Metagenome / Metatranscriptome Family F016311

Overview

Basic Information

• Family ID: F016311
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 248
• Average Sequence Length: 40 residues
• Representative Sequence: MRSFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKN
• Number of Associated Samples: 153
• Number of Associated Scaffolds: 248

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 83.47 %
• % of genes near scaffold ends (potentially truncated): 18.55 %
• % of genes from short scaffolds (< 2000 bps): 86.29 %
• Associated GOLD sequencing projects: 135
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (52.419 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (14.516 % of family members)
• Environment Ontology (ENVO): Unclassified (24.194 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (45.565 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: Yes
• Secondary Structure distribution:
  α-helix: 37.31%
  β-sheet: 13.43%
  Coil/Unstructured: 49.25%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 248 Family Scaffolds
PF05532	CsbD	4.44
PF01925	TauE	4.03
PF00072	Response_reg	4.03
PF01694	Rhomboid	2.82
PF04632	FUSC	2.02
PF00294	PfkB	1.61
PF05239	PRC	1.61
PF07702	UTRA	1.61
PF16998	17kDa_Anti_2	1.61
PF05974	DUF892	1.21
PF00528	BPD_transp_1	1.21
PF00291	PALP	1.21
PF03734	YkuD	0.81
PF02894	GFO_IDH_MocA_C	0.81
PF10137	TIR-like	0.81
PF00296	Bac_luciferase	0.81
PF04226	Transgly_assoc	0.81
PF13430	DUF4112	0.81
PF00005	ABC_tran	0.81
PF12680	SnoaL_2	0.81
PF01965	DJ-1_PfpI	0.40
PF13533	Biotin_lipoyl_2	0.40
PF05589	DUF768	0.40
PF00753	Lactamase_B	0.40
PF01192	RNA_pol_Rpb6	0.40
PF02810	SEC-C	0.40
PF08241	Methyltransf_11	0.40
PF07883	Cupin_2	0.40
PF12974	Phosphonate-bd	0.40
PF03330	DPBB_1	0.40
PF07690	MFS_1	0.40
PF07813	LTXXQ	0.40
PF01266	DAO	0.40
PF01812	5-FTHF_cyc-lig	0.40
PF04545	Sigma70_r4	0.40
PF02769	AIRS_C	0.40
PF03466	LysR_substrate	0.40
PF17200	sCache_2	0.40
PF16184	Cadherin_3	0.40
PF00929	RNase_T	0.40
PF00106	adh_short	0.40
PF00583	Acetyltransf_1	0.40
PF00816	Histone_HNS	0.40
PF15887	Peptidase_Mx	0.40
PF03060	NMO	0.40
PF09976	TPR_21	0.40
PF09084	NMT1	0.40
PF00486	Trans_reg_C	0.40
PF03631	Virul_fac_BrkB	0.40
PF07238	PilZ	0.40
PF13468	Glyoxalase_3	0.40
PF03144	GTP_EFTU_D2	0.40
PF01594	AI-2E_transport	0.40
PF07043	DUF1328	0.40
PF13587	Obsolete Pfam Family	0.40
PF02776	TPP_enzyme_N	0.40
PF14216	DUF4326	0.40

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 248 Family Scaffolds
COG3237	Uncharacterized conserved protein YjbJ, UPF0337 family	Function unknown [S]	4.44
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	4.03
COG0705	Membrane-associated serine protease, rhomboid family	Posttranslational modification, protein turnover, chaperones [O]	2.82
COG1289	Uncharacterized membrane protein YccC	Function unknown [S]	2.02
COG3678	Periplasmic chaperone Spy, Spy/CpxP family	Posttranslational modification, protein turnover, chaperones [O]	1.61
COG3685	Ferritin-like metal-binding protein YciE	Inorganic ion transport and metabolism [P]	1.21
COG0673	Predicted dehydrogenase	General function prediction only [R]	0.81
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.81
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.81
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.81
COG2261	Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family	General function prediction only [R]	0.81
COG1758	DNA-directed RNA polymerase, subunit K/omega	Transcription [K]	0.40
COG5487	Uncharacterized membrane protein YtjA, UPF0391 family	Function unknown [S]	0.40
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.40
COG2916	DNA-binding protein H-NS	Transcription [K]	0.40
COG2070	NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family	General function prediction only [R]	0.40
COG0212	5-formyltetrahydrofolate cyclo-ligase	Coenzyme transport and metabolism [H]	0.40
COG1295	Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)	Function unknown [S]	0.40
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.40
COG0628	Predicted PurR-regulated permease PerM	General function prediction only [R]	0.40
COG0516	IMP dehydrogenase/GMP reductase	Nucleotide transport and metabolism [F]	0.40

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	52.82 %
Unclassified	root	N/A	47.18 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	52.82 %
Unclassified	root	N/A	47.18 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	52.42 %
Unclassified	root	N/A	47.18 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.40 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	37.50 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.81 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.81 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.40 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.40 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.40 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	28.23 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.40 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.40 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.40 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.40 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.40 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	14.92 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	5.24 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.81 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.40 %
unclassified Planctomycetota	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota	0.40 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	0.40 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %
Moraxellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales	0.40 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.40 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	5.24 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.40 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Moraxellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae	0.40 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.40 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.40 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	3.23 %
Methyloceanibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter	1.21 %
unclassified Hyphomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae	0.40 %
Conexibacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Amaricoccus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Acinetobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter	0.40 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.40 %
Rhodoblastus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus	0.40 %
Ramlibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Acinetobacter calcoaceticus/baumannii complex	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
unclassified Rhodoblastus	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus	0.40 %
unclassified Hyphomicrobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	47.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.24 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1.21 %
Hyphomicrobium zavarzinii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	0.81 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	0.40 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.40 %
Rhodoblastus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	0.40 %
Acinetobacter baumannii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	0.40 %
Ramlibacter aquaticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	0.40 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.40 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	0.40 %
Amaricoccus macauensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	0.40 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.40 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.40 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.40 %
Acidobacteria bacterium 13_1_40CM_2_68_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	0.40 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2124908007|FWIRElOz_GKZ9IRQ01BYVET	Not Available	514
2124908045|KansclcFeb2_ConsensusfromContig164598	Not Available	720
2199352025|deepsgr__Contig_115374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	897
2228664022|INPgaii200_c0766495	Not Available	716
3300000033|ICChiseqgaiiDRAFT_c2344699	All Organisms → cellular organisms → Bacteria	713
3300000033|ICChiseqgaiiDRAFT_c2346208	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus	833
3300000363|ICChiseqgaiiFebDRAFT_14452968	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	691
3300000364|INPhiseqgaiiFebDRAFT_100740804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1411
3300000364|INPhiseqgaiiFebDRAFT_101447112	All Organisms → cellular organisms → Bacteria	1359
3300000364|INPhiseqgaiiFebDRAFT_101980631	All Organisms → cellular organisms → Bacteria	1642
3300000364|INPhiseqgaiiFebDRAFT_101997194	All Organisms → cellular organisms → Bacteria → Proteobacteria	2028
3300000364|INPhiseqgaiiFebDRAFT_105632595	All Organisms → cellular organisms → Bacteria	2571
3300000550|F24TB_13055513	Not Available	506
3300000559|F14TC_102931290	Not Available	1586
3300000559|F14TC_104888496	Not Available	1359
3300000955|JGI1027J12803_101205658	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5	938
3300000955|JGI1027J12803_106712902	All Organisms → cellular organisms → Bacteria → Proteobacteria	1374
3300000956|JGI10216J12902_101927244	All Organisms → cellular organisms → Bacteria	8888
3300000956|JGI10216J12902_101988697	Not Available	876
3300000956|JGI10216J12902_107828215	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	699
3300002568|C688J35102_120415973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1052
3300003324|soilH2_10115140	All Organisms → cellular organisms → Bacteria → Proteobacteria	1058
3300003659|JGI25404J52841_10040687	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	984
3300004114|Ga0062593_100458211	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1165
3300004114|Ga0062593_100494337	Not Available	1131
3300004114|Ga0062593_100745681	All Organisms → cellular organisms → Bacteria → Proteobacteria	964
3300004463|Ga0063356_100188579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2413
3300004463|Ga0063356_104011320	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	634
3300004463|Ga0063356_106044258	Not Available	519
3300004463|Ga0063356_106238250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	511
3300004479|Ga0062595_102090483	Not Available	550
3300004633|Ga0066395_10013580	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3080
3300004633|Ga0066395_10412729	Not Available	763
3300005045|Ga0071328_109299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	4369
3300005093|Ga0062594_100050567	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2122
3300005332|Ga0066388_100035514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	4803
3300005332|Ga0066388_100056070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4114
3300005332|Ga0066388_100918671	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1451
3300005332|Ga0066388_101382178	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1221
3300005332|Ga0066388_101422594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	1206
3300005332|Ga0066388_102350616	Not Available	966
3300005332|Ga0066388_102407458	All Organisms → cellular organisms → Bacteria → Proteobacteria	955
3300005332|Ga0066388_103008564	Not Available	861
3300005332|Ga0066388_103770068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	773
3300005332|Ga0066388_107456549	Not Available	549
3300005332|Ga0066388_107804627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	536
3300005347|Ga0070668_101240779	All Organisms → cellular organisms → Bacteria → Proteobacteria	676
3300005434|Ga0070709_10233372	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	1317
3300005435|Ga0070714_100739039	Not Available	951
3300005441|Ga0070700_100314617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1148
3300005441|Ga0070700_100685231	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	813
3300005441|Ga0070700_101357759	All Organisms → cellular organisms → Bacteria	599
3300005441|Ga0070700_101871658	Not Available	518
3300005547|Ga0070693_101131235	Not Available	598
3300005548|Ga0070665_101084929	All Organisms → cellular organisms → Bacteria	812
3300005566|Ga0066693_10345085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	599
3300005577|Ga0068857_101968939	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	573
3300005578|Ga0068854_101530556	All Organisms → cellular organisms → Bacteria	606
3300005617|Ga0068859_102487227	All Organisms → cellular organisms → Bacteria	570
3300005618|Ga0068864_101514501	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	674
3300005713|Ga0066905_100101466	All Organisms → cellular organisms → Bacteria → Proteobacteria	1955
3300005713|Ga0066905_100167486	All Organisms → cellular organisms → Bacteria	1605
3300005713|Ga0066905_100196903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1502
3300005713|Ga0066905_100390717	All Organisms → cellular organisms → Bacteria → Proteobacteria	1125
3300005713|Ga0066905_101631544	All Organisms → cellular organisms → Bacteria	591
3300005713|Ga0066905_102168744	Not Available	518
3300005719|Ga0068861_100029469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4016
3300005719|Ga0068861_100610276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1003
3300005764|Ga0066903_100672203	All Organisms → cellular organisms → Bacteria → Proteobacteria	1817
3300005764|Ga0066903_101176716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1421
3300005764|Ga0066903_101275801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1370
3300005764|Ga0066903_103315008	Not Available	870
3300005764|Ga0066903_105441021	Not Available	672
3300005764|Ga0066903_106803075	Not Available	594
3300005841|Ga0068863_100144884	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2271
3300005842|Ga0068858_101247127	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	731
3300005937|Ga0081455_10000282	All Organisms → cellular organisms → Bacteria	67197
3300005983|Ga0081540_1000611	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	34020
3300006046|Ga0066652_101914999	Not Available	531
3300006049|Ga0075417_10490764	Not Available	616
3300006173|Ga0070716_101170031	Not Available	616
3300006175|Ga0070712_100531481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	989
3300006194|Ga0075427_10109801	Not Available	519
3300006196|Ga0075422_10107248	All Organisms → cellular organisms → Bacteria → Proteobacteria	1078
3300006844|Ga0075428_100087437	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	3400
3300006844|Ga0075428_100241047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1951
3300006844|Ga0075428_100403767	All Organisms → cellular organisms → Bacteria → Proteobacteria	1464
3300006844|Ga0075428_102723352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii	504
3300006845|Ga0075421_100980498	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	958
3300006845|Ga0075421_101461859	Not Available	749
3300006852|Ga0075433_10044339	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3863
3300006852|Ga0075433_10319459	Not Available	1374
3300006852|Ga0075433_10851190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	796
3300006953|Ga0074063_11350377	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	515
3300006969|Ga0075419_10082456	All Organisms → cellular organisms → Bacteria	2049
3300007076|Ga0075435_100129520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2111
3300007281|Ga0104349_1046939	All Organisms → cellular organisms → Bacteria → Proteobacteria	2277
3300007788|Ga0099795_10288030	Not Available	719
3300009094|Ga0111539_10048283	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5083
3300009094|Ga0111539_10279104	All Organisms → cellular organisms → Bacteria	1944
3300009094|Ga0111539_10547246	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1348
3300009094|Ga0111539_11022338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	961
3300009094|Ga0111539_11533969	Not Available	773
3300009094|Ga0111539_12034219	Not Available	666
3300009094|Ga0111539_12101016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	655
3300009094|Ga0111539_13227830	Not Available	525
3300009100|Ga0075418_10069136	All Organisms → cellular organisms → Bacteria	3764
3300009100|Ga0075418_10118330	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2815
3300009100|Ga0075418_10326618	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii	1637
3300009100|Ga0075418_10421373	All Organisms → cellular organisms → Bacteria → Proteobacteria	1429
3300009146|Ga0105091_10019151	All Organisms → cellular organisms → Bacteria	2923
3300009146|Ga0105091_10445899	Not Available	650
3300009146|Ga0105091_10654366	Not Available	547
3300009147|Ga0114129_10522774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1547
3300009148|Ga0105243_10371712	All Organisms → cellular organisms → Bacteria → Proteobacteria	1319
3300009148|Ga0105243_12692454	All Organisms → cellular organisms → Bacteria	537
3300009156|Ga0111538_12465808	Not Available	653
3300009157|Ga0105092_10443348	Not Available	741
3300009162|Ga0075423_10292659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1706
3300009174|Ga0105241_10593166	Not Available	1000
3300009551|Ga0105238_12826641	Not Available	522
3300009553|Ga0105249_10232098	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1820
3300009792|Ga0126374_10657878	Not Available	782
3300009792|Ga0126374_11638179	Not Available	533
3300010046|Ga0126384_10111285	Not Available	2042
3300010046|Ga0126384_10170569	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	1695
3300010047|Ga0126382_10501262	Not Available	976
3300010047|Ga0126382_11279651	Not Available	662
3300010154|Ga0127503_10086846	Not Available	717
3300010358|Ga0126370_10094438	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2050
3300010359|Ga0126376_10751741	Not Available	945
3300010359|Ga0126376_11701510	Not Available	666
3300010362|Ga0126377_10002235	All Organisms → cellular organisms → Bacteria → Proteobacteria	13214
3300010362|Ga0126377_10695898	Not Available	1069
3300010362|Ga0126377_10744310	All Organisms → cellular organisms → Bacteria	1036
3300010371|Ga0134125_13009603	Not Available	511
3300010397|Ga0134124_10682626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1015
3300010398|Ga0126383_10592556	Not Available	1179
3300010398|Ga0126383_10935027	Not Available	954
3300010398|Ga0126383_12701663	Not Available	579
3300010399|Ga0134127_11763114	All Organisms → cellular organisms → Bacteria	695
3300010400|Ga0134122_10001693	All Organisms → cellular organisms → Bacteria	16016
3300010401|Ga0134121_12085349	Not Available	601
3300010401|Ga0134121_13003035	Not Available	519
3300012206|Ga0137380_10833733	Not Available	795
3300012212|Ga0150985_110124441	Not Available	576
3300012469|Ga0150984_123647430	Not Available	595
3300012668|Ga0157216_10458029	Not Available	554
3300012685|Ga0137397_10087257	Not Available	2274
3300012908|Ga0157286_10380054	Not Available	542
3300012911|Ga0157301_10135035	All Organisms → cellular organisms → Bacteria → Acidobacteria	768
3300012922|Ga0137394_10222540	Not Available	1613
3300012929|Ga0137404_11580040	All Organisms → cellular organisms → Bacteria	608
3300012955|Ga0164298_11290347	All Organisms → cellular organisms → Bacteria	558
3300012955|Ga0164298_11424684	Not Available	537
3300012955|Ga0164298_11636219	Not Available	508
3300012960|Ga0164301_10973344	Not Available	665
3300013297|Ga0157378_10510094	Not Available	1203
3300014326|Ga0157380_10908257	All Organisms → cellular organisms → Bacteria	907
3300014968|Ga0157379_10538743	All Organisms → cellular organisms → Bacteria → Proteobacteria	1085
3300015077|Ga0173483_10562744	Not Available	620
3300015084|Ga0167654_1024524	All Organisms → cellular organisms → Bacteria	957
3300015170|Ga0120098_1061286	Not Available	548
3300015371|Ga0132258_10133839	All Organisms → cellular organisms → Bacteria → Proteobacteria	5917
3300015371|Ga0132258_10355903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3621
3300015371|Ga0132258_11441300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1739
3300015371|Ga0132258_12008431	All Organisms → cellular organisms → Bacteria	1455
3300015372|Ga0132256_101065653	Not Available	923
3300015374|Ga0132255_105719974	Not Available	526
3300016341|Ga0182035_11338694	Not Available	642
3300016371|Ga0182034_11314829	Not Available	631
3300017930|Ga0187825_10106716	All Organisms → cellular organisms → Bacteria → Proteobacteria	972
3300017944|Ga0187786_10630817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	507
3300017947|Ga0187785_10293490	Not Available	745
3300018027|Ga0184605_10526548	Not Available	512
3300018053|Ga0184626_10057950	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1626
3300018075|Ga0184632_10294653	Not Available	703
3300018422|Ga0190265_10400917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1470
3300018422|Ga0190265_10905274	Not Available	1005
3300018422|Ga0190265_11057144	Not Available	933
3300018422|Ga0190265_12230775	Not Available	650
3300018422|Ga0190265_12845153	Not Available	578
3300018429|Ga0190272_10109219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1801
3300018429|Ga0190272_10421297	Not Available	1099
3300018429|Ga0190272_10575767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	980
3300018429|Ga0190272_10601526	Not Available	964
3300018429|Ga0190272_10878442	Not Available	838
3300018429|Ga0190272_11163003	Not Available	754
3300018466|Ga0190268_11267952	Not Available	618
3300018469|Ga0190270_10474462	Not Available	1184
3300018469|Ga0190270_12336811	Not Available	596
3300018469|Ga0190270_12944349	All Organisms → cellular organisms → Bacteria	538
3300018469|Ga0190270_13031924	All Organisms → cellular organisms → Bacteria → Proteobacteria	531
3300018469|Ga0190270_13214320	Not Available	518
3300018476|Ga0190274_10970819	Not Available	922
3300018482|Ga0066669_11119379	Not Available	710
3300019259|Ga0184646_1217883	Not Available	523
3300019269|Ga0184644_1303855	Not Available	540
3300019362|Ga0173479_10572890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	585
3300019884|Ga0193741_1145149	Not Available	589
3300019886|Ga0193727_1192445	Not Available	516
3300020170|Ga0179594_10042746	Not Available	1502
3300020581|Ga0210399_10549037	Not Available	958
3300021078|Ga0210381_10113066	Not Available	893
3300021082|Ga0210380_10016883	All Organisms → cellular organisms → Bacteria → Proteobacteria	3078
3300021478|Ga0210402_10413065	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1253
3300021560|Ga0126371_12070233	Not Available	685
3300021560|Ga0126371_13501004	Not Available	530
3300022214|Ga0224505_10142217	All Organisms → cellular organisms → Bacteria	929
3300024288|Ga0179589_10104138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1163
3300025935|Ga0207709_11293164	Not Available	602
3300025939|Ga0207665_10621966	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	844
3300026035|Ga0207703_11094024	Not Available	766
3300026118|Ga0207675_101259746	Not Available	760
3300026118|Ga0207675_101528442	Not Available	688
3300026121|Ga0207683_11434600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	638
3300027675|Ga0209077_1126134	Not Available	713
3300027866|Ga0209813_10070156	Not Available	1137
3300027866|Ga0209813_10187248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	760
3300027873|Ga0209814_10566714	Not Available	505
3300027874|Ga0209465_10129765	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1246
3300027880|Ga0209481_10188479	Not Available	1028
3300027907|Ga0207428_10040062	All Organisms → cellular organisms → Bacteria	3803
3300027909|Ga0209382_10009995	All Organisms → cellular organisms → Bacteria	11865
3300027909|Ga0209382_10091497	All Organisms → cellular organisms → Bacteria	3573
3300027909|Ga0209382_10124670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3002
3300027909|Ga0209382_10323636	All Organisms → cellular organisms → Bacteria	1734
3300027961|Ga0209853_1104076	Not Available	717
3300028047|Ga0209526_10847666	Not Available	561
3300028381|Ga0268264_11672359	Not Available	647
3300028381|Ga0268264_12295991	Not Available	546
3300028809|Ga0247824_10585848	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp.	668
3300028814|Ga0307302_10325026	Not Available	758
3300028889|Ga0247827_11192768	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	527
3300031039|Ga0102760_10343949	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	808
3300031058|Ga0308189_10530084	Not Available	511
3300031152|Ga0307501_10156748	Not Available	623
3300031184|Ga0307499_10053072	Not Available	999
3300031184|Ga0307499_10115497	Not Available	752
3300031184|Ga0307499_10332259	Not Available	510
3300031455|Ga0307505_10190064	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	945
3300031546|Ga0318538_10470313	Not Available	681
3300031740|Ga0307468_100228970	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis	1286
3300031740|Ga0307468_100406247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1042
3300032094|Ga0318540_10524651	Not Available	571
3300032174|Ga0307470_11849123	Not Available	512
3300032205|Ga0307472_100494711	Not Available	1052
3300032261|Ga0306920_100696263	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1498

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	68.15%
Host-Associated	Host-Associated	31.45%
Engineered	Engineered	0.40%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	62.10%
Plants	Host-Associated → Plants	31.45%
Aquatic	Environmental → Aquatic	6.05%
Wastewater	Engineered → Wastewater	0.40%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	62.10%
Rhizosphere	Host-Associated → Plants → Rhizosphere	19.76%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.89%
Freshwater	Environmental → Aquatic → Freshwater	4.44%
Sediment	Environmental → Aquatic → Sediment	1.21%
Roots	Host-Associated → Plants → Roots	0.81%
Marine	Environmental → Aquatic → Marine	0.40%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.40%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	43.95%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	18.15%
Loam	Environmental → Terrestrial → Soil → Loam	16.53%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.06%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.63%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.42%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.61%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.21%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.81%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.81%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.40%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.40%
Sediment	Environmental → Aquatic → Marine → Sediment	0.40%
Sand	Environmental → Terrestrial → Soil → Sand	0.40%
Fossil	Environmental → Terrestrial → Soil → Fossil	0.40%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.40%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.40%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	28.23%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	18.15%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	10.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.06%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.26%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.84%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.03%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.63%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.42%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.42%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.61%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.21%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.81%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.81%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.81%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.40%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.40%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.40%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.40%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.40%
Unclassified	Environmental → Terrestrial → Soil → Fossil → Unclassified	0.40%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.40%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.40%

Habitat

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	14.52%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	14.11%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	10.48%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	6.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.44%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.63%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.82%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.42%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	2.02%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.02%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.02%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.02%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.61%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.61%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.61%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.61%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.21%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.21%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.21%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.21%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.21%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.81%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.81%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.81%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.40%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.40%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.40%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.40%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.40%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.40%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.40%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.40%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.40%
Fossill	Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill	0.40%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.40%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.40%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.40%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.40%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.40%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.40%
Aeration Tank Of Activated Sludge Process	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process	0.40%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2124908007	Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2	Environmental
2124908045	Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011	Environmental
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental
2228664022	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental
3300003324	Sugarcane bulk soil Sample H2	Environmental
3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental
3300005045	Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA	Environmental
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental
3300006194	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Host-Associated
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated
3300007281	Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 2ppm of oxygen, sample B	Engineered
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental
3300010154	Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)	Environmental
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012668	Arctic soils microbial communities. Combined Assembly of 23 SPs	Environmental
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental
3300012911	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2	Environmental
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental
3300015084	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine)	Environmental
3300015170	Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015372	Soil combined assembly	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental
3300019259	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)	Environmental
3300019269	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)	Environmental
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental
3300019884	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2	Environmental
3300019886	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2	Environmental
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental
3300021078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo	Environmental
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300022214	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1	Environmental
3300024288	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal	Environmental
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated
3300027675	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)	Environmental
3300027866	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)	Host-Associated
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated
3300027961	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)	Environmental
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300028809	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48	Environmental
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental
3300028889	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2	Environmental
3300031039	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome)	Environmental
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental
3300031184	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S	Environmental
3300031455	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S	Environmental
3300031546	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23	Environmental
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental
3300032094	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25	Environmental
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FWIRElOz_06816360	2124908007	Soil	LKSFVIGALIAAVVVLGYLYWDSRNNTIFKAPGIEIKKN
KansclcFeb2_09405410	2124908045	Soil	MDGKSLLIGVLLVGMGVLGYLYWDSQHNTVVKLPGVEIKKN
deepsgr_01823270	2199352025	Soil	MRSFVIGALVVAVGVLGYLYWDSRQNTLVKLPGVEIKKN
INPgaii200_07664952	2228664022	Soil	MRGFVIGALVVAVGVLGYLYWDAHNNTVFKAPGVEIKKN
ICChiseqgaiiDRAFT_23446992	3300000033	Soil	IGVLVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS*
ICChiseqgaiiDRAFT_23462081	3300000033	Soil	MRSFXIGVLVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS*
ICChiseqgaiiFebDRAFT_144529682	3300000363	Soil	MRSFFIGVLVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS*
INPhiseqgaiiFebDRAFT_1007408041	3300000364	Soil	MLIGALIIAVAVLGYLYWDSQNNTIVKVPGVTIKKN*
INPhiseqgaiiFebDRAFT_1014471122	3300000364	Soil	MDTRSMLIGILVVAVAVVGYLYWDSQHNTVLKVPGVEIKKN*
INPhiseqgaiiFebDRAFT_1019806314	3300000364	Soil	MRSFVIGALVVAVGVLGYLYWDSQQNTLVKLPGVEIKKN*
INPhiseqgaiiFebDRAFT_1019971945	3300000364	Soil	MRSFVIGALVIGVGVLGYLYWDAHQNTVFKAPGVEINKN*
INPhiseqgaiiFebDRAFT_1056325952	3300000364	Soil	MRGXMIAALLGAVIVLGYLYWDSTQNTVFKAPGVEIKRS*
F24TB_130555133	3300000550	Soil	LMEVEMRSFIIGALVIAVGVLGYLYWDSEHNTLFKAPGIEIKK*
F14TC_1029312903	3300000559	Soil	MEVEMRSFIIGALVIAVGVLGYLYWDSEHNTLFKAPGIEIKK*
F14TC_1048884965	3300000559	Soil	LKSFAIGALIVAVVVLGYLYWDSRTNTVFKAPGIEIKK
JGI1027J12803_1012056581	3300000955	Soil	RHTEEEARMRGFVIGALVVAVGVLGYLYWDAHNNTVFKAPGVEIKKN*
JGI1027J12803_1067129024	3300000955	Soil	RGLMIAALLGAVIVLGYLYWDSTQNTVFKAPGVEIKRS*
JGI10216J12902_1019272448	3300000956	Soil	MNAKSMLIGALVVAVAVLGYLYWDSQQNTVVKLPGVTIKKN*
JGI10216J12902_1019886972	3300000956	Soil	MDGRSLLVGALLVGVIVLGYLYWDSQHNTVFKAPGVEIKKN*
JGI10216J12902_1078282151	3300000956	Soil	MDGKSLLIGMLAIVAAVLGYLYWDSQYNTVLKAPGVTIKKN*
C688J35102_1204159732	3300002568	Soil	VPAVCLPVIGALVAAVAVLGYLYWDSQHNTIFKAPGIDIKKN*
soilH2_101151402	3300003324	Sugarcane Root And Bulk Soil	MKSFVIGALVIAVAVLGFLYWDSEQNTLVKAPGIEIKKN*
JGI25404J52841_100406871	3300003659	Tabebuia Heterophylla Rhizosphere	MVTXPMEEEMRSFIIGALFVAVAVLGYLYWDSEHNTVFKAPGIEIKK*
Ga0062593_1004582114	3300004114	Soil	MDGKSLLIGVLLVGMGVLGYLYWDSQHNTVVKLPGVEIKKN*
Ga0062593_1004943372	3300004114	Soil	MDGKSVVIGALLIGVAVPGYLYWDSQHNTVVKLPGVEIKKN*
Ga0062593_1007456812	3300004114	Soil	MRSFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS*
Ga0063356_1001885793	3300004463	Arabidopsis Thaliana Rhizosphere	MDGKSLMIGALLVAVVVLGYLYWDSTHNTVFKAPGVEIRAK*
Ga0063356_1040113202	3300004463	Arabidopsis Thaliana Rhizosphere	MRGFVIGALAVAVAVLGYLYWDSQHNTIVKVPGVEIKKN*
Ga0063356_1060442582	3300004463	Arabidopsis Thaliana Rhizosphere	MDGKSLVIGALLIGVVVLGYMVWDSRENTVVKLPGVEIKKN*
Ga0063356_1062382501	3300004463	Arabidopsis Thaliana Rhizosphere	MDGRSMLIGILLVAVVVLGYLYWDRENNTLFKAPGVEIRKN*
Ga0062595_1020904832	3300004479	Soil	MDGRSLLVGALLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN*
Ga0066395_100135802	3300004633	Tropical Forest Soil	MRGLMIGALLIAVIVLGYLYWDSTQNTVFKAPGVEIKKS*
Ga0066395_104127291	3300004633	Tropical Forest Soil	MDGKSLVIGALLIGIVVLGYLYWDSQQNTVFKASGVAIKKN*
Ga0071328_1092994	3300005045	Permafrost	MDGKSLLIGALIVGMGVLGYMYWDSQHNTVVKLPGVEIKKN*
Ga0062594_1000505674	3300005093	Soil	MDGKSVVIGALLIGVAVLGYLYWDSQHNTVVKLPGVEIKKN*
Ga0066388_1000355143	3300005332	Tropical Forest Soil	MKSFVIGALVVAVGVLGYLIRDSRENTVLKAPGVEIKKN*
Ga0066388_1000560703	3300005332	Tropical Forest Soil	MRSFVIGALVVAVGVLGYLYWDSEHNTVFKAPGVEIKNK*
Ga0066388_1009186712	3300005332	Tropical Forest Soil	MRGFVVGALVVAVAVLGYMYWDSEHNTLFRAPGVEIKKN*
Ga0066388_1013821782	3300005332	Tropical Forest Soil	MRGLMIAVLLVAVIVLGYLYWDSTQNTVFKAPGVEIKKS*
Ga0066388_1014225942	3300005332	Tropical Forest Soil	MDGKSLLIGALVIGIGVLGYLYWDSHENTVFKVPGVEIKKE*
Ga0066388_1023506162	3300005332	Tropical Forest Soil	MRGFIIGVLVIGAGVLGYLYWDSQHNTVFKAPGVEIKKN*
Ga0066388_1024074582	3300005332	Tropical Forest Soil	MRSFIIGVLVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS*
Ga0066388_1030085642	3300005332	Tropical Forest Soil	MRSFIIGVLVIAVGVLGYLYWDSEHNTLFKAPGVEIKKS*
Ga0066388_1037700682	3300005332	Tropical Forest Soil	MDGKSLLIGALVIGIGVLGYLYWDSHENTVFKAPGVEIKKE*
Ga0066388_1074565491	3300005332	Tropical Forest Soil	MDGKSVVIGALLIGVAVRGYLYWDSQHNTVVKLPGVEIKKN*
Ga0066388_1078046271	3300005332	Tropical Forest Soil	LKSVVIGALVAAVVILGYLYWDSRTNTVFKAPGIEIKKN*
Ga0070668_1012407791	3300005347	Switchgrass Rhizosphere	EATMKSFVIGALVVAVGVLGYLYWDSHENTLVKVPGVEIKKN*
Ga0070709_102333722	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MRSFVIGALVIGVGVLGYLYWDAHQNTVFKAPGVEIKKN*
Ga0070714_1007390392	3300005435	Agricultural Soil	MRGLMIAALLGAVIVLGYLYWDSTQNTVFKAPGVEIKRS*
Ga0070700_1003146171	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MDGRSLLVGILLVGVAVLGYLYWDSQHNTVFKAPGVEIKKS*
Ga0070700_1006852313	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MRSFLIGALFIAVGVLGYLYWDSEHNTVFKAPGIEIKNK*
Ga0070700_1013577591	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MRGFVIGALVVAVGVLGYLYWDAEHNTVFKAPGVEIKKN*
Ga0070700_1018716581	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MRGFVIGALVVAVGVLGYMYWDSEHNTLVKAPGVEIKKN*
Ga0070693_1011312351	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	DVERQLKEVTMRSFIIGALAVGALGSSYGDGEHDTVCKALGIEIKKC*
Ga0070665_1010849292	3300005548	Switchgrass Rhizosphere	MLRRSKEVNMRGFVIGALVVAVGVLGYLYWDAEHNTVFKAPGVEIKKN*
Ga0066693_103450851	3300005566	Soil	MRSFVIGALVVAVGVLGYLYWDSQQNTLVKLPGVE
Ga0068857_1019689392	3300005577	Corn Rhizosphere	MRSFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVE
Ga0068854_1015305562	3300005578	Corn Rhizosphere	DGDPIGKEPQMRSFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS*
Ga0068859_1024872272	3300005617	Switchgrass Rhizosphere	RSKEVNMRGFVIGALVVAVGVLGYLYWDAEHNTVFKAPGVEIKKN*
Ga0068864_1015145011	3300005618	Switchgrass Rhizosphere	MDGRSLLIGALVIGVAVLGYLYWDSHENTVVKLPG
Ga0066905_1001014662	3300005713	Tropical Forest Soil	MRSFLIGALFVAVGVLGYLYWDSEHNTVVKAPGIEIKK*
Ga0066905_1001674862	3300005713	Tropical Forest Soil	MRGFIIGVLLAAVGLLGYLYWDSQHNTVFKAPGVEIKKN*
Ga0066905_1001969032	3300005713	Tropical Forest Soil	MRSFVIGALIVAVGVLGYLYWDSEHNTVFKAPGVEIKNK*
Ga0066905_1003907172	3300005713	Tropical Forest Soil	MRSFIIGALFIAVGVLGYLYWDSEHNTVFKAPGIEIKNK*
Ga0066905_1016315441	3300005713	Tropical Forest Soil	MRSFIIGVLVVAVGVLGYLYWDSQHNTVFKASGVEIKKS*
Ga0066905_1021687443	3300005713	Tropical Forest Soil	VRGFIIGVLVIAVGVLGYLYWDSEHNTVLKAPGVEIKKN*
Ga0068861_1000294695	3300005719	Switchgrass Rhizosphere	MDGRSMLIGILLVTVLVLGYLYWDREHNTVLKAPGVEIRKN*
Ga0068861_1006102762	3300005719	Switchgrass Rhizosphere	MDGRSLLVGILLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN*
Ga0066903_1006722034	3300005764	Tropical Forest Soil	MDGKSLIIGVLLIGIVVLGYLYWDSQQNTVFKAPGVEIKKN*
Ga0066903_1011767161	3300005764	Tropical Forest Soil	MIAVLLVAVIVLGYLYWDSTQNTVFKAPGVEIKKS*
Ga0066903_1012758014	3300005764	Tropical Forest Soil	MKSFVIGALVVAVGVLGICIRDSRENTVLKAPGVEIKKN*
Ga0066903_1033150083	3300005764	Tropical Forest Soil	MRGFIIGVLVVVVGVLGYLYWDSEHNTLFKAPGVEIKKN*
Ga0066903_1054410212	3300005764	Tropical Forest Soil	MRGFIIGALLVTVRVLGYLSWDGEHNTLIKAPGVEIKRN*
Ga0066903_1068030751	3300005764	Tropical Forest Soil	FIIGVLVVVIGVLGYLYWDSEHNTLFKAPGVEIKKN*
Ga0068863_1001448843	3300005841	Switchgrass Rhizosphere	LKSILIGALIAAVAVLGYLYWDSRNNTIFRAPGIEIKKD*
Ga0068858_1012471272	3300005842	Switchgrass Rhizosphere	DGRSMLIGILLVTVLVLGYLYWDREHNTVLKAPGVEIRKN*
Ga0081455_1000028239	3300005937	Tabebuia Heterophylla Rhizosphere	MRGFIIGVLLVAVGVLGYLYWDSEHNTVLKAPGVEIKKN*
Ga0081540_100061130	3300005983	Tabebuia Heterophylla Rhizosphere	MVTEPMEEEMRSFIIGALFVAVAVLGYLYWDSEHNTVFKAPGIEIKK*
Ga0066652_1019149992	3300006046	Soil	MNGKSILIGALIIAVAVLGYLYWDSQNNTIVKVPGVTIKKN*
Ga0075417_104907641	3300006049	Populus Rhizosphere	MRSFIIGALVIAVGVLGYLYWDSEHNTLFKAPGIEIKNK*
Ga0070716_1011700312	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MKSFVMGALIIAVGVLGYLYWDSQYNTVLKAPGVEIKKN*
Ga0070712_1005314812	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	LKSVVIGALLVAVVILGYLYWDSRTNTVFKAPGIEIKKN*
Ga0075427_101098011	3300006194	Populus Rhizosphere	MRSFIIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIKKS*
Ga0075422_101072482	3300006196	Populus Rhizosphere	MDGRSLLIGALLVGIAVLGFLYWDTEHNTLFKAPGVEIKKN*
Ga0075428_1000874374	3300006844	Populus Rhizosphere	MDGKSMLIGALIIGVAVLGYLYWDSQHNTVLQVPGVTIKKN*
Ga0075428_1002410471	3300006844	Populus Rhizosphere	MRSFIIGVLVVAVGVLGYLYWDREHNTVFKAPGVEIKKN*
Ga0075428_1004037673	3300006844	Populus Rhizosphere	MRSFVIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIKKS*
Ga0075428_1027233521	3300006844	Populus Rhizosphere	MRSFIIGALLVAVGVLGYLYWDSQHNTVFKAPGVEIKKS*
Ga0075421_1009804983	3300006845	Populus Rhizosphere	MDGKSLLIGALIVGVGILGYLYWDSQHNTVVKLPGVEIKKN*
Ga0075421_1014618593	3300006845	Populus Rhizosphere	MDGRSLLIGVLLVGVAVLGFLYWDTEHNTLFKAPGVEIKKN*
Ga0075433_100443393	3300006852	Populus Rhizosphere	MRGFVIGILLVAVGVFGYLYWDSEHNTVFKAPGVEIKKN*
Ga0075433_103194592	3300006852	Populus Rhizosphere	LKSIVIGVLIAAVVVLGYLYWDSQHSTVFKAPGIEIKKN*
Ga0075433_108511902	3300006852	Populus Rhizosphere	MRSFVIGALVVAVGVLGYLYWDSQQNTRVKLPGVEIKKN*
Ga0074063_113503771	3300006953	Soil	ILVGALLVAVAVLGYLYWDSRHNTIFKAPGVEIKKN*
Ga0075419_100824563	3300006969	Populus Rhizosphere	MGGPIGKETSMRSFVIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIKKS*
Ga0075435_1001295201	3300007076	Populus Rhizosphere	MRGFVIGILLVAVGVFGYLYWDSEHNTVFKAPGVEIKK
Ga0104349_10469393	3300007281	Aeration Tank Of Activated Sludge Process	MIIGALLVAVGVLGYMYWDSEHNTVLKAPGVEIKKN*
Ga0099795_102880301	3300007788	Vadose Zone Soil	LKSIVIGALVAAVAVLGYLYWDSRNNTIFKAPGIEIKNN*
Ga0111539_100482832	3300009094	Populus Rhizosphere	MRSFVIGALVVAVAVLGYLYWDSQHNTLVKLPGVEIKKN*
Ga0111539_102791043	3300009094	Populus Rhizosphere	MEVEMRSFIIGALFIAVGVLGYLYWDSEHNTVFKAPGIEIKNK*
Ga0111539_105472463	3300009094	Populus Rhizosphere	MMDGRSLLVGALLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN*
Ga0111539_110223382	3300009094	Populus Rhizosphere	MRGFMIGALVVAVGVLGYLYWDAGHNTVFKAPGVEIKKN*
Ga0111539_115339691	3300009094	Populus Rhizosphere	MRGFIIGALVVAVGVLGYLYWDSQRNTVFKAPGVEIKKS*
Ga0111539_120342192	3300009094	Populus Rhizosphere	LALIVTVALLCYLYWDSRENTVVKLPGVEIKKNL*
Ga0111539_121010162	3300009094	Populus Rhizosphere	MRCFVIGALVVAVGVLGYLYWDSQQNTLVKLPGVEIKKN*
Ga0111539_132278302	3300009094	Populus Rhizosphere	MDGKSLVIGALLIGVVVLGYMVWDSRQNTVVKLPGVEIKKN*
Ga0075418_100691365	3300009100	Populus Rhizosphere	MEVEMRSFIIGALVIAVGVLGYLYWDSEHNTLFKAPGIEIKNK*
Ga0075418_101183306	3300009100	Populus Rhizosphere	MRSFVIGALVVAVAVLGYLYWDSQHNTLVMLPGVEIKKN*
Ga0075418_103266183	3300009100	Populus Rhizosphere	SGKEPQMRSFIIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIKKS*
Ga0075418_104213731	3300009100	Populus Rhizosphere	MRSFIIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIK
Ga0105091_100191517	3300009146	Freshwater Sediment	MRSFIIGALVVAVGVLGYLYWDSEHNTLFKAPGVEIKKN*
Ga0105091_104458991	3300009146	Freshwater Sediment	MTMRGFVIGALAVAVAVLGYLYWDSQHNTIVKVPGVEIKKN*
Ga0105091_106543661	3300009146	Freshwater Sediment	MNGKSMLIGALVVAVGVLGYLYWDSQHNTVLQVPGVTIKKN*
Ga0114129_105227744	3300009147	Populus Rhizosphere	FVIGALVVAVGVLGYLYWDSQQNTVVKLPGVEIKKN*
Ga0105243_103717121	3300009148	Miscanthus Rhizosphere	FIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS*
Ga0105243_126924543	3300009148	Miscanthus Rhizosphere	GFIIGVLVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS*
Ga0111538_124658081	3300009156	Populus Rhizosphere	MEVEMRSFIIGALFIVVGVLGYLYWDSEHNTLFKAPGIEIKNK*
Ga0105092_104433482	3300009157	Freshwater Sediment	MDGKSMLIGALVVGVAVFGYLYWDSKHNTVFKAPGVEIKKN*
Ga0075423_102926593	3300009162	Populus Rhizosphere	MEVEMRSFIIGALFIAVGVLGYLYWDSEHNTVFKAPGIEIKKQ*
Ga0105241_105931661	3300009174	Corn Rhizosphere	MEVEMRSFLIGALFIAVGVLGYLYWDSEHNTIFKAPGVEIKNK*
Ga0105238_128266412	3300009551	Corn Rhizosphere	MDGKSVVIGALLIGVAVLAYLYWDSQHNTVVKLPGVEIKKN*
Ga0105249_102320982	3300009553	Switchgrass Rhizosphere	MRSFVIGALVVAVGVLGYLYWDSQQNTLVKLPGVETKKN*
Ga0126374_106578781	3300009792	Tropical Forest Soil	MRGFIIGVLVVVIGVLGYLYWDSEHNTLFKAPGVEIKKN*
Ga0126374_116381791	3300009792	Tropical Forest Soil	MRGFIVVALVVIVGVLGYLYWDSENNTLFKAPGVEIKKN*
Ga0126384_101112852	3300010046	Tropical Forest Soil	MMGRSKEAAMRGVIIGALVVIVGVLGYLYWDSEHNTLFKAPGVEIKKN*
Ga0126384_101705691	3300010046	Tropical Forest Soil	MDGKSLIIGALLIGIVVLGYLYWDSQQNTVFKAPGVAIKKN*
Ga0126382_105012622	3300010047	Tropical Forest Soil	MEVEMRSFLIGALFVAVGVLGYLYWDSEHNTVVKAPGIEIKK*
Ga0126382_112796511	3300010047	Tropical Forest Soil	MRSFVIGALVVAVGVLGYLYWDSEHNTVFKAPGVEIK
Ga0127503_100868461	3300010154	Soil	LKSIVIGALVAAVAVLGYLYWDSQHNTIFKAPGIEIKKN*
Ga0126370_100944382	3300010358	Tropical Forest Soil	MIGALLIAVIVLGYLYWDSTQNTVFKAPGVEIKKS*
Ga0126376_107517411	3300010359	Tropical Forest Soil	SLLIGALVIGIGVLGYLYWDSHENTVFKAPGVEIKKE*
Ga0126376_117015101	3300010359	Tropical Forest Soil	MRGFIIGVLVVVIGVQGYLYWDSEHNTLFKAPGVEIKKN*
Ga0126377_1000223513	3300010362	Tropical Forest Soil	MRSFLIGALCIAVGVLGYLYWDSEHNTVFKAPGIEIKNK*
Ga0126377_106958981	3300010362	Tropical Forest Soil	MDGKSLLIGALVIGIGVLGYLYWDSHENTLFKAPGVEIKKE*
Ga0126377_107443102	3300010362	Tropical Forest Soil	MRSFLIGALLIAVGVLGYLYWDSEHNTVFKAPGIEIKKQ*
Ga0134125_130096031	3300010371	Terrestrial Soil	MRGLIIGVLVVAVGVLGYMYWDSHYNTVFKAPGVEIKKN*
Ga0134124_106826262	3300010397	Terrestrial Soil	LKSILIGALIAAVAVLGYLYWDSRNNTIFKAPGIEIKKD*
Ga0126383_105925563	3300010398	Tropical Forest Soil	MDGKSLVIGALLIGIVVLGYLYWDSQQNTVFKAPGVAIKKN*
Ga0126383_109350273	3300010398	Tropical Forest Soil	IGALLIGIVVLGYLYWDSQQNTVFKAPGFEIKRN*
Ga0126383_127016632	3300010398	Tropical Forest Soil	MDGKSLLIGALLIGVAVLGYLYWDSQHNTVFKAPGVEIKKN*
Ga0134127_117631141	3300010399	Terrestrial Soil	MDGKSLLIGVLLVGMGVLGYLYWDSQHNTVVKLPGV
Ga0134122_100016938	3300010400	Terrestrial Soil	MEVEMRSFIIGALFIAVGVLGYLYWDSEHNTIFKAPGIEIKNK*
Ga0134121_120853492	3300010401	Terrestrial Soil	VGQGVGVKVFVGVSVLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN*
Ga0134121_130030351	3300010401	Terrestrial Soil	MEAEMRSFLIGALFIAVGVLGYLYWDSEHNTIFKAPGVEIKNK*
Ga0137380_108337333	3300012206	Vadose Zone Soil	LKSLVIGALIVAVAVLGYLYWDSRNNTIFKAPGIEIKKN*
Ga0150985_1101244412	3300012212	Avena Fatua Rhizosphere	MRGFVIGALVVVVGVLGYLYWDSEHNTLVKAPGVEIKKN*
Ga0150984_1236474301	3300012469	Avena Fatua Rhizosphere	MLRRSWRSATMKSFIIGALVVAVREHNTIFKAPGVEIKKN*
Ga0157216_104580292	3300012668	Glacier Forefield Soil	MEVIMRGFVIGALVVAVGVLGYLYWDSQHNTVFKAPGIEIKKN*
Ga0137397_100872574	3300012685	Vadose Zone Soil	LKSLVIGALIVAVAVLGYLYSDSRNNTIFKAPGIEIKKN*
Ga0157286_103800541	3300012908	Soil	MRSFIIGVLVVGVGVLGYLYWDSQHNTVFKAPGVEIKKS*
Ga0157301_101350353	3300012911	Soil	MRSFVIGALVVAVGVLGYLYWNSQQNTLVKLPGVEIKKN*
Ga0137394_102225403	3300012922	Vadose Zone Soil	LKSLVIGALIVAVVVLGYLYWDSRNNTIFEASGIEIKKN*
Ga0137404_115800402	3300012929	Vadose Zone Soil	LKSIVIGALIVAVVVLGYLYWDSRNNTIFKAPGIEIKKN*
Ga0164298_112903471	3300012955	Soil	MLCRSKEVNMRGFVIGALVVAVAVLGYLYWDAEHNTVFKAPGVEIKKN*
Ga0164298_114246841	3300012955	Soil	MEATMRSFMIGALIIAVGVLGYLYWDSEHNTLFKAPGIEIKK*
Ga0164298_116362192	3300012955	Soil	MDGRSLLVGALLVGVAVLGYLYWDSQHNTVFKAPGVEIKKS*
Ga0164301_109733442	3300012960	Soil	MRSFMIGALIIVVGVLGYLYWDSEHNTLFKAPGIEIKK*
Ga0157378_105100942	3300013297	Miscanthus Rhizosphere	MDGRSLLIGALVIGVAVLGYLYWDSHENTGVKRPGVEIKKN*
Ga0157380_109082572	3300014326	Switchgrass Rhizosphere	NMRGFVIGALVVAVGVLGYLYWDAEHNTVFKAPGVEIKKN*
Ga0157379_105387433	3300014968	Switchgrass Rhizosphere	DGKSVVIGALLIGVAVLGYLYWDSQHNTVVKLPGVEIKKN*
Ga0173483_105627441	3300015077	Soil	MKSMLIGALIIAVAVLGYLYWDSQNNTIVKVPGVTIKKN*
Ga0167654_10245243	3300015084	Glacier Forefield Soil	MEGRSLLIGMLLVGVLVLGYLYWDSQHNTVFKAPGVEIKKN*
Ga0120098_10612862	3300015170	Fossill	MDGKSLLIGALTVGVGILGYLYWDSQHNTVVELPGVEIKKN*
Ga0132258_101338393	3300015371	Arabidopsis Rhizosphere	MRGFIIGVLVVIVGVLGYLYWDSEHNTLFKAPGVEIKKN*
Ga0132258_103559035	3300015371	Arabidopsis Rhizosphere	MRGLIIGALVLAVGVLGYLYWDSTQNTVFKAPGVEIKKS*
Ga0132258_114413003	3300015371	Arabidopsis Rhizosphere	MEVEMRSFLIGALFIAVGVLGYLYWDSEHNTIFKAPGV
Ga0132258_120084311	3300015371	Arabidopsis Rhizosphere	MRGFIIGALVVAVGVLGYMYWDREHNTVFKAPGVEIKKN*
Ga0132256_1010656532	3300015372	Arabidopsis Rhizosphere	MDGKSVVIGALLIGVAVLGYLYWDSQHNTVVKLPGVEVKKN*
Ga0132255_1057199742	3300015374	Arabidopsis Rhizosphere	MRGFIIGALVVVIGVLGYLYWDSEHNTLFKAPGVEIKKN*
Ga0182035_113386942	3300016341	Soil	VRGFIIGVLVVVVGVLGYLYWDSEHNALFKAPGVEIKRN
Ga0182034_113148292	3300016371	Soil	VRGFIIGVLVVVVGVLGYLYWDSEHNALFKAPGIEIKRN
Ga0187825_101067161	3300017930	Freshwater Sediment	MRGFIIGVLIIGVAVLGYLYWDSEHNTIFKAPGVEIKKN
Ga0187786_106308173	3300017944	Tropical Peatland	QGRSLLIGALLVGIAVLGYLYWDSQYNTVLKVPGVEIKKN
Ga0187785_102934902	3300017947	Tropical Peatland	MRGLVIGLLVVAVGVLGYMYWDAQYNTVFKAPGVEIKKN
Ga0184605_105265481	3300018027	Groundwater Sediment	VNGKSILIGALLVAVAVLGYLYWDSQQNTVLKAPA
Ga0184626_100579502	3300018053	Groundwater Sediment	MDGKSMLIGALVIGVAVLGYLYWDSQHNTVFKAPGVEIKKN
Ga0184632_102946532	3300018075	Groundwater Sediment	MRSFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKN
Ga0190265_104009174	3300018422	Soil	MDGKSLLIGALIVGMGILGYLYWDSQHNTVVKLPGVEIKKN
Ga0190265_109052741	3300018422	Soil	MDGKSLLIGALIIGMGVLGYMYWDSQHNTVFKAPGVEIKKN
Ga0190265_110571442	3300018422	Soil	MDGKSLVIGALLVGLAFVGYLYWDSEHNTVFKAPGVEIKKN
Ga0190265_122307752	3300018422	Soil	MDGKSLLIGALIVGMGVLGYMYWDSQHNTVFKAPGVEIKKN
Ga0190265_128451531	3300018422	Soil	MDGKSLLIGGLLVAVVVFGYLYWDSQNNVVFKAPGV
Ga0190272_101092192	3300018429	Soil	MDGKSLLIGALIAGMGILGYLYWDSQHNTVVKLPGVEIKKN
Ga0190272_104212972	3300018429	Soil	VVAAIGALIVGMGVLGYMYWDSQHNTVFKAPGVEIKKN
Ga0190272_105757673	3300018429	Soil	MDGKSLLIGALIVGMGVLGYMYWDSQHNTVVKLPGVEIKKN
Ga0190272_106015261	3300018429	Soil	HGRQSLLIGALIVGMGLLGYMYWDSQHNTVFKAPGVEIKKN
Ga0190272_108784422	3300018429	Soil	MRGFVIGALVVAVGVLGYLYWDSQHNTVFKAPGIEIKKN
Ga0190272_111630031	3300018429	Soil	MDGKSLLIGALLVGVVVLGYLYWDSQHNTVFKAPGVEIKAK
Ga0190268_112679522	3300018466	Soil	MDGKSLLIGALIVGMGVLGYMYWASQHNTVFKAPGVEIKKN
Ga0190270_104744623	3300018469	Soil	MDGRSMLIGILLVAVVVLGYLYWDRENNTLFKAPGVEIRKN
Ga0190270_123368111	3300018469	Soil	MKSFIIGALVIAVAVLGYLYWDSQHNTVVKLPGVEIKKN
Ga0190270_129443492	3300018469	Soil	LKQNQLYLLIGALVVAVAVLGYLYWDSQHNTVVKLPGVEIKKN
Ga0190270_130319242	3300018469	Soil	MRSFIIGVLVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS
Ga0190270_132143201	3300018469	Soil	MRGFVIGALAVAVAVLGYLYWDSQHNTIVKLPGVEIKKN
Ga0190274_109708193	3300018476	Soil	MDGRSLLVGILLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN
Ga0066669_111193791	3300018482	Grasslands Soil	MNGKSILIGALIIAVAVLGYLYWDSQNNTIVKVPGVTIKKN
Ga0184646_12178831	3300019259	Groundwater Sediment	REPIMDGKSMLIGALVIGVAVLGYLYWDSQHNTVFKAPGVEIRKN
Ga0184644_13038552	3300019269	Groundwater Sediment	MRGFVIGALVVAVGVLGYMYWDSEHNTLVKAPGIEIKKN
Ga0173479_105728902	3300019362	Soil	MDGRSMLIGILLVTVLVLGYLYWDREHNTVLKAPGVEIRKN
Ga0193741_11451492	3300019884	Soil	MRSFIIGVLVVAVGVLGYLYWDSQNNTIFKAPGVEIKKS
Ga0193727_11924452	3300019886	Soil	LKSLVIGALIVAVAVLGYLYWDSRNNTIFKAPGIEIKKN
Ga0179594_100427461	3300020170	Vadose Zone Soil	LKSIVIGALIAAIAVLGYLYWDSRNNTIFKAPGIEIKKN
Ga0210399_105490371	3300020581	Soil	MRSFVIGALVIGVGVLGYLYWDAHQNTVFKAPGVEIKKN
Ga0210381_101130662	3300021078	Groundwater Sediment	LKSIVIGALVAAVAVLGYLYWDSQHNTIFKAPGIEIKKN
Ga0210380_100168833	3300021082	Groundwater Sediment	MRSFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS
Ga0210402_104130651	3300021478	Soil	YARSKEAIMRGLMIAALLGAVIVLGYLYWDSTQNTVFKAPGVEIKRS
Ga0126371_120702332	3300021560	Tropical Forest Soil	MRGLMIGALLIAVIVLGYLYWDSTQNTVFKAPGVEIKKS
Ga0126371_135010041	3300021560	Tropical Forest Soil	IMRGLMIGALLIAVIVLGYLYWDSNQNTVFKAPGVEIKKS
Ga0224505_101422172	3300022214	Sediment	MRGFIIGALIVAVGLLGYLYWDSEHNTLFKAPGIEIKK
Ga0179589_101041382	3300024288	Vadose Zone Soil	MDGRSIVVGALLVAVAVLGYLYWDSRNNTIFKAPGVEIKKN
Ga0207709_112931643	3300025935	Miscanthus Rhizosphere	QEELVMDGKSLLIGVLLVGMGVLGYLYWDSQHNTVVKLPGVEIKKN
Ga0207665_106219661	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MRSFVIGALVIGVGVLGYLYWDAHQNTVLKAPGVEIKKN
Ga0207703_110940241	3300026035	Switchgrass Rhizosphere	RSYDARGEADMDGRSMLIGILLVTVLVLGYLYWDREHNTVLKAPGVEIRKN
Ga0207675_1012597461	3300026118	Switchgrass Rhizosphere	MRSFVIGALVVAVAVLGYLYWDAQHNTVFKAPGVEIKKN
Ga0207675_1015284423	3300026118	Switchgrass Rhizosphere	MDGRSLLVGALLVGVAVLGYLYWDSQHNTVFKAPGV
Ga0207683_114346001	3300026121	Miscanthus Rhizosphere	MDGKSLLIGVLLVGMGVLGYLYWDSQHNTVVKLPGVEI
Ga0209077_11261341	3300027675	Freshwater Sediment	MRSFIIGALVVAVGVLGYLYWDSEHNTLFKAPGVEIKKN
Ga0209813_100701563	3300027866	Populus Endosphere	MDGRSLLVGALLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN
Ga0209813_101872484	3300027866	Populus Endosphere	LLVGILLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN
Ga0209814_105667141	3300027873	Populus Rhizosphere	MRSFIIGALVIAVGVLGYLYWDSEHNTLFKAPGIEIKNK
Ga0209465_101297652	3300027874	Tropical Forest Soil	MIAVLLVAVIVLGYLYWDSTQNTVFKAPGVEIKKS
Ga0209481_101884791	3300027880	Populus Rhizosphere	MGGQSERKPQMRSFIIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIKKS
Ga0207428_100400622	3300027907	Populus Rhizosphere	MRGFVIGILLVAVGVFGYLYWDSEHNTVFKAPGVEIKKN
Ga0209382_1000999514	3300027909	Populus Rhizosphere	MDGKSMLIGALIIGVAVLGYLYWDSQHNTVLQVPGVTIKKN
Ga0209382_100914972	3300027909	Populus Rhizosphere	MRSFIIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIKKS
Ga0209382_101246701	3300027909	Populus Rhizosphere	MRSFIIGVLVVAVGVLGYLYWDREHNTVFKAPGVEIKKN
Ga0209382_103236363	3300027909	Populus Rhizosphere	MDGKSLLIGALIVGVGILGYLYWDSQHNTVVKLPGVEIKKN
Ga0209853_11040761	3300027961	Groundwater Sand	MRSFIIGMLVVAVGVLGYLYWDSQHNTILKAPGVEIKKS
Ga0209526_108476662	3300028047	Forest Soil	MKTMLIGALIIAVAVLGYLYWDSQNNTIVKVPGVTIKKN
Ga0268264_116723591	3300028381	Switchgrass Rhizosphere	MRGFVIGALVVAVGVLGYMYWDSEHNTLVKAPGVEIKKN
Ga0268264_122959911	3300028381	Switchgrass Rhizosphere	MEVTMRGFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS
Ga0247824_105858481	3300028809	Soil	MDGKSLMIGALLVAVVVLGYLYWDSTHNTVFKAPGVEIRAK
Ga0307302_103250262	3300028814	Soil	LKSIVIGALIAAVAVLGYLYWDSQHNTIFKAPGIEIKKN
Ga0247827_111927681	3300028889	Soil	IIGTLVVAVGVLGYLYWDSQHNTIFKAPGVEIKKS
Ga0102760_103439492	3300031039	Soil	MRGFVIGALVVVVGVLGYLYWDSEHNTLVKAPGVEIKKN
Ga0308189_105300843	3300031058	Soil	GFVIGALVVAVAVLGYLYWDSQYNTVFKAPGVEIKKSP
Ga0307501_101567481	3300031152	Soil	LKSIVIGALVAAVAVLGYLYWDSQNNTIFKAPGIEIKKN
Ga0307499_100530721	3300031184	Soil	MRSFIIGALFIAVGVLGYLYWDSEHNTIFKAPGIEIKNK
Ga0307499_101154973	3300031184	Soil	LKSLVIGALIVAVVVLGYLYWDSRNNTIFKAPGIEIKKNP
Ga0307499_103322591	3300031184	Soil	MRSFIIGALVVAVGVLGYLYWDSQHNTIFKAPGVEIKKS
Ga0307505_101900641	3300031455	Soil	MNAKSLAIGGLLVAVAVFGYLYWDSQNNVLFKAPGVE
Ga0318538_104703132	3300031546	Soil	VRGFFIGVLVVVVGVLGYLYWDSEHNTLFKAPGVEIKKN
Ga0307468_1002289702	3300031740	Hardwood Forest Soil	MRSFLIGALFIAVGVLGYLYWDSEHNTVFKAPGIEIKNK
Ga0307468_1004062472	3300031740	Hardwood Forest Soil	MRSFVIGALVVAVGVLGYLYWDSQHNTLVKLPGVEIKKN
Ga0318540_105246511	3300032094	Soil	MRGFIIGVLVVVVGVLGYLYWDSEHNTLFKAPGVEIK
Ga0307470_118491231	3300032174	Hardwood Forest Soil	MRGLIIGALAVAVGVLGYLYWDAEHNTVFKAPGVEIKKN
Ga0307472_1004947111	3300032205	Hardwood Forest Soil	MRGFVIGVLLVAVGVFGYLYWDSEHNTVFKAPGVEIKKN
Ga0306920_1006962631	3300032261	Soil	MRGFIIGVLVVVVGVLGYLYWDSEHNTLFKAPGVEIKKN