVPYLVKPFEVSDLISQARRLLQKTQAAVAGSI |
Ga0307474_111052363 | 3300031718 | Hardwood Forest Soil | HERAFLQENNVPYLVKPFEVAELISQARRLLQKAHAAAASAS |
Ga0307474_112538392 | 3300031718 | Hardwood Forest Soil | NGIEQGDERVFLQEHNVPYLVKPFEVAELISQARRLLQKAHAATASAD |
Ga0307468_1009000761 | 3300031740 | Hardwood Forest Soil | ADGRTFLQENRIPYLVKPFEVAELISQARKLLQKAQAAGAD |
Ga0318576_102472521 | 3300031796 | Soil | RNYLQGNGIPSLVKPFEVVDLIAQARKILQKTQAAIAR |
Ga0306919_108186861 | 3300031879 | Soil | YTFSNSVEPGDGRSFLQENRVPYLVKPFEVAELISQARKLMQKAQAAGAGAD |
Ga0306921_108835491 | 3300031912 | Soil | VEPGEGRTFLQENSIPYLVKPFEVAELISQARKLLLKAQAASAGSD |
Ga0310912_100064181 | 3300031941 | Soil | VAEKDVRAYLQQAHIPSLVKPFEVAELIAHARRLLQKTQAATAK |
Ga0310912_100866935 | 3300031941 | Soil | DVRNYLQGNGIPSLVKPFEVVDLIAQARKILQKTQAAIAR |
Ga0310909_109011161 | 3300031947 | Soil | AEPETRTFLQANHVSYLVKPFEVIDLISHARKLLQKSNAAAAG |
Ga0306924_125600902 | 3300032076 | Soil | FLQANHVSYLVKPFEVIDLISHARKLLQKSNAAAAG |
Ga0307470_102276563 | 3300032174 | Hardwood Forest Soil | DTDIRNYLQANGVPSLVKPFEVVDLISQARRMLQKTQAAVAQ |
Ga0307471_1011109951 | 3300032180 | Hardwood Forest Soil | VEEGDERAFLQQNNVPYLVKPFEVAELISQARRLLQKAQAAAASAS |
Ga0307471_1035969231 | 3300032180 | Hardwood Forest Soil | GDGRTFLQENSIPYLVKPFEVAELISQARKLLQKAQAVGAGAD |
Ga0307471_1036007011 | 3300032180 | Hardwood Forest Soil | LHQNNLPYLVKPFEVADLISQARRLLQKTRAASAG |
Ga0307472_1007697201 | 3300032205 | Hardwood Forest Soil | FTFSNAVEPEIRSFLHDNNIPYLVKPFEVGDLISQARRLLQRTLAATAG |
Ga0348332_130141244 | 3300032515 | Plant Litter | EQGDERAFLQENNVPYLVKPFEVAELISQARRLLQKAHATAASAS |
Ga0335078_100990814 | 3300032805 | Soil | RDYLQENSVPYLVKPFEVAELISQARKLLQKTQAAGAGAD |
Ga0335078_103128071 | 3300032805 | Soil | LQDHNVPFLVKPFEVAELITQVRQLLPKAQAAGAG |
Ga0335080_107007602 | 3300032828 | Soil | ERSFLQENRVPYLVKPFEVAELISQARKLLQKAQSAAAGAAE |
Ga0335081_101717445 | 3300032892 | Soil | SAAELEMRNFLQENNVPSLLKPFEVADLIMQTRLLLQKAQAVGAS |
Ga0335081_108551733 | 3300032892 | Soil | RTFLQERNVPFLVKPFEVSDVIAHARRLLQKTHAAGAS |
Ga0335069_100742061 | 3300032893 | Soil | STMADAETKAFLQEHTVTCLVKPFGVADLIAQARRLLQKTMAAGA |
Ga0335069_101056681 | 3300032893 | Soil | ENGVPYLVKPFEVAELISQARKLLQKSLAAGAGTD |
Ga0335069_108291492 | 3300032893 | Soil | GVELGEGRSFLQENNVPYLVKPFEVAELISQARKLLQKSLAASAGTD |
Ga0335069_120688972 | 3300032893 | Soil | GVELGEGRSFLQENNVPYLVKPFEVAELISQARKLLQKSLAAGAGTD |
Ga0335071_100379554 | 3300032897 | Soil | NGVEPGEGRSFLQENGVPYLVKPFEVAELISQARKLLQKSLAAGAGTD |
Ga0335083_100198241 | 3300032954 | Soil | TFSNGVEPGEGRAFLQENNVPYLVKPFEVAELISQARKLLQKTQAAGAGAD |
Ga0335083_106169232 | 3300032954 | Soil | FLQQNSVPYLVKPFEVADLIAQTRKLLQGTKAAAAGAS |
Ga0335073_110757801 | 3300033134 | Soil | DARAFLQENKVPYLVKPFEVAELIAQTRKLLPKAHAAGAGAS |
Ga0335077_100914302 | 3300033158 | Soil | PGDGRAFLQENNVPYLVKPFEVAELISQARKLLQKALAAGAGTD |
Ga0314867_142931_431_559 | 3300033808 | Peatland | DGRAFLQENGIPYLVKPFEVAELIAQTRKLLQKAQAAGAGAS |
Ga0334792_115755_569_718 | 3300033888 | Soil | AADGDERAFLQENNLPYLVKPFEVAELISQARRLLQKAQAAAASAGAMG |
Ga0371488_0068885_1966_2079 | 3300033983 | Peat Soil | LQENKIPFLVKPFEVADLISQARRLLQKAQAAAASAS |
⦗Top⦘ |