| Basic Information | |
|---|---|
| Family ID | F016543 |
| Family Type | Metagenome |
| Number of Sequences | 246 |
| Average Sequence Length | 46 residues |
| Representative Sequence | ITNLPYDANGNVIDSRSRPRGAGFGVATGYQNPRTVQAQIRFSF |
| Number of Associated Samples | 192 |
| Number of Associated Scaffolds | 246 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.92 % |
| % of genes near scaffold ends (potentially truncated) | 92.28 % |
| % of genes from short scaffolds (< 2000 bps) | 93.50 % |
| Associated GOLD sequencing projects | 182 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.618 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.008 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.740 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.439 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.56% β-sheet: 2.78% Coil/Unstructured: 91.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 246 Family Scaffolds |
|---|---|---|
| PF00884 | Sulfatase | 4.88 |
| PF01739 | CheR | 3.25 |
| PF13620 | CarboxypepD_reg | 3.25 |
| PF13442 | Cytochrome_CBB3 | 3.25 |
| PF02776 | TPP_enzyme_N | 2.03 |
| PF00171 | Aldedh | 1.63 |
| PF01408 | GFO_IDH_MocA | 1.22 |
| PF06283 | ThuA | 1.22 |
| PF09339 | HTH_IclR | 1.22 |
| PF00753 | Lactamase_B | 1.22 |
| PF12836 | HHH_3 | 1.22 |
| PF00355 | Rieske | 1.22 |
| PF00034 | Cytochrom_C | 1.22 |
| PF01738 | DLH | 0.81 |
| PF07676 | PD40 | 0.81 |
| PF00406 | ADK | 0.81 |
| PF08327 | AHSA1 | 0.81 |
| PF13360 | PQQ_2 | 0.81 |
| PF00127 | Copper-bind | 0.81 |
| PF03551 | PadR | 0.81 |
| PF01063 | Aminotran_4 | 0.81 |
| PF04734 | Ceramidase_alk | 0.41 |
| PF01545 | Cation_efflux | 0.41 |
| PF12708 | Pectate_lyase_3 | 0.41 |
| PF07690 | MFS_1 | 0.41 |
| PF12704 | MacB_PCD | 0.41 |
| PF12681 | Glyoxalase_2 | 0.41 |
| PF01261 | AP_endonuc_2 | 0.41 |
| PF03713 | DUF305 | 0.41 |
| PF00754 | F5_F8_type_C | 0.41 |
| PF07969 | Amidohydro_3 | 0.41 |
| PF13517 | FG-GAP_3 | 0.41 |
| PF13377 | Peripla_BP_3 | 0.41 |
| PF14559 | TPR_19 | 0.41 |
| PF02371 | Transposase_20 | 0.41 |
| PF05199 | GMC_oxred_C | 0.41 |
| PF07978 | NIPSNAP | 0.41 |
| PF03616 | Glt_symporter | 0.41 |
| PF13646 | HEAT_2 | 0.41 |
| PF01042 | Ribonuc_L-PSP | 0.41 |
| PF00903 | Glyoxalase | 0.41 |
| PF05572 | Peptidase_M43 | 0.41 |
| PF17186 | Lipocalin_9 | 0.41 |
| PF00072 | Response_reg | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 246 Family Scaffolds |
|---|---|---|---|
| COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 6.50 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 3.25 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.63 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.63 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.63 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.63 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 1.22 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.81 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.81 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.81 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.81 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.41 |
| COG0786 | Na+/glutamate symporter | Amino acid transport and metabolism [E] | 0.41 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.41 |
| COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 0.41 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.41 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.41 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.41 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.62 % |
| Unclassified | root | N/A | 11.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886011|MRS1b_contig_2106901 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 2170459005|F1BAP7Q01C0CAW | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300000550|F24TB_11406049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 531 | Open in IMG/M |
| 3300000559|F14TC_106020833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300000956|JGI10216J12902_106859138 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300000956|JGI10216J12902_111754434 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_106577261 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 668 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108431472 | Not Available | 720 | Open in IMG/M |
| 3300001686|C688J18823_10424994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300001976|JGI24752J21851_1053596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300002128|JGI24036J26619_10081048 | Not Available | 651 | Open in IMG/M |
| 3300002128|JGI24036J26619_10104154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8 | 580 | Open in IMG/M |
| 3300002239|JGI24034J26672_10040966 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300002244|JGI24742J22300_10116399 | Not Available | 525 | Open in IMG/M |
| 3300004114|Ga0062593_101721885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300004114|Ga0062593_103142153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300004153|Ga0063455_101165890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300004156|Ga0062589_101091450 | Not Available | 754 | Open in IMG/M |
| 3300004156|Ga0062589_102577266 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300004157|Ga0062590_100403620 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300004643|Ga0062591_100855861 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300004643|Ga0062591_101150933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300005093|Ga0062594_101401697 | Not Available | 709 | Open in IMG/M |
| 3300005093|Ga0062594_101632602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300005093|Ga0062594_101700925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300005093|Ga0062594_102456252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300005093|Ga0062594_103083439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300005093|Ga0062594_103175849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300005174|Ga0066680_10282197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
| 3300005328|Ga0070676_10183886 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300005340|Ga0070689_100111687 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
| 3300005344|Ga0070661_101850030 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005355|Ga0070671_100415313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1152 | Open in IMG/M |
| 3300005356|Ga0070674_101068948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8 | 711 | Open in IMG/M |
| 3300005365|Ga0070688_100170366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1502 | Open in IMG/M |
| 3300005365|Ga0070688_101666568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300005366|Ga0070659_100749094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300005436|Ga0070713_101936396 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005440|Ga0070705_101278747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300005441|Ga0070700_101911059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300005445|Ga0070708_102272436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300005456|Ga0070678_100436642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 1144 | Open in IMG/M |
| 3300005457|Ga0070662_101475122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300005458|Ga0070681_10981961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300005459|Ga0068867_102000434 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005466|Ga0070685_10845926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300005467|Ga0070706_101392345 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005471|Ga0070698_101455962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300005518|Ga0070699_100457626 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300005535|Ga0070684_100382679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1296 | Open in IMG/M |
| 3300005549|Ga0070704_101443233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300005559|Ga0066700_10327555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300005564|Ga0070664_101435396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300005617|Ga0068859_101119661 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005618|Ga0068864_100616436 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300005618|Ga0068864_100710164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8 | 983 | Open in IMG/M |
| 3300005618|Ga0068864_101768341 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005713|Ga0066905_100140909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1720 | Open in IMG/M |
| 3300005764|Ga0066903_108785915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300005843|Ga0068860_100651208 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300005844|Ga0068862_100519122 | Not Available | 1133 | Open in IMG/M |
| 3300005844|Ga0068862_100727280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
| 3300006034|Ga0066656_10263240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300006051|Ga0075364_10847067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300006058|Ga0075432_10225725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300006195|Ga0075366_11020581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300006353|Ga0075370_10933520 | Not Available | 531 | Open in IMG/M |
| 3300006797|Ga0066659_11888315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300006846|Ga0075430_101415505 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006852|Ga0075433_11462071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300006853|Ga0075420_100158674 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
| 3300006871|Ga0075434_101222015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300006871|Ga0075434_101235635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300006880|Ga0075429_100363667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1267 | Open in IMG/M |
| 3300006894|Ga0079215_10870487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 641 | Open in IMG/M |
| 3300006894|Ga0079215_11006067 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300006903|Ga0075426_10083203 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
| 3300006904|Ga0075424_101149279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300006904|Ga0075424_102389079 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300006954|Ga0079219_10680715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300006969|Ga0075419_11052283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300009012|Ga0066710_103110305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300009012|Ga0066710_104161071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 541 | Open in IMG/M |
| 3300009038|Ga0099829_10712962 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300009084|Ga0105046_11235514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300009094|Ga0111539_10682438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Bryocella → Bryocella elongata | 1196 | Open in IMG/M |
| 3300009100|Ga0075418_12462520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300009111|Ga0115026_11789431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300009147|Ga0114129_10303743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2126 | Open in IMG/M |
| 3300009156|Ga0111538_11642322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300009156|Ga0111538_13438426 | Not Available | 550 | Open in IMG/M |
| 3300009177|Ga0105248_12610834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300009527|Ga0114942_1188919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300009610|Ga0105340_1243356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300009840|Ga0126313_10492682 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300010041|Ga0126312_10611242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300010044|Ga0126310_10816070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300010301|Ga0134070_10221463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300010375|Ga0105239_11386308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300010399|Ga0134127_11387584 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300010400|Ga0134122_12318450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300010401|Ga0134121_12905595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300010403|Ga0134123_12277518 | Not Available | 605 | Open in IMG/M |
| 3300011119|Ga0105246_11723451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300011269|Ga0137392_11057021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300011444|Ga0137463_1135192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300012096|Ga0137389_11200607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300012096|Ga0137389_11399751 | Not Available | 595 | Open in IMG/M |
| 3300012179|Ga0137334_1141674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300012189|Ga0137388_11962871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300012204|Ga0137374_10017843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 8111 | Open in IMG/M |
| 3300012212|Ga0150985_114112019 | Not Available | 592 | Open in IMG/M |
| 3300012212|Ga0150985_114449145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3296 | Open in IMG/M |
| 3300012360|Ga0137375_11460538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 505 | Open in IMG/M |
| 3300012680|Ga0136612_10062120 | All Organisms → cellular organisms → Bacteria | 1878 | Open in IMG/M |
| 3300012684|Ga0136614_10505788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300012893|Ga0157284_10167142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300012901|Ga0157288_10198234 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012909|Ga0157290_10236183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300012951|Ga0164300_10541763 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300012961|Ga0164302_11199105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300012971|Ga0126369_12658219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300012984|Ga0164309_11525617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300012984|Ga0164309_11731237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300012985|Ga0164308_10397136 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300012985|Ga0164308_12224274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300012986|Ga0164304_11323843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300012987|Ga0164307_11638593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300013296|Ga0157374_10184307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2040 | Open in IMG/M |
| 3300013308|Ga0157375_10607712 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300014325|Ga0163163_11407318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300014325|Ga0163163_12904845 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300014326|Ga0157380_11971071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300014326|Ga0157380_13163720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300014745|Ga0157377_10209015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1243 | Open in IMG/M |
| 3300014880|Ga0180082_1033263 | Not Available | 1073 | Open in IMG/M |
| 3300014880|Ga0180082_1166876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300015196|Ga0167627_1077940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
| 3300015371|Ga0132258_10976356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2140 | Open in IMG/M |
| 3300015371|Ga0132258_12472246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1300 | Open in IMG/M |
| 3300015372|Ga0132256_101314815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300015372|Ga0132256_102793133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300015373|Ga0132257_101145901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
| 3300015373|Ga0132257_103849870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300015374|Ga0132255_101024114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1239 | Open in IMG/M |
| 3300015374|Ga0132255_101785076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300015374|Ga0132255_102390604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300015374|Ga0132255_105196517 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300017654|Ga0134069_1274597 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300017965|Ga0190266_10232259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
| 3300018073|Ga0184624_10074488 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300018073|Ga0184624_10270856 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300018075|Ga0184632_10271879 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300018075|Ga0184632_10356539 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300018082|Ga0184639_10648425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300018429|Ga0190272_13126128 | Not Available | 514 | Open in IMG/M |
| 3300018431|Ga0066655_10443236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300018469|Ga0190270_10059402 | All Organisms → cellular organisms → Bacteria | 2714 | Open in IMG/M |
| 3300018469|Ga0190270_10599157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1073 | Open in IMG/M |
| 3300018476|Ga0190274_10502013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1213 | Open in IMG/M |
| 3300018476|Ga0190274_12504140 | Not Available | 613 | Open in IMG/M |
| 3300018476|Ga0190274_13900179 | Not Available | 505 | Open in IMG/M |
| 3300018481|Ga0190271_10191154 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
| 3300018481|Ga0190271_11438138 | Not Available | 807 | Open in IMG/M |
| 3300018481|Ga0190271_12207441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300018481|Ga0190271_13278609 | Not Available | 543 | Open in IMG/M |
| 3300018962|Ga0193589_1182008 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300019356|Ga0173481_10831357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300019361|Ga0173482_10248591 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300020020|Ga0193738_1061507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1119 | Open in IMG/M |
| 3300020198|Ga0194120_10534840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 521 | Open in IMG/M |
| 3300021078|Ga0210381_10272718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300022756|Ga0222622_11308936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300022899|Ga0247795_1092164 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300024055|Ga0247794_10036635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Bryocella → Bryocella elongata | 1296 | Open in IMG/M |
| 3300025903|Ga0207680_11211394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300025910|Ga0207684_11055248 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300025913|Ga0207695_11041697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300025922|Ga0207646_10431990 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300025923|Ga0207681_10090497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2184 | Open in IMG/M |
| 3300025923|Ga0207681_10135828 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
| 3300025923|Ga0207681_11101500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300025925|Ga0207650_10186542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1655 | Open in IMG/M |
| 3300025926|Ga0207659_11221575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300025931|Ga0207644_10177620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1667 | Open in IMG/M |
| 3300025932|Ga0207690_10166951 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300025940|Ga0207691_10190079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1791 | Open in IMG/M |
| 3300025940|Ga0207691_10729328 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300025941|Ga0207711_11273207 | Not Available | 677 | Open in IMG/M |
| 3300025945|Ga0207679_11026934 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300025972|Ga0207668_10999976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300025972|Ga0207668_11584006 | Not Available | 591 | Open in IMG/M |
| 3300025972|Ga0207668_12149449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300025981|Ga0207640_10164857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1644 | Open in IMG/M |
| 3300026023|Ga0207677_11216536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8 | 690 | Open in IMG/M |
| 3300026035|Ga0207703_11286169 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300026041|Ga0207639_11195417 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300026088|Ga0207641_12237633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8 | 547 | Open in IMG/M |
| 3300026089|Ga0207648_10921415 | Not Available | 817 | Open in IMG/M |
| 3300026116|Ga0207674_10587435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1076 | Open in IMG/M |
| 3300026142|Ga0207698_10294396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1508 | Open in IMG/M |
| 3300026306|Ga0209468_1079999 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300027462|Ga0210000_1047668 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300027614|Ga0209970_1053482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300027639|Ga0209387_1017703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1347 | Open in IMG/M |
| 3300027826|Ga0209060_10384857 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300027850|Ga0209591_10730245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300027886|Ga0209486_10786338 | Not Available | 621 | Open in IMG/M |
| 3300028379|Ga0268266_11387716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8 | 678 | Open in IMG/M |
| 3300028379|Ga0268266_12160331 | Not Available | 529 | Open in IMG/M |
| 3300028608|Ga0247819_10734159 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300028802|Ga0307503_10948081 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300028819|Ga0307296_10824252 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300030606|Ga0299906_11326533 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031366|Ga0307506_10014552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1827 | Open in IMG/M |
| 3300031455|Ga0307505_10131158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300031538|Ga0310888_10500104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300031547|Ga0310887_10566331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300031562|Ga0310886_10233866 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300031854|Ga0310904_10479010 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300031858|Ga0310892_10903089 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300031892|Ga0310893_10459500 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031901|Ga0307406_10945599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300031908|Ga0310900_10386224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
| 3300031940|Ga0310901_10535501 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031996|Ga0308176_11805060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8 | 653 | Open in IMG/M |
| 3300032000|Ga0310903_10093253 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300032002|Ga0307416_100879411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 995 | Open in IMG/M |
| 3300032002|Ga0307416_101465643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300032003|Ga0310897_10170210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300032003|Ga0310897_10471076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300032003|Ga0310897_10713497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300032074|Ga0308173_10735849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 903 | Open in IMG/M |
| 3300032122|Ga0310895_10335008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300032179|Ga0310889_10079148 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300033412|Ga0310810_10635187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300033412|Ga0310810_10892464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300033413|Ga0316603_11869761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300033418|Ga0316625_100769012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300034157|Ga0370506_108512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.28% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.06% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.25% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.44% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.03% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.03% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.03% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.22% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.22% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.22% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.63% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.41% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.41% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.41% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.41% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.41% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.41% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.41% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.41% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.41% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
| Rice-Straw Enriched Compost | Engineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost | 0.41% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.81% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005286 | Mesophilic microbial community from rice straw/compost enrichment Sample: eDNA_1 | Engineered | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009084 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300015196 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G2C, Ice surface) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018962 | Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 3 min after wetting v1 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300034157 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MRS1b_0302.00000430 | 2162886011 | Miscanthus Rhizosphere | VTITNLPFDANGNLIDTRSRPRGAGFGVATAYQNPRTVQAQIRFSF |
| E41_05687980 | 2170459005 | Grass Soil | NLPYDANGNLIASRSLPRGAGFGVANAYQNARTVQVQIRFTF |
| F24TB_114060491 | 3300000550 | Soil | ALNLPFDAAGNLIPSRSLPKNAGFGVANAYQGPRTVQGQIRFSF* |
| F14TC_1060208331 | 3300000559 | Soil | GNVIDARSRPRGAGFGVATAYQDPRTMQLQLRVSF* |
| JGI10216J12902_1068591381 | 3300000956 | Soil | DPVTATNLPYDANGNLIASRSLPRGAGFGVANAYQAPRQVQLQIRFRF* |
| JGI10216J12902_1117544341 | 3300000956 | Soil | DPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQAPRQVQLQIRFRF* |
| JGIcombinedJ13530_1065772611 | 3300001213 | Wetland | PFDSSGNLIVSRSQPKNAGFGVANGYQGARTIQAQLRFYF* |
| JGIcombinedJ13530_1084314721 | 3300001213 | Wetland | TTPTTITNLPGVDANGYPIRSTPRTAGFGVATTYQSARSIQLTARFNF* |
| C688J18823_104249942 | 3300001686 | Soil | PVSATNLPFDANGNVIDSRSRPRGAGFGVANAYQNPRTVQAQIRFSF* |
| JGI24752J21851_10535961 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | STPNTITNLPYDASGNPIDSRSKPRGAGFGVATAYQTPRAIQLTARFNF* |
| JGI24036J26619_100810481 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | YDAAGNLIPARAIPSTAGFGVATNAADPRRVQVQIRFQF* |
| JGI24036J26619_101041542 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | DPVAITNLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF* |
| JGI24034J26672_100409661 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | LPFDAAGNLVASRATPRGNGFGVATAFQTPRTIQAQIRFSF* |
| JGI24742J22300_101163991 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | NLPFDAAGNLVASRATPRGNGFGVATAFQTPRTIQAQIRFSF* |
| Ga0062593_1017218851 | 3300004114 | Soil | NTTMQLANPNAPGAITNLPYDADGNLITSRSLPRGAGFGVATQYQSPRTVQGQVRFVF* |
| Ga0062593_1031421531 | 3300004114 | Soil | ATMSLLSPANPVDIQNLPFDANGNLIDSRSRPRGAGFGVATGYQAPRTLQFQLRFAF* |
| Ga0063455_1011658902 | 3300004153 | Soil | ATNLPYDANGNLVASRSLPRGAGFGVATAYQTPRQVQVQVRFRF* |
| Ga0062589_1010914502 | 3300004156 | Soil | LPYDASGNVIDARSRPRGAGFGVATQYQTPRAIQLTARFNF* |
| Ga0062589_1025772662 | 3300004156 | Soil | SDPVNATNLPFDSSGNVVQSRALPRGAGFGVANAYQNPRTVQLQVRFSF* |
| Ga0062590_1004036202 | 3300004157 | Soil | TVNLSDPTNPVTANNLPFDAAGNLIAARALPRSAGFGVANNYQAPRAMQAQIRFSF* |
| Ga0062591_1008558612 | 3300004643 | Soil | ASFSSQADPITLQNSPFDANGNLIASRSLPRGAGFGVANNYQAPRNVQLQVRFSF* |
| Ga0062591_1011509331 | 3300004643 | Soil | PSAPNVITNLPFDAAGNVVETRSRPRGAGFGVATDYQDPRTMQFQLRFSF* |
| Ga0062594_1014016971 | 3300005093 | Soil | SSPTDPTPVNLPYDANGNTVTSRSLPKNAGFGVASGYQSPRTIQAQIRFSF* |
| Ga0062594_1016326021 | 3300005093 | Soil | VTITNLPFDANGNLIDTRSRPRGAGFGVATAYQNPRTVQAQIRFSF* |
| Ga0062594_1017009252 | 3300005093 | Soil | NLPFDANGNLIVARSLPRGAGFGVANAYQAPRSVQVQLRFSF* |
| Ga0062594_1024562522 | 3300005093 | Soil | ATNLPFDANGNLIASRSLPRGAGFGVANAYQAPRTIQAQIRFSF* |
| Ga0062594_1030834392 | 3300005093 | Soil | AITNLPVDASGNVIDSRSRPRGAGFGVATDYQNPRAVQMQIRFSF* |
| Ga0062594_1031758492 | 3300005093 | Soil | QTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF* |
| Ga0066680_102821971 | 3300005174 | Soil | LVNPTDPVTATNLPFDADGNLIDARARPRSAGFGVATGYQAARTIQAQLRFSF* |
| Ga0065721_104039322 | 3300005286 | Rice-Straw Enriched Compost | TMNLSNPLNPTTINNLPSDENGQLIDARSRPRSAGFGVASAYQTPRTVQLQVRFTF* |
| Ga0070676_101838861 | 3300005328 | Miscanthus Rhizosphere | LDQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF* |
| Ga0070689_1001116871 | 3300005340 | Switchgrass Rhizosphere | MTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF* |
| Ga0070689_1009649502 | 3300005340 | Switchgrass Rhizosphere | TMNLSNPGDPTTITNLPYDAAGNVIAARATPRGNGFGVATGFQSPRNLQAQIRFSF* |
| Ga0070661_1018500301 | 3300005344 | Corn Rhizosphere | YDSSGNLIPTLSLPRNAGFGVATAYQNPRSVQVQIRFTF* |
| Ga0070671_1004153131 | 3300005355 | Switchgrass Rhizosphere | YDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF* |
| Ga0070674_1010689481 | 3300005356 | Miscanthus Rhizosphere | NLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF* |
| Ga0070688_1001703662 | 3300005365 | Switchgrass Rhizosphere | ITNLPYDASGNLIPTLSLPRNAGFGVATAYQVPRSVQAQIRFVF* |
| Ga0070688_1016665682 | 3300005365 | Switchgrass Rhizosphere | SAPNVITNLPFDAAGNVVETRSRPRGAGFGVATDYQDPRTMQFQLRFSF* |
| Ga0070659_1007490942 | 3300005366 | Corn Rhizosphere | VTITNLPFDANGNLIDTRSRPRGAGFGVATAYQNPRTVQAQIRF |
| Ga0070713_1019363961 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TPAAAATITNLPYDANGNLIPSLTLPRSAGFGVATAYQTPRAVQVQIRFSF* |
| Ga0070705_1012787472 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | NRNSPQNLPYDANGNLIASRSLPRGAGFGVANNYQNARSVQVQVRFSF* |
| Ga0070700_1019110592 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | DPAAITNLPFDAAGNLVASRATPRGNGFGVATAFQTPRTIQAQIRFSF* |
| Ga0070708_1022724362 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TSPNDPVTPQNLPFDANGNLIASRSLPRGAGFGVANNYQNARSVQGQVRFSF* |
| Ga0070678_1004366422 | 3300005456 | Miscanthus Rhizosphere | RNTTVNYNNPTDPITATNLPYDASGNVVASRSQPKNAGFGVATTYQTPRQVQLQIRFRF* |
| Ga0070662_1014751222 | 3300005457 | Corn Rhizosphere | NPVDIQNLPFDANGNLIDSRSRPRGAGFGVATGYQAPRTLQFQLRFAF* |
| Ga0070681_109819611 | 3300005458 | Corn Rhizosphere | YDANGNVIDSRSRPRGAGFGVANAYQNPRNLQAQIRFSF* |
| Ga0068867_1020004341 | 3300005459 | Miscanthus Rhizosphere | FDANGNLVASRSLPSNAGFGVANAYQAPRTVQAQIRFSF* |
| Ga0070685_108459262 | 3300005466 | Switchgrass Rhizosphere | FANPSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF* |
| Ga0070706_1013923451 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | FDADGNLIDSRSRPRGAGFGVATGYQAPRSVQVQARFSF* |
| Ga0070698_1014559621 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DPLTVVNLPFLADGSLNPARSLPKNAGFGVANVYQNPRTIQAQIRFSF* |
| Ga0070699_1004576261 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VITNLPFDASGNVIDSRSRPRGAGFGVATGYQDPRTMQLQVRFSF* |
| Ga0070684_1003826792 | 3300005535 | Corn Rhizosphere | NTTMTLASPTDPVAITNLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF* |
| Ga0070704_1014432332 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TNLPVDASGNVIDSRSRPRGAGFGVATDYQNPRAVQMQIRFSF* |
| Ga0066700_103275552 | 3300005559 | Soil | VTATNLPFDANGNLSVSRSLPRGAGFGVATAYQPARTMQIQVRFSF* |
| Ga0070664_1014353961 | 3300005564 | Corn Rhizosphere | VSLASPLDQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF* |
| Ga0068859_1011196611 | 3300005617 | Switchgrass Rhizosphere | VTPQNLPFNGAGDLILSRSLPRGAGFGVANNYQNPRTVQVQVRFSF* |
| Ga0068864_1006164361 | 3300005618 | Switchgrass Rhizosphere | NVVDARSRPRGAGFGVASAYQSPRTMQAQIRFAF* |
| Ga0068864_1007101642 | 3300005618 | Switchgrass Rhizosphere | ITNLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF* |
| Ga0068864_1017683411 | 3300005618 | Switchgrass Rhizosphere | NTSSGAAATITNLPYDANGNLIPSLSLPRNAGFGVATNYQVPRTVQVQIRFSF* |
| Ga0066905_1001409091 | 3300005713 | Tropical Forest Soil | LPYDAAGNVIASRSLPKNAGFGVANAYQNPRTLQAQIRFTF* |
| Ga0068861_1001159761 | 3300005719 | Switchgrass Rhizosphere | SVIDSRSRPRGAGFGVATGYQNPRTVQAQIRFSF* |
| Ga0066903_1087859151 | 3300005764 | Tropical Forest Soil | ITPTNLPVDANGRLIDSRSRPRGAGFGVATGFQPPRTVQIQLRLSF* |
| Ga0068860_1006512082 | 3300005843 | Switchgrass Rhizosphere | GNPGNATNLPFDPAGNLIPARAIPRGAGFGVANNYQAPRSVQLQIRFSF* |
| Ga0068860_1021805062 | 3300005843 | Switchgrass Rhizosphere | ASPSDPVTVTNLPFDAAGNVIATRSTPKNPGFGIATGYQPPRTMQLQARFSF* |
| Ga0068862_1005191222 | 3300005844 | Switchgrass Rhizosphere | NLKGDFSDPASIQNLPFDAAGNIIEGLSKPRGAGFGVATGYQTPRSLQMQARFSF* |
| Ga0068862_1007272801 | 3300005844 | Switchgrass Rhizosphere | PLDQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF* |
| Ga0066656_102632401 | 3300006034 | Soil | GNIVDARARPRGAGFGVATGYQDPRTMQMQLRISF* |
| Ga0075364_108470671 | 3300006051 | Populus Endosphere | NGNLIPSLSLPRGAGFGVATGYQDPRTLQLQLRFQF* |
| Ga0075432_102257252 | 3300006058 | Populus Rhizosphere | VITNLPFDAAGNVIDARSRPRGAGFGVATEYQLPRTVQLQVRVAF* |
| Ga0075366_110205811 | 3300006195 | Populus Endosphere | ASQATAGSPTNLPFDAQGNLIDGRSKPRGAGLGVASAYQGPRTVQAQVRFSF* |
| Ga0075370_109335201 | 3300006353 | Populus Endosphere | ASPNDPVTITNLPYDPATGAVVDSRSRPRGAGFGVATGYQAPRSVQALVRFSF* |
| Ga0066659_118883152 | 3300006797 | Soil | ATNLPFDANGNLVVSRSLPRGAGFGVANAYQPARNMQVQVRFSF* |
| Ga0075430_1014155052 | 3300006846 | Populus Rhizosphere | PFDAAGNLIPARSLPRGAGFGVATNYQAARSVQVQIRFSF* |
| Ga0075433_114620711 | 3300006852 | Populus Rhizosphere | DLATGAVIDARSRPRGAGAGVATAYQNPRTVQAQVRVSF* |
| Ga0075420_1001586743 | 3300006853 | Populus Rhizosphere | ASGNVIDARARPNGAGFGVATDYQAPRTLQLQARFSF* |
| Ga0075434_1012220151 | 3300006871 | Populus Rhizosphere | RNATINLSNPNDPVTATNLPFDANGNLIASRSLPRGAGFGVATGYQPPRNMQVQVRFSF* |
| Ga0075434_1012356352 | 3300006871 | Populus Rhizosphere | NTVITNLPFDASGNVIDSRSRPRGAGFGVATVYQDPRTMQLQVRFSF* |
| Ga0075434_1013718182 | 3300006871 | Populus Rhizosphere | TMNLSNPNDPSTITNLPFDANGNVIDSRSRPRGAGFGVATGYQNPRTVQMQIRFSF* |
| Ga0075429_1003636671 | 3300006880 | Populus Rhizosphere | GLHATNLPYDANGNVVAARSLPRGAGFGVATAYQDPRTVQVQVRFSF* |
| Ga0079215_108704872 | 3300006894 | Agricultural Soil | PFDTAGNVVDARSRPRGAGFGVATGYQAARTLQLQARFSF* |
| Ga0079215_110060672 | 3300006894 | Agricultural Soil | PFDAATGAVIDSRSRPRGAGVGVATEYQTPRRIQLQVRFSF* |
| Ga0075426_100832031 | 3300006903 | Populus Rhizosphere | ASGNLIANRSQPKNAGFGVANNYQSPRTLQILLRLGF* |
| Ga0075424_1011492792 | 3300006904 | Populus Rhizosphere | SPLDQTVTNLPFDANGNLVASRSQPKNAGVGVANGYQGPRTVQAQIRFSF* |
| Ga0075424_1023890792 | 3300006904 | Populus Rhizosphere | TITNLPYDANGNALPSLSLPRNAGFGVATAYQTPRAVQVQIRFSF* |
| Ga0079303_103179341 | 3300006930 | Deep Subsurface | ADGTLNASRLIPRNAGFGAVTGTVNPLTMQAQIRFSF* |
| Ga0079219_106807151 | 3300006954 | Agricultural Soil | DAGGNLIPSLSLPRNAGFGVATNYQVPRAVQAQIRVSF* |
| Ga0075419_110522832 | 3300006969 | Populus Rhizosphere | QMASPATNTVITNLPFDASGNVIDSRSRPRGAGFGVATEYQAPRTMQLQVRFSF* |
| Ga0066710_1031103051 | 3300009012 | Grasslands Soil | TVTNLPFDASGNLVASRSQPKNAGVGVANSYQAPRTLQAQIRFSF |
| Ga0066710_1041610711 | 3300009012 | Grasslands Soil | MHDPNDPVTINNLAFDANGALIASRSLPQGAGFGVANNFQSARSIQGQLRLSF |
| Ga0099829_107129621 | 3300009038 | Vadose Zone Soil | VVLVRAIEGLDEVTARNLPFDASGNLISSLSLPRGAGFGVATAYQDPRTMQLQLRFQF* |
| Ga0105046_112355142 | 3300009084 | Freshwater | FDASGVLIPSRSLPKNAGFGLATGYQGPRTLQGQIRFVF* |
| Ga0111539_106824382 | 3300009094 | Populus Rhizosphere | DGSVIPARTVPRGAGFGVATAYQAPRTMQLQIRFMF* |
| Ga0075418_124625202 | 3300009100 | Populus Rhizosphere | LANPNDPVTVTNLPFDAAGNLIESRSRPRGAGFGVANNYQAPRTVQAQFRLSF* |
| Ga0115026_117894311 | 3300009111 | Wetland | DANGNLIESRSQPKNAGFGVANGYQAPRSVQMQIRFSF* |
| Ga0114129_103037434 | 3300009147 | Populus Rhizosphere | LSSPANPIDIQNLPFDANGNLIDSRSRPRGAGFGVATAYQGPRTLQLQARFAF* |
| Ga0111538_116423221 | 3300009156 | Populus Rhizosphere | ANGNLIDSRSRPRGAGFGVATAYQGPRTLQLQARFAF* |
| Ga0111538_134384261 | 3300009156 | Populus Rhizosphere | TAPGTITNLPYDANGNLIPSLSVPRGAGFGVATGYQTPRSTQVQIRFAF* |
| Ga0105248_126108342 | 3300009177 | Switchgrass Rhizosphere | DGTPANLPYDASGATVVSRSLPKNAGFGVANAYQAPRTLQVQIRFSF* |
| Ga0114942_11889191 | 3300009527 | Groundwater | TATNLPFDANGNLIESRSLPRNAGFGVANAYQTPRAMQLQLRFSF* |
| Ga0105340_12433562 | 3300009610 | Soil | MASPATNSVITNLPFDAAGNVIDARSRPRGAGFGVATNYQDPRSMQLQIRVSF* |
| Ga0126313_104926821 | 3300009840 | Serpentine Soil | LTLSSPTDPVTPQNLPFDSSGNLIPARSLPRGAGFGVANAYQSPRTVQVQVRFSF* |
| Ga0126312_106112422 | 3300010041 | Serpentine Soil | DPTALNLPYDANGNVVVSRSLPKNAGFGAASGYQTPRTMQLQFRFSF* |
| Ga0126310_108160701 | 3300010044 | Serpentine Soil | QPTTIQNLPFDATGNLIDTLSRPRGAGFGVATNYQAPRTMQMQLRLSF* |
| Ga0134070_102214631 | 3300010301 | Grasslands Soil | ATNLPYDADGKPVPSRQAPRTAGFGVANTYQAARTIQAQIRFSF* |
| Ga0105239_113863081 | 3300010375 | Corn Rhizosphere | DQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF* |
| Ga0134127_113875841 | 3300010399 | Terrestrial Soil | TDTTTITNLPYDLATGAVIDARSRPRGAGAGVATTYQNPRTVQAQVRISF* |
| Ga0134122_123184501 | 3300010400 | Terrestrial Soil | NLPFDASGNVIDTRSRPRGAGFGVATNYQDPRTMQLQVRFAF* |
| Ga0134121_129055952 | 3300010401 | Terrestrial Soil | VNLPYDASGNIVASRSLPKNAGFGVANAYQAPRTLQAQIRFSF* |
| Ga0134123_122775181 | 3300010403 | Terrestrial Soil | PVDAAGNVIDARSRPSGAGFGVATDYQSPRAIQLQARFAF* |
| Ga0105246_117234512 | 3300011119 | Miscanthus Rhizosphere | PYDANGNVVASRSQPKNAGFGVANAYQTPRQVQLQIRFRF* |
| Ga0137392_110570211 | 3300011269 | Vadose Zone Soil | LSNPNDPVTITNLPYLADGTLIPSRSRPRGAGVGVATDYQSPRRVQLQARVSF* |
| Ga0137463_11351921 | 3300011444 | Soil | PANLPYDASGATVVSRSLPKNAGFGVASTYQAPRTMQVQIRFSF* |
| Ga0137389_112006071 | 3300012096 | Vadose Zone Soil | AFDASGNLIASRSLPKNAGFGVANGYQGPRTLQGQIRFSF* |
| Ga0137389_113997512 | 3300012096 | Vadose Zone Soil | PFDADGNLIATRSLPKNAGFGVANAYQGPRTVQGQIRFSF* |
| Ga0137334_11416741 | 3300012179 | Soil | ITGRNSTIAYTSPADPLTPQNLPYDASGNLIASRSIPRGAGFGVASGYQAARTIQFQVRFSF* |
| Ga0137388_119628711 | 3300012189 | Vadose Zone Soil | DASGNLIPSRSQPKNAGFGVANGYQGPRTLQAQIRFSF* |
| Ga0137374_100178436 | 3300012204 | Vadose Zone Soil | LSNPTDPVTPTNLPYDLKTGEVVANRSLPRNAGFGVANAYQAPRTIQAQVRFSF* |
| Ga0150985_1141120192 | 3300012212 | Avena Fatua Rhizosphere | GNLIESRSRPRGAGFGVATGYQSPRTMQMQVRFSF* |
| Ga0150985_1144491451 | 3300012212 | Avena Fatua Rhizosphere | LTNPSDPVTANNLPYDASGNVIDSRTVPRTAGFGVANAYQNQRTLPAQIRFSF* |
| Ga0137375_114605382 | 3300012360 | Vadose Zone Soil | NDPTTIANLPYDANGNVIDSRSRPRGAGFGVATAYQNPRTVQAQVRFSF* |
| Ga0136612_100621202 | 3300012680 | Polar Desert Sand | VANPSDPKTITNLPFDANGNLIASRSLPRGAGFGVATGYQAPRSIQVQVGFQF* |
| Ga0136614_105057882 | 3300012684 | Polar Desert Sand | DPVTITNLPYLADGTLNPARSRPRGAGVGVATNYQSPRRVQVQARFSF* |
| Ga0157284_101671422 | 3300012893 | Soil | MNTSIGLVNSPSTPNTITNLPYDASGNPIDSRSKPRGAGFGVATAYQTPRAIQLTARFNF |
| Ga0157288_101982341 | 3300012901 | Soil | GSVRPTFALPRGAGFGVATAYQAPRTMQFQIRFSF* |
| Ga0157290_102361832 | 3300012909 | Soil | VSEGANSYCYDANGNMVVTRSLPKNAGFGVANAYQAPRTMQLQLRFAF* |
| Ga0164300_105417631 | 3300012951 | Soil | ATNLPFDASGNVVASRALPRGAGFGVANAYQSPRTIQLQVRFSF* |
| Ga0164302_111991052 | 3300012961 | Soil | GNLIDARSHPRGAGFGVATDYQAPRTMQLQLRISF* |
| Ga0126369_126582191 | 3300012971 | Tropical Forest Soil | PANLPYDASGNTVVARSLPKNAGFCVANTYQNPRTLQVQLRFSF* |
| Ga0164309_115256172 | 3300012984 | Soil | TSPNDPVTITNLPYDANGNLIASRSLPRGAGFGVANAYQNARTVQVQIRFTF* |
| Ga0164309_117312371 | 3300012984 | Soil | ATNLPYNPDGSVNPTRSLPRNAGFGVANAYQSPRTIQMQLRFSF* |
| Ga0164308_103971362 | 3300012985 | Soil | FDASGAPIDSRSLPKNAGFGVANTYQSPRTIQAQIRFSF* |
| Ga0164308_122242741 | 3300012985 | Soil | VTAGNLPYDVNGNVVSSRTVPRTAGFGVANAYQNPLTLQAQIRFSF* |
| Ga0164304_113238431 | 3300012986 | Soil | ITPQNLPYDAAGNLIASRSLPRGAGFGVANNYQNPRNIQFQVRYSF* |
| Ga0164307_116385932 | 3300012987 | Soil | VTAGNLPYDVNGNVVSSRTVPRTAGFGVANAYQNPRTLQAQIRFSF* |
| Ga0157374_101843072 | 3300013296 | Miscanthus Rhizosphere | ERVVTITNLPFDANGNLIDTRSRPRGAGFGVATAYQNPRTVQAQIRFSF* |
| Ga0157375_106077121 | 3300013308 | Miscanthus Rhizosphere | ATPNDPNTIQNLPYDANGALIPSRSLPRGAGFGVANAYQAPRTVQIQVRFSF* |
| Ga0163163_114073182 | 3300014325 | Switchgrass Rhizosphere | YDANGNLVASRSLPKNGGFGVATGFQSPRTLQAQVRFGF* |
| Ga0163163_129048451 | 3300014325 | Switchgrass Rhizosphere | ASGNVIPALSRPRGAGFGVATAYQSPRTMQAQIRFQF* |
| Ga0157380_119710711 | 3300014326 | Switchgrass Rhizosphere | NGNVIDSRSRPRGAGFGVATDYQSPRALQMQIRLSF* |
| Ga0157380_131637201 | 3300014326 | Switchgrass Rhizosphere | NPSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQAPRQVQLQIRFRF* |
| Ga0157377_102090151 | 3300014745 | Miscanthus Rhizosphere | NLPYDANGNLIPSLSLPRNAGFGVATNYQVPRTVQVQIRFSF* |
| Ga0180082_10332631 | 3300014880 | Soil | LPYDAAGNVIPSLSKPRGAGFGVATNYQTPRALQMQIRFSF* |
| Ga0180082_11668761 | 3300014880 | Soil | TTMNLSNPTDPVTITNLPYDASGNLIPSRLRPRDAGFGVANAYISPRTVQAQIRFQF* |
| Ga0167627_10779401 | 3300015196 | Glacier Forefield Soil | TMNLVSPIDQTVTNLPVDASGTLIASRSQPKNAGVGVANAYQGPRTLQAQIRFVF* |
| Ga0132258_109763562 | 3300015371 | Arabidopsis Rhizosphere | VTITNLPFDANGNLIDTRSRPRGAGFGVATTYQNPRTVQAQIRFSF* |
| Ga0132258_124722462 | 3300015371 | Arabidopsis Rhizosphere | ANGNLIDSRSRPRGAGFGVATGYQAPRTLQFQLRFAF* |
| Ga0132256_1013148151 | 3300015372 | Arabidopsis Rhizosphere | IFASPATNTVITNLPYDASGNVVQSFAKPRGAGFGVATAYQSPRTMQAQIRFQF* |
| Ga0132256_1027931332 | 3300015372 | Arabidopsis Rhizosphere | TSPLDGTMVNLPYDATGATVASRSLPKNAGFGVATAYQAPRTLQAQIRFSF* |
| Ga0132257_1011459012 | 3300015373 | Arabidopsis Rhizosphere | QNLPYDQTTGDLIVSRSLPRGAGFGVANNYQNPRSIQMQVRFSF* |
| Ga0132257_1038498701 | 3300015373 | Arabidopsis Rhizosphere | LNNPSDPTTILNLPFDSAGNVVASRSRPRGAGFGVANGYQTPRQTQFTLRFAF* |
| Ga0132255_1010241142 | 3300015374 | Arabidopsis Rhizosphere | VAINAPFDASGNLVDSRSRPRGAGAGVATAYQDPRTMQIQLRFAF* |
| Ga0132255_1017850762 | 3300015374 | Arabidopsis Rhizosphere | ATVSNLPFDAAGNLIASRSQPSNAGFGVANVYQNPRNVQMQIRFVF* |
| Ga0132255_1023906041 | 3300015374 | Arabidopsis Rhizosphere | DANGNLIPSLIVPRSAGFGVATSYQVPRSVQVQIRFSF* |
| Ga0132255_1051965171 | 3300015374 | Arabidopsis Rhizosphere | NLPYDASGNVVTGRSLPKNAGFGVANTYQNPRTVQAQIRFSF* |
| Ga0134069_12745971 | 3300017654 | Grasslands Soil | NSVITNLPYDASGNVVQSFAKPRGAGFGVATAYQSPRTMQAQVRFAF |
| Ga0190266_102322591 | 3300017965 | Soil | QTARNLPFDASGNLIPSLSLPRGAGFGVATAYQDPRTLQIQIRFQF |
| Ga0184624_100744881 | 3300018073 | Groundwater Sediment | TMNLSNPTDPVTITNLPYDASGNLIPSRLRPRDAGFGVANAYISPRTVQAQIRFQF |
| Ga0184624_102708561 | 3300018073 | Groundwater Sediment | EPRNLVTLQNAPFDASGNLIASRSLPRGAGFGVANNYQAPRNIQLQVRFSF |
| Ga0184632_102718792 | 3300018075 | Groundwater Sediment | MPVSPASRADIQNLPFDASGNLRDAFSRPRGAGFGVATNYQAPRTMQGQIRFSF |
| Ga0184632_103565392 | 3300018075 | Groundwater Sediment | LPFDANGNLIDARSRPRGAGFGVATGYQTPRSVQAQVRFSF |
| Ga0184639_106484251 | 3300018082 | Groundwater Sediment | MQLPSPADPLNIQNLPFDANGNVVVARSLPRGAGFGVATNYQAPRTIQGQIRFSF |
| Ga0190272_131261281 | 3300018429 | Soil | TITNLPFDAAGNPIPERLRPSGAGFGVATGARALRSFQGQVRFSF |
| Ga0066655_104432361 | 3300018431 | Grasslands Soil | LPYDANGNLLPNRSLPKNAGFGVANAYQAARSMQAQIRFSF |
| Ga0190270_100594021 | 3300018469 | Soil | MNLSNPTDPVTITNLPYDASANLIPARLRPRDAGFGVANAYISPRTVQAQIRYQF |
| Ga0190270_105991572 | 3300018469 | Soil | TNLPFDAPGNLMDALSRPRGAGFGVANNYQAARSVQAQIRFTF |
| Ga0190274_105020132 | 3300018476 | Soil | LDGTMTNLPYDPVTGATVTSRSQPKNAGFGVATAYQAPRTLQAQIRFSF |
| Ga0190274_125041401 | 3300018476 | Soil | SMTLSSPSDPATISNLPYDASGNLIPSRSLPRGAGFGVATAYQAPRSVQLQVRFSF |
| Ga0190274_139001791 | 3300018476 | Soil | NGNLIPSLSVPRGAGFGVATGYQTPRSTQVQIRFAF |
| Ga0190271_101911542 | 3300018481 | Soil | PSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF |
| Ga0190271_114381381 | 3300018481 | Soil | PVTITNLPFNPDGSLITSRSLPRGAGVGVATDYQNARTIQVQVRFSF |
| Ga0190271_122074412 | 3300018481 | Soil | TTVNFVNPSDPVTATNLPYDANGNLIVSRSLPRGAGFGVANAYQTPRQIQLQIRFRF |
| Ga0190271_132786091 | 3300018481 | Soil | TSRNSSITLSSPNDPVTPQNLPYDAAGNLIDARSRPRGAGFGVATNYQAPRSVQAQVRFS |
| Ga0193589_11820082 | 3300018962 | Soil | NLTSPKDPVRATNLPFDADGNLVATRSFPRAAGFGVATNYQAPQSIQGQIRFSF |
| Ga0173481_108313571 | 3300019356 | Soil | PYDANGNVVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF |
| Ga0173482_102485912 | 3300019361 | Soil | DPVTITNLPYDANGNLITSRTRPRDAGFGVANAYMAPRTVQVQIRYQF |
| Ga0193738_10615071 | 3300020020 | Soil | DAPGNLIPSRSLPRGAGFGVATGYQAPRSVQLQVRFSF |
| Ga0194120_105348401 | 3300020198 | Freshwater Lake | VSPVSQAVTNSPFDASGNLIPSRSQPKNAGLGVATAYQGPRNLQAQIRFVF |
| Ga0210381_102727182 | 3300021078 | Groundwater Sediment | ITNLPYDASGNLIPSRLRPRDAGFGVANAYISPRTVQAQIRFQF |
| Ga0222622_113089361 | 3300022756 | Groundwater Sediment | FNPDGTVIDSRSRPRGAGFGVATGYQAPRTVQAQIRFSF |
| Ga0247795_10921642 | 3300022899 | Soil | GNLIPSLSLPRNAGFGVATNYQVPRTVQVQIRFSF |
| Ga0247794_100366352 | 3300024055 | Soil | FNPDGSVIAARAVPRGAGFGVATAYQAPRTMQLQIRFMF |
| Ga0207680_112113941 | 3300025903 | Switchgrass Rhizosphere | SPLDQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLKAQIRFSF |
| Ga0207684_110552481 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | FDADGNLIDSRSRPRGAGFGVATGYQAPRSVQVQARFSF |
| Ga0207695_110416971 | 3300025913 | Corn Rhizosphere | VSPVDPTAANLPYDASGAVVTSRSLPKNAGFGVANAYQPPRTVQAQIRFSF |
| Ga0207646_104319901 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | NGNLIPSRSRPRNAGFGVADNYQSPRSVQLQIRFRF |
| Ga0207681_100904971 | 3300025923 | Switchgrass Rhizosphere | LASPLDQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF |
| Ga0207681_101358283 | 3300025923 | Switchgrass Rhizosphere | PYDAAGNVIAARATPRGNGFGVATGFQSPRNLQAQIRFSF |
| Ga0207681_111015001 | 3300025923 | Switchgrass Rhizosphere | QTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF |
| Ga0207650_101865422 | 3300025925 | Switchgrass Rhizosphere | GNVIDSRSRPRGAGFGVATGYQNPRTVQAQIRFSF |
| Ga0207659_112215752 | 3300025926 | Miscanthus Rhizosphere | SGNVIDARSRPRGAGFGVATDYQNPRTVQLQLRLAF |
| Ga0207644_101776201 | 3300025931 | Switchgrass Rhizosphere | TLASPTDPVAITNLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF |
| Ga0207690_101669513 | 3300025932 | Corn Rhizosphere | NPVDIQNLPFDANGNLIDSRSRPRGAGFGVATGYQAPRTLQFQLRFAF |
| Ga0207691_101900793 | 3300025940 | Miscanthus Rhizosphere | GNLVASRATPRGNGFGVATAFQTPRTIQAQIRFSF |
| Ga0207691_107293281 | 3300025940 | Miscanthus Rhizosphere | ADGSVIESRSLPRGAGFGVATAYQAPRSMQLQLRFMF |
| Ga0207711_112732071 | 3300025941 | Switchgrass Rhizosphere | YDASGNTIDARSKPRGAGFGVATAYQTPRAIQLTARFNF |
| Ga0207679_110269342 | 3300025945 | Corn Rhizosphere | NLPYDAAGNVIAARATPRGNGFGVATGFQSPRNLQAQIRFSF |
| Ga0207668_109999761 | 3300025972 | Switchgrass Rhizosphere | TTITNLPYDANGNLIDSRSRPRGAGFGVANAYQPPRSIQLQLRYSF |
| Ga0207668_115840062 | 3300025972 | Switchgrass Rhizosphere | LPYDANGNLIDSRSRPRDAGFGVATGYLNPRTVQLQIRFQF |
| Ga0207668_121494491 | 3300025972 | Switchgrass Rhizosphere | NYNNPNDPVTATNLPYDANGNVVASRSQPKNAGFGVANAYQTPRQVQLQIRFRF |
| Ga0207640_101648571 | 3300025981 | Corn Rhizosphere | SPLDQTMTNLPFDANGNVVAARSLPKNAGFGVATAYQAPRTLQAQIRFSF |
| Ga0207677_112165362 | 3300026023 | Miscanthus Rhizosphere | LASPTDPVTITNLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF |
| Ga0207703_112861691 | 3300026035 | Switchgrass Rhizosphere | AATTITNLPYDASGTLIPSLAVPRSAGFGVATNYQVPRTVQAQIRFSF |
| Ga0207639_111954172 | 3300026041 | Corn Rhizosphere | NGNLIDTRSRPRGAGFGVATAYQNPRTVQAQIRFSF |
| Ga0207641_122376332 | 3300026088 | Switchgrass Rhizosphere | MTLASPTDPVAITNLPYDADGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF |
| Ga0207648_109214151 | 3300026089 | Miscanthus Rhizosphere | ETPTVAINAPFDASGNLVDSRSRPRGAGAGVATAYQDPRTMQIQLRFAF |
| Ga0207674_105874351 | 3300026116 | Corn Rhizosphere | ITNLPYDANGNVIDSRSRPRGAGFGVATGYQNPRTVQAQIRFSF |
| Ga0207698_102943961 | 3300026142 | Corn Rhizosphere | NPFDPVTAGNLPYDVHGNVVSSRTVPRTAGFGVANAYQNPRTLQAQIRFSF |
| Ga0209468_10799992 | 3300026306 | Soil | NGNTVVSRSLPKNAGFGVANAYQAPRTLQAQIRFSF |
| Ga0210000_10476682 | 3300027462 | Arabidopsis Thaliana Rhizosphere | LPYDSNGNTVVARSLPKNAGFGVANAYQAPRTMQLQLRFAF |
| Ga0209970_10534822 | 3300027614 | Arabidopsis Thaliana Rhizosphere | MNLTNPNDPVTITNLPYDASGNLIPSRLRPRDAGFGVANAYIAPRTVQAQIRFQF |
| Ga0209387_10177031 | 3300027639 | Agricultural Soil | NPADPTTITNLPFDANGNVIDSRSRPRGAGFGVATGYQAPRNVQVQVRFSF |
| Ga0209060_103848572 | 3300027826 | Surface Soil | NLPYDATGNPIPALSTPRGNGFGVATGFQSPRSVQAQIRFSF |
| Ga0209591_107302451 | 3300027850 | Freshwater | TNLPFDASGVLIPSRSLPKNAGFGLATGYQGPRTLQGQIRFVF |
| Ga0209486_107863381 | 3300027886 | Agricultural Soil | TNLPFDASGNLIDSRSRPRDAGFGVATGYLNPRTVQAQIRFQF |
| Ga0268266_113877162 | 3300028379 | Switchgrass Rhizosphere | PYDANGNVIPARAIPSGAGFGVATVYQNPRTVQALVRFSF |
| Ga0268266_121603312 | 3300028379 | Switchgrass Rhizosphere | FDSSGAVVASRSLPKNAGFGVANTYQAPRTVQAQIRFSF |
| Ga0247819_107341591 | 3300028608 | Soil | ITNLPYDAKGNLIPSLSLPRNAGFGVATNYQVPRTVQVQIRFSF |
| Ga0307503_109480812 | 3300028802 | Soil | AAAATTITNLPYDANGNLIPTLSLPRNAGFGVATNYQVPRSVQFQIRFSF |
| Ga0307296_108242521 | 3300028819 | Soil | SGNVIAARATPAGAGFGVATDYQPPRTIQLQARFSF |
| Ga0299906_113265332 | 3300030606 | Soil | PSAITNLPFDADGNLIESRSRPRGAGFGVADGFQAPRTLQLQARFQF |
| Ga0307506_100145521 | 3300031366 | Soil | DAGGNLIANRSLPRNAGFGVANAYQAPRQVQLQLRFRF |
| Ga0307505_101311581 | 3300031455 | Soil | DAQGNVIESRSRPRGAGFGVATGYQAPRTVQLQARFSF |
| Ga0310888_105001042 | 3300031538 | Soil | QTTANFNNPGDPVTVTNLPYDAEGNLIAARSLPRGAGFGVANAYQAARNIQIQVRFSF |
| Ga0310887_105663311 | 3300031547 | Soil | TNLPFDANGNVVDARARPRGAGFGVATGYQDPRTMQMQLRIAF |
| Ga0310886_102338662 | 3300031562 | Soil | DGSVIESRSLPRGAGFGVATAYQAPRSMQLQLRFMF |
| Ga0310904_104790103 | 3300031854 | Soil | NPSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF |
| Ga0310892_109030892 | 3300031858 | Soil | LPYDAAGNLIPTLSLPRNAGFGVATAYQNPRSVQVQIRFAF |
| Ga0310893_104595002 | 3300031892 | Soil | NTTISFVNPSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF |
| Ga0307406_109455991 | 3300031901 | Rhizosphere | PATGAVVDSRSRPRGAGVGVATTYQAPRSVQALVRFSF |
| Ga0310900_103862242 | 3300031908 | Soil | SPSTITNLPFDAQGNLIDALSKPRGAGFGVANNYQAARSVQVQIRFTF |
| Ga0310901_105355011 | 3300031940 | Soil | DANGNVVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF |
| Ga0308176_118050602 | 3300031996 | Soil | ASPTDPVTITNLPYDANGNLIDSRSRPRGAGFGVATVYQNPRTVQALIRFSF |
| Ga0310903_100932533 | 3300032000 | Soil | MNMASPSTPNTITNLPYDASGNPIDSRSKPRGAGFGVATAYQTPRAIQLTARFNF |
| Ga0307416_1008794111 | 3300032002 | Rhizosphere | NMNLASPDNPSVTNLPFDANGNLIAARSLPRGAGFGVATDYQAPRSVQLQIRFSF |
| Ga0307416_1014656431 | 3300032002 | Rhizosphere | VDIQNLPYDSNGNIIESRSRPRGAGFGVATGYQAPRTLQLQARFAF |
| Ga0310897_101702102 | 3300032003 | Soil | TTATNLPFDANGNVVDARARPRGAGFGVATDYQDPRTMQMQLRISF |
| Ga0310897_104710761 | 3300032003 | Soil | TTATNLPFDANGNVVDARARPRGAGFGVATGYQDPRTMQMQLRIAF |
| Ga0310897_107134971 | 3300032003 | Soil | FVNPSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF |
| Ga0308173_107358491 | 3300032074 | Soil | PTDPVTATNLPYDASGNVVASRSQPKNAGFGVATAYQTPRQVQLQIRFRF |
| Ga0310895_103350081 | 3300032122 | Soil | DPVTVTNLPYDAEGNLIAARSLPRGAGFGVANAYQAARNIQIQVRFSF |
| Ga0310889_100791481 | 3300032179 | Soil | VNPSDPVTATNLPYDANGNLVASRSLPRGAGFGVANAYQTPRQVQLQIRFRF |
| Ga0310810_106351871 | 3300033412 | Soil | LPYDSSGNLIPTLSLPRNAGFGVATAYQNPRSVQVQIRFTF |
| Ga0310810_108924642 | 3300033412 | Soil | AASTITNLPYDANGNLIPTLSLPRNAGFGVATNYQVPRTVQAQIRFSF |
| Ga0316603_118697612 | 3300033413 | Soil | NLPFNADGTVNPNRNLPKNAGFGVASAYQLPRRVQVQVRFSF |
| Ga0316625_1007690121 | 3300033418 | Soil | STITNLPYDANGNVIESRSKPRGAGFGVATAYQTPRSIQLTARFSF |
| Ga0370506_108512_1_141 | 3300034157 | Untreated Peat Soil | ATITNLPFDAAGNLIDSRSRPRGAGFGVATGYQTARSLQLQARLSF |
| ⦗Top⦘ |