Basic Information | |
---|---|
Family ID | F016311 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 248 |
Average Sequence Length | 40 residues |
Representative Sequence | MRSFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKN |
Number of Associated Samples | 153 |
Number of Associated Scaffolds | 248 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 83.47 % |
% of genes near scaffold ends (potentially truncated) | 18.55 % |
% of genes from short scaffolds (< 2000 bps) | 86.29 % |
Associated GOLD sequencing projects | 135 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (52.419 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (14.516 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.194 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.565 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 37.31% β-sheet: 13.43% Coil/Unstructured: 49.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 248 Family Scaffolds |
---|---|---|
PF05532 | CsbD | 4.44 |
PF01925 | TauE | 4.03 |
PF00072 | Response_reg | 4.03 |
PF01694 | Rhomboid | 2.82 |
PF04632 | FUSC | 2.02 |
PF00294 | PfkB | 1.61 |
PF05239 | PRC | 1.61 |
PF07702 | UTRA | 1.61 |
PF16998 | 17kDa_Anti_2 | 1.61 |
PF05974 | DUF892 | 1.21 |
PF00528 | BPD_transp_1 | 1.21 |
PF00291 | PALP | 1.21 |
PF03734 | YkuD | 0.81 |
PF02894 | GFO_IDH_MocA_C | 0.81 |
PF10137 | TIR-like | 0.81 |
PF00296 | Bac_luciferase | 0.81 |
PF04226 | Transgly_assoc | 0.81 |
PF13430 | DUF4112 | 0.81 |
PF00005 | ABC_tran | 0.81 |
PF12680 | SnoaL_2 | 0.81 |
PF01965 | DJ-1_PfpI | 0.40 |
PF13533 | Biotin_lipoyl_2 | 0.40 |
PF05589 | DUF768 | 0.40 |
PF00753 | Lactamase_B | 0.40 |
PF01192 | RNA_pol_Rpb6 | 0.40 |
PF02810 | SEC-C | 0.40 |
PF08241 | Methyltransf_11 | 0.40 |
PF07883 | Cupin_2 | 0.40 |
PF12974 | Phosphonate-bd | 0.40 |
PF03330 | DPBB_1 | 0.40 |
PF07690 | MFS_1 | 0.40 |
PF07813 | LTXXQ | 0.40 |
PF01266 | DAO | 0.40 |
PF01812 | 5-FTHF_cyc-lig | 0.40 |
PF04545 | Sigma70_r4 | 0.40 |
PF02769 | AIRS_C | 0.40 |
PF03466 | LysR_substrate | 0.40 |
PF17200 | sCache_2 | 0.40 |
PF16184 | Cadherin_3 | 0.40 |
PF00929 | RNase_T | 0.40 |
PF00106 | adh_short | 0.40 |
PF00583 | Acetyltransf_1 | 0.40 |
PF00816 | Histone_HNS | 0.40 |
PF15887 | Peptidase_Mx | 0.40 |
PF03060 | NMO | 0.40 |
PF09976 | TPR_21 | 0.40 |
PF09084 | NMT1 | 0.40 |
PF00486 | Trans_reg_C | 0.40 |
PF03631 | Virul_fac_BrkB | 0.40 |
PF07238 | PilZ | 0.40 |
PF13468 | Glyoxalase_3 | 0.40 |
PF03144 | GTP_EFTU_D2 | 0.40 |
PF01594 | AI-2E_transport | 0.40 |
PF07043 | DUF1328 | 0.40 |
PF13587 | Obsolete Pfam Family | 0.40 |
PF02776 | TPP_enzyme_N | 0.40 |
PF14216 | DUF4326 | 0.40 |
COG ID | Name | Functional Category | % Frequency in 248 Family Scaffolds |
---|---|---|---|
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 4.44 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 4.03 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 2.82 |
COG1289 | Uncharacterized membrane protein YccC | Function unknown [S] | 2.02 |
COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 1.61 |
COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 1.21 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.81 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.81 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.81 |
COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.40 |
COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 0.40 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.40 |
COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.40 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.40 |
COG0212 | 5-formyltetrahydrofolate cyclo-ligase | Coenzyme transport and metabolism [H] | 0.40 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.40 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.40 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.40 |
COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.40 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 52.82 % |
Unclassified | root | N/A | 47.18 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908007|FWIRElOz_GKZ9IRQ01BYVET | Not Available | 514 | Open in IMG/M |
2124908045|KansclcFeb2_ConsensusfromContig164598 | Not Available | 720 | Open in IMG/M |
2199352025|deepsgr__Contig_115374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 897 | Open in IMG/M |
2228664022|INPgaii200_c0766495 | Not Available | 716 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2344699 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2346208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter aquaticus | 833 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_14452968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100740804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1411 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101447112 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101980631 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101997194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2028 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105632595 | All Organisms → cellular organisms → Bacteria | 2571 | Open in IMG/M |
3300000550|F24TB_13055513 | Not Available | 506 | Open in IMG/M |
3300000559|F14TC_102931290 | Not Available | 1586 | Open in IMG/M |
3300000559|F14TC_104888496 | Not Available | 1359 | Open in IMG/M |
3300000955|JGI1027J12803_101205658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5 | 938 | Open in IMG/M |
3300000955|JGI1027J12803_106712902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1374 | Open in IMG/M |
3300000956|JGI10216J12902_101927244 | All Organisms → cellular organisms → Bacteria | 8888 | Open in IMG/M |
3300000956|JGI10216J12902_101988697 | Not Available | 876 | Open in IMG/M |
3300000956|JGI10216J12902_107828215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
3300002568|C688J35102_120415973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1052 | Open in IMG/M |
3300003324|soilH2_10115140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1058 | Open in IMG/M |
3300003659|JGI25404J52841_10040687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 984 | Open in IMG/M |
3300004114|Ga0062593_100458211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis | 1165 | Open in IMG/M |
3300004114|Ga0062593_100494337 | Not Available | 1131 | Open in IMG/M |
3300004114|Ga0062593_100745681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 964 | Open in IMG/M |
3300004463|Ga0063356_100188579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2413 | Open in IMG/M |
3300004463|Ga0063356_104011320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
3300004463|Ga0063356_106044258 | Not Available | 519 | Open in IMG/M |
3300004463|Ga0063356_106238250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 511 | Open in IMG/M |
3300004479|Ga0062595_102090483 | Not Available | 550 | Open in IMG/M |
3300004633|Ga0066395_10013580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3080 | Open in IMG/M |
3300004633|Ga0066395_10412729 | Not Available | 763 | Open in IMG/M |
3300005045|Ga0071328_109299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 4369 | Open in IMG/M |
3300005093|Ga0062594_100050567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2122 | Open in IMG/M |
3300005332|Ga0066388_100035514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 4803 | Open in IMG/M |
3300005332|Ga0066388_100056070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4114 | Open in IMG/M |
3300005332|Ga0066388_100918671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1451 | Open in IMG/M |
3300005332|Ga0066388_101382178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1221 | Open in IMG/M |
3300005332|Ga0066388_101422594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii | 1206 | Open in IMG/M |
3300005332|Ga0066388_102350616 | Not Available | 966 | Open in IMG/M |
3300005332|Ga0066388_102407458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 955 | Open in IMG/M |
3300005332|Ga0066388_103008564 | Not Available | 861 | Open in IMG/M |
3300005332|Ga0066388_103770068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 773 | Open in IMG/M |
3300005332|Ga0066388_107456549 | Not Available | 549 | Open in IMG/M |
3300005332|Ga0066388_107804627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1 | 536 | Open in IMG/M |
3300005347|Ga0070668_101240779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
3300005434|Ga0070709_10233372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1317 | Open in IMG/M |
3300005435|Ga0070714_100739039 | Not Available | 951 | Open in IMG/M |
3300005441|Ga0070700_100314617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1148 | Open in IMG/M |
3300005441|Ga0070700_100685231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 813 | Open in IMG/M |
3300005441|Ga0070700_101357759 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300005441|Ga0070700_101871658 | Not Available | 518 | Open in IMG/M |
3300005547|Ga0070693_101131235 | Not Available | 598 | Open in IMG/M |
3300005548|Ga0070665_101084929 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300005566|Ga0066693_10345085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
3300005577|Ga0068857_101968939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
3300005578|Ga0068854_101530556 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300005617|Ga0068859_102487227 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300005618|Ga0068864_101514501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
3300005713|Ga0066905_100101466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1955 | Open in IMG/M |
3300005713|Ga0066905_100167486 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
3300005713|Ga0066905_100196903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1502 | Open in IMG/M |
3300005713|Ga0066905_100390717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1125 | Open in IMG/M |
3300005713|Ga0066905_101631544 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005713|Ga0066905_102168744 | Not Available | 518 | Open in IMG/M |
3300005719|Ga0068861_100029469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4016 | Open in IMG/M |
3300005719|Ga0068861_100610276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1003 | Open in IMG/M |
3300005764|Ga0066903_100672203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1817 | Open in IMG/M |
3300005764|Ga0066903_101176716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1421 | Open in IMG/M |
3300005764|Ga0066903_101275801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1370 | Open in IMG/M |
3300005764|Ga0066903_103315008 | Not Available | 870 | Open in IMG/M |
3300005764|Ga0066903_105441021 | Not Available | 672 | Open in IMG/M |
3300005764|Ga0066903_106803075 | Not Available | 594 | Open in IMG/M |
3300005841|Ga0068863_100144884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2271 | Open in IMG/M |
3300005842|Ga0068858_101247127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 731 | Open in IMG/M |
3300005937|Ga0081455_10000282 | All Organisms → cellular organisms → Bacteria | 67197 | Open in IMG/M |
3300005983|Ga0081540_1000611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 34020 | Open in IMG/M |
3300006046|Ga0066652_101914999 | Not Available | 531 | Open in IMG/M |
3300006049|Ga0075417_10490764 | Not Available | 616 | Open in IMG/M |
3300006173|Ga0070716_101170031 | Not Available | 616 | Open in IMG/M |
3300006175|Ga0070712_100531481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 989 | Open in IMG/M |
3300006194|Ga0075427_10109801 | Not Available | 519 | Open in IMG/M |
3300006196|Ga0075422_10107248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1078 | Open in IMG/M |
3300006844|Ga0075428_100087437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3400 | Open in IMG/M |
3300006844|Ga0075428_100241047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1951 | Open in IMG/M |
3300006844|Ga0075428_100403767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1464 | Open in IMG/M |
3300006844|Ga0075428_102723352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium zavarzinii | 504 | Open in IMG/M |
3300006845|Ga0075421_100980498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 958 | Open in IMG/M |
3300006845|Ga0075421_101461859 | Not Available | 749 | Open in IMG/M |
3300006852|Ga0075433_10044339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3863 | Open in IMG/M |
3300006852|Ga0075433_10319459 | Not Available | 1374 | Open in IMG/M |
3300006852|Ga0075433_10851190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 796 | Open in IMG/M |
3300006953|Ga0074063_11350377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
3300006969|Ga0075419_10082456 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
3300007076|Ga0075435_100129520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2111 | Open in IMG/M |
3300007281|Ga0104349_1046939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2277 | Open in IMG/M |
3300007788|Ga0099795_10288030 | Not Available | 719 | Open in IMG/M |
3300009094|Ga0111539_10048283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5083 | Open in IMG/M |
3300009094|Ga0111539_10279104 | All Organisms → cellular organisms → Bacteria | 1944 | Open in IMG/M |
3300009094|Ga0111539_10547246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1348 | Open in IMG/M |
3300009094|Ga0111539_11022338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 961 | Open in IMG/M |
3300009094|Ga0111539_11533969 | Not Available | 773 | Open in IMG/M |
3300009094|Ga0111539_12034219 | Not Available | 666 | Open in IMG/M |
3300009094|Ga0111539_12101016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
3300009094|Ga0111539_13227830 | Not Available | 525 | Open in IMG/M |
3300009100|Ga0075418_10069136 | All Organisms → cellular organisms → Bacteria | 3764 | Open in IMG/M |
3300009100|Ga0075418_10118330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2815 | Open in IMG/M |
3300009100|Ga0075418_10326618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | 1637 | Open in IMG/M |
3300009100|Ga0075418_10421373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1429 | Open in IMG/M |
3300009146|Ga0105091_10019151 | All Organisms → cellular organisms → Bacteria | 2923 | Open in IMG/M |
3300009146|Ga0105091_10445899 | Not Available | 650 | Open in IMG/M |
3300009146|Ga0105091_10654366 | Not Available | 547 | Open in IMG/M |
3300009147|Ga0114129_10522774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1547 | Open in IMG/M |
3300009148|Ga0105243_10371712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1319 | Open in IMG/M |
3300009148|Ga0105243_12692454 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300009156|Ga0111538_12465808 | Not Available | 653 | Open in IMG/M |
3300009157|Ga0105092_10443348 | Not Available | 741 | Open in IMG/M |
3300009162|Ga0075423_10292659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1706 | Open in IMG/M |
3300009174|Ga0105241_10593166 | Not Available | 1000 | Open in IMG/M |
3300009551|Ga0105238_12826641 | Not Available | 522 | Open in IMG/M |
3300009553|Ga0105249_10232098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1820 | Open in IMG/M |
3300009792|Ga0126374_10657878 | Not Available | 782 | Open in IMG/M |
3300009792|Ga0126374_11638179 | Not Available | 533 | Open in IMG/M |
3300010046|Ga0126384_10111285 | Not Available | 2042 | Open in IMG/M |
3300010046|Ga0126384_10170569 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1695 | Open in IMG/M |
3300010047|Ga0126382_10501262 | Not Available | 976 | Open in IMG/M |
3300010047|Ga0126382_11279651 | Not Available | 662 | Open in IMG/M |
3300010154|Ga0127503_10086846 | Not Available | 717 | Open in IMG/M |
3300010358|Ga0126370_10094438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2050 | Open in IMG/M |
3300010359|Ga0126376_10751741 | Not Available | 945 | Open in IMG/M |
3300010359|Ga0126376_11701510 | Not Available | 666 | Open in IMG/M |
3300010362|Ga0126377_10002235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13214 | Open in IMG/M |
3300010362|Ga0126377_10695898 | Not Available | 1069 | Open in IMG/M |
3300010362|Ga0126377_10744310 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300010371|Ga0134125_13009603 | Not Available | 511 | Open in IMG/M |
3300010397|Ga0134124_10682626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1015 | Open in IMG/M |
3300010398|Ga0126383_10592556 | Not Available | 1179 | Open in IMG/M |
3300010398|Ga0126383_10935027 | Not Available | 954 | Open in IMG/M |
3300010398|Ga0126383_12701663 | Not Available | 579 | Open in IMG/M |
3300010399|Ga0134127_11763114 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300010400|Ga0134122_10001693 | All Organisms → cellular organisms → Bacteria | 16016 | Open in IMG/M |
3300010401|Ga0134121_12085349 | Not Available | 601 | Open in IMG/M |
3300010401|Ga0134121_13003035 | Not Available | 519 | Open in IMG/M |
3300012206|Ga0137380_10833733 | Not Available | 795 | Open in IMG/M |
3300012212|Ga0150985_110124441 | Not Available | 576 | Open in IMG/M |
3300012469|Ga0150984_123647430 | Not Available | 595 | Open in IMG/M |
3300012668|Ga0157216_10458029 | Not Available | 554 | Open in IMG/M |
3300012685|Ga0137397_10087257 | Not Available | 2274 | Open in IMG/M |
3300012908|Ga0157286_10380054 | Not Available | 542 | Open in IMG/M |
3300012911|Ga0157301_10135035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
3300012922|Ga0137394_10222540 | Not Available | 1613 | Open in IMG/M |
3300012929|Ga0137404_11580040 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300012955|Ga0164298_11290347 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300012955|Ga0164298_11424684 | Not Available | 537 | Open in IMG/M |
3300012955|Ga0164298_11636219 | Not Available | 508 | Open in IMG/M |
3300012960|Ga0164301_10973344 | Not Available | 665 | Open in IMG/M |
3300013297|Ga0157378_10510094 | Not Available | 1203 | Open in IMG/M |
3300014326|Ga0157380_10908257 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300014968|Ga0157379_10538743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1085 | Open in IMG/M |
3300015077|Ga0173483_10562744 | Not Available | 620 | Open in IMG/M |
3300015084|Ga0167654_1024524 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300015170|Ga0120098_1061286 | Not Available | 548 | Open in IMG/M |
3300015371|Ga0132258_10133839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5917 | Open in IMG/M |
3300015371|Ga0132258_10355903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3621 | Open in IMG/M |
3300015371|Ga0132258_11441300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1739 | Open in IMG/M |
3300015371|Ga0132258_12008431 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
3300015372|Ga0132256_101065653 | Not Available | 923 | Open in IMG/M |
3300015374|Ga0132255_105719974 | Not Available | 526 | Open in IMG/M |
3300016341|Ga0182035_11338694 | Not Available | 642 | Open in IMG/M |
3300016371|Ga0182034_11314829 | Not Available | 631 | Open in IMG/M |
3300017930|Ga0187825_10106716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 972 | Open in IMG/M |
3300017944|Ga0187786_10630817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 507 | Open in IMG/M |
3300017947|Ga0187785_10293490 | Not Available | 745 | Open in IMG/M |
3300018027|Ga0184605_10526548 | Not Available | 512 | Open in IMG/M |
3300018053|Ga0184626_10057950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1626 | Open in IMG/M |
3300018075|Ga0184632_10294653 | Not Available | 703 | Open in IMG/M |
3300018422|Ga0190265_10400917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis | 1470 | Open in IMG/M |
3300018422|Ga0190265_10905274 | Not Available | 1005 | Open in IMG/M |
3300018422|Ga0190265_11057144 | Not Available | 933 | Open in IMG/M |
3300018422|Ga0190265_12230775 | Not Available | 650 | Open in IMG/M |
3300018422|Ga0190265_12845153 | Not Available | 578 | Open in IMG/M |
3300018429|Ga0190272_10109219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1801 | Open in IMG/M |
3300018429|Ga0190272_10421297 | Not Available | 1099 | Open in IMG/M |
3300018429|Ga0190272_10575767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis | 980 | Open in IMG/M |
3300018429|Ga0190272_10601526 | Not Available | 964 | Open in IMG/M |
3300018429|Ga0190272_10878442 | Not Available | 838 | Open in IMG/M |
3300018429|Ga0190272_11163003 | Not Available | 754 | Open in IMG/M |
3300018466|Ga0190268_11267952 | Not Available | 618 | Open in IMG/M |
3300018469|Ga0190270_10474462 | Not Available | 1184 | Open in IMG/M |
3300018469|Ga0190270_12336811 | Not Available | 596 | Open in IMG/M |
3300018469|Ga0190270_12944349 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300018469|Ga0190270_13031924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
3300018469|Ga0190270_13214320 | Not Available | 518 | Open in IMG/M |
3300018476|Ga0190274_10970819 | Not Available | 922 | Open in IMG/M |
3300018482|Ga0066669_11119379 | Not Available | 710 | Open in IMG/M |
3300019259|Ga0184646_1217883 | Not Available | 523 | Open in IMG/M |
3300019269|Ga0184644_1303855 | Not Available | 540 | Open in IMG/M |
3300019362|Ga0173479_10572890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
3300019884|Ga0193741_1145149 | Not Available | 589 | Open in IMG/M |
3300019886|Ga0193727_1192445 | Not Available | 516 | Open in IMG/M |
3300020170|Ga0179594_10042746 | Not Available | 1502 | Open in IMG/M |
3300020581|Ga0210399_10549037 | Not Available | 958 | Open in IMG/M |
3300021078|Ga0210381_10113066 | Not Available | 893 | Open in IMG/M |
3300021082|Ga0210380_10016883 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3078 | Open in IMG/M |
3300021478|Ga0210402_10413065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1253 | Open in IMG/M |
3300021560|Ga0126371_12070233 | Not Available | 685 | Open in IMG/M |
3300021560|Ga0126371_13501004 | Not Available | 530 | Open in IMG/M |
3300022214|Ga0224505_10142217 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300024288|Ga0179589_10104138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1163 | Open in IMG/M |
3300025935|Ga0207709_11293164 | Not Available | 602 | Open in IMG/M |
3300025939|Ga0207665_10621966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter | 844 | Open in IMG/M |
3300026035|Ga0207703_11094024 | Not Available | 766 | Open in IMG/M |
3300026118|Ga0207675_101259746 | Not Available | 760 | Open in IMG/M |
3300026118|Ga0207675_101528442 | Not Available | 688 | Open in IMG/M |
3300026121|Ga0207683_11434600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
3300027675|Ga0209077_1126134 | Not Available | 713 | Open in IMG/M |
3300027866|Ga0209813_10070156 | Not Available | 1137 | Open in IMG/M |
3300027866|Ga0209813_10187248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 760 | Open in IMG/M |
3300027873|Ga0209814_10566714 | Not Available | 505 | Open in IMG/M |
3300027874|Ga0209465_10129765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1246 | Open in IMG/M |
3300027880|Ga0209481_10188479 | Not Available | 1028 | Open in IMG/M |
3300027907|Ga0207428_10040062 | All Organisms → cellular organisms → Bacteria | 3803 | Open in IMG/M |
3300027909|Ga0209382_10009995 | All Organisms → cellular organisms → Bacteria | 11865 | Open in IMG/M |
3300027909|Ga0209382_10091497 | All Organisms → cellular organisms → Bacteria | 3573 | Open in IMG/M |
3300027909|Ga0209382_10124670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3002 | Open in IMG/M |
3300027909|Ga0209382_10323636 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
3300027961|Ga0209853_1104076 | Not Available | 717 | Open in IMG/M |
3300028047|Ga0209526_10847666 | Not Available | 561 | Open in IMG/M |
3300028381|Ga0268264_11672359 | Not Available | 647 | Open in IMG/M |
3300028381|Ga0268264_12295991 | Not Available | 546 | Open in IMG/M |
3300028809|Ga0247824_10585848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp. | 668 | Open in IMG/M |
3300028814|Ga0307302_10325026 | Not Available | 758 | Open in IMG/M |
3300028889|Ga0247827_11192768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
3300031039|Ga0102760_10343949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
3300031058|Ga0308189_10530084 | Not Available | 511 | Open in IMG/M |
3300031152|Ga0307501_10156748 | Not Available | 623 | Open in IMG/M |
3300031184|Ga0307499_10053072 | Not Available | 999 | Open in IMG/M |
3300031184|Ga0307499_10115497 | Not Available | 752 | Open in IMG/M |
3300031184|Ga0307499_10332259 | Not Available | 510 | Open in IMG/M |
3300031455|Ga0307505_10190064 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 945 | Open in IMG/M |
3300031546|Ga0318538_10470313 | Not Available | 681 | Open in IMG/M |
3300031740|Ga0307468_100228970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → Amaricoccus macauensis | 1286 | Open in IMG/M |
3300031740|Ga0307468_100406247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1042 | Open in IMG/M |
3300032094|Ga0318540_10524651 | Not Available | 571 | Open in IMG/M |
3300032174|Ga0307470_11849123 | Not Available | 512 | Open in IMG/M |
3300032205|Ga0307472_100494711 | Not Available | 1052 | Open in IMG/M |
3300032261|Ga0306920_100696263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1498 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.11% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.48% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.44% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.63% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.82% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.42% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.02% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.02% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.61% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.61% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.61% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.21% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.21% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.21% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.40% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.40% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.40% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.40% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.40% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.40% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.40% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.40% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.40% |
Fossill | Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill | 0.40% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.40% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.40% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.40% |
Aeration Tank Of Activated Sludge Process | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process | 0.40% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908007 | Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2 | Environmental | Open in IMG/M |
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005045 | Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007281 | Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 2ppm of oxygen, sample B | Engineered | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015084 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine) | Environmental | Open in IMG/M |
3300015170 | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300031039 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FWIRElOz_06816360 | 2124908007 | Soil | LKSFVIGALIAAVVVLGYLYWDSRNNTIFKAPGIEIKKN |
KansclcFeb2_09405410 | 2124908045 | Soil | MDGKSLLIGVLLVGMGVLGYLYWDSQHNTVVKLPGVEIKKN |
deepsgr_01823270 | 2199352025 | Soil | MRSFVIGALVVAVGVLGYLYWDSRQNTLVKLPGVEIKKN |
INPgaii200_07664952 | 2228664022 | Soil | MRGFVIGALVVAVGVLGYLYWDAHNNTVFKAPGVEIKKN |
ICChiseqgaiiDRAFT_23446992 | 3300000033 | Soil | IGVLVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS* |
ICChiseqgaiiDRAFT_23462081 | 3300000033 | Soil | MRSFXIGVLVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS* |
ICChiseqgaiiFebDRAFT_144529682 | 3300000363 | Soil | MRSFFIGVLVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS* |
INPhiseqgaiiFebDRAFT_1007408041 | 3300000364 | Soil | MLIGALIIAVAVLGYLYWDSQNNTIVKVPGVTIKKN* |
INPhiseqgaiiFebDRAFT_1014471122 | 3300000364 | Soil | MDTRSMLIGILVVAVAVVGYLYWDSQHNTVLKVPGVEIKKN* |
INPhiseqgaiiFebDRAFT_1019806314 | 3300000364 | Soil | MRSFVIGALVVAVGVLGYLYWDSQQNTLVKLPGVEIKKN* |
INPhiseqgaiiFebDRAFT_1019971945 | 3300000364 | Soil | MRSFVIGALVIGVGVLGYLYWDAHQNTVFKAPGVEINKN* |
INPhiseqgaiiFebDRAFT_1056325952 | 3300000364 | Soil | MRGXMIAALLGAVIVLGYLYWDSTQNTVFKAPGVEIKRS* |
F24TB_130555133 | 3300000550 | Soil | LMEVEMRSFIIGALVIAVGVLGYLYWDSEHNTLFKAPGIEIKK* |
F14TC_1029312903 | 3300000559 | Soil | MEVEMRSFIIGALVIAVGVLGYLYWDSEHNTLFKAPGIEIKK* |
F14TC_1048884965 | 3300000559 | Soil | LKSFAIGALIVAVVVLGYLYWDSRTNTVFKAPGIEIKK |
JGI1027J12803_1012056581 | 3300000955 | Soil | RHTEEEARMRGFVIGALVVAVGVLGYLYWDAHNNTVFKAPGVEIKKN* |
JGI1027J12803_1067129024 | 3300000955 | Soil | RGLMIAALLGAVIVLGYLYWDSTQNTVFKAPGVEIKRS* |
JGI10216J12902_1019272448 | 3300000956 | Soil | MNAKSMLIGALVVAVAVLGYLYWDSQQNTVVKLPGVTIKKN* |
JGI10216J12902_1019886972 | 3300000956 | Soil | MDGRSLLVGALLVGVIVLGYLYWDSQHNTVFKAPGVEIKKN* |
JGI10216J12902_1078282151 | 3300000956 | Soil | MDGKSLLIGMLAIVAAVLGYLYWDSQYNTVLKAPGVTIKKN* |
C688J35102_1204159732 | 3300002568 | Soil | VPAVCLPVIGALVAAVAVLGYLYWDSQHNTIFKAPGIDIKKN* |
soilH2_101151402 | 3300003324 | Sugarcane Root And Bulk Soil | MKSFVIGALVIAVAVLGFLYWDSEQNTLVKAPGIEIKKN* |
JGI25404J52841_100406871 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MVTXPMEEEMRSFIIGALFVAVAVLGYLYWDSEHNTVFKAPGIEIKK* |
Ga0062593_1004582114 | 3300004114 | Soil | MDGKSLLIGVLLVGMGVLGYLYWDSQHNTVVKLPGVEIKKN* |
Ga0062593_1004943372 | 3300004114 | Soil | MDGKSVVIGALLIGVAVPGYLYWDSQHNTVVKLPGVEIKKN* |
Ga0062593_1007456812 | 3300004114 | Soil | MRSFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS* |
Ga0063356_1001885793 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDGKSLMIGALLVAVVVLGYLYWDSTHNTVFKAPGVEIRAK* |
Ga0063356_1040113202 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRGFVIGALAVAVAVLGYLYWDSQHNTIVKVPGVEIKKN* |
Ga0063356_1060442582 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDGKSLVIGALLIGVVVLGYMVWDSRENTVVKLPGVEIKKN* |
Ga0063356_1062382501 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDGRSMLIGILLVAVVVLGYLYWDRENNTLFKAPGVEIRKN* |
Ga0062595_1020904832 | 3300004479 | Soil | MDGRSLLVGALLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN* |
Ga0066395_100135802 | 3300004633 | Tropical Forest Soil | MRGLMIGALLIAVIVLGYLYWDSTQNTVFKAPGVEIKKS* |
Ga0066395_104127291 | 3300004633 | Tropical Forest Soil | MDGKSLVIGALLIGIVVLGYLYWDSQQNTVFKASGVAIKKN* |
Ga0071328_1092994 | 3300005045 | Permafrost | MDGKSLLIGALIVGMGVLGYMYWDSQHNTVVKLPGVEIKKN* |
Ga0062594_1000505674 | 3300005093 | Soil | MDGKSVVIGALLIGVAVLGYLYWDSQHNTVVKLPGVEIKKN* |
Ga0066388_1000355143 | 3300005332 | Tropical Forest Soil | MKSFVIGALVVAVGVLGYLIRDSRENTVLKAPGVEIKKN* |
Ga0066388_1000560703 | 3300005332 | Tropical Forest Soil | MRSFVIGALVVAVGVLGYLYWDSEHNTVFKAPGVEIKNK* |
Ga0066388_1009186712 | 3300005332 | Tropical Forest Soil | MRGFVVGALVVAVAVLGYMYWDSEHNTLFRAPGVEIKKN* |
Ga0066388_1013821782 | 3300005332 | Tropical Forest Soil | MRGLMIAVLLVAVIVLGYLYWDSTQNTVFKAPGVEIKKS* |
Ga0066388_1014225942 | 3300005332 | Tropical Forest Soil | MDGKSLLIGALVIGIGVLGYLYWDSHENTVFKVPGVEIKKE* |
Ga0066388_1023506162 | 3300005332 | Tropical Forest Soil | MRGFIIGVLVIGAGVLGYLYWDSQHNTVFKAPGVEIKKN* |
Ga0066388_1024074582 | 3300005332 | Tropical Forest Soil | MRSFIIGVLVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS* |
Ga0066388_1030085642 | 3300005332 | Tropical Forest Soil | MRSFIIGVLVIAVGVLGYLYWDSEHNTLFKAPGVEIKKS* |
Ga0066388_1037700682 | 3300005332 | Tropical Forest Soil | MDGKSLLIGALVIGIGVLGYLYWDSHENTVFKAPGVEIKKE* |
Ga0066388_1074565491 | 3300005332 | Tropical Forest Soil | MDGKSVVIGALLIGVAVRGYLYWDSQHNTVVKLPGVEIKKN* |
Ga0066388_1078046271 | 3300005332 | Tropical Forest Soil | LKSVVIGALVAAVVILGYLYWDSRTNTVFKAPGIEIKKN* |
Ga0070668_1012407791 | 3300005347 | Switchgrass Rhizosphere | EATMKSFVIGALVVAVGVLGYLYWDSHENTLVKVPGVEIKKN* |
Ga0070709_102333722 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSFVIGALVIGVGVLGYLYWDAHQNTVFKAPGVEIKKN* |
Ga0070714_1007390392 | 3300005435 | Agricultural Soil | MRGLMIAALLGAVIVLGYLYWDSTQNTVFKAPGVEIKRS* |
Ga0070700_1003146171 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MDGRSLLVGILLVGVAVLGYLYWDSQHNTVFKAPGVEIKKS* |
Ga0070700_1006852313 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSFLIGALFIAVGVLGYLYWDSEHNTVFKAPGIEIKNK* |
Ga0070700_1013577591 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGFVIGALVVAVGVLGYLYWDAEHNTVFKAPGVEIKKN* |
Ga0070700_1018716581 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGFVIGALVVAVGVLGYMYWDSEHNTLVKAPGVEIKKN* |
Ga0070693_1011312351 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | DVERQLKEVTMRSFIIGALAVGALGSSYGDGEHDTVCKALGIEIKKC* |
Ga0070665_1010849292 | 3300005548 | Switchgrass Rhizosphere | MLRRSKEVNMRGFVIGALVVAVGVLGYLYWDAEHNTVFKAPGVEIKKN* |
Ga0066693_103450851 | 3300005566 | Soil | MRSFVIGALVVAVGVLGYLYWDSQQNTLVKLPGVE |
Ga0068857_1019689392 | 3300005577 | Corn Rhizosphere | MRSFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVE |
Ga0068854_1015305562 | 3300005578 | Corn Rhizosphere | DGDPIGKEPQMRSFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS* |
Ga0068859_1024872272 | 3300005617 | Switchgrass Rhizosphere | RSKEVNMRGFVIGALVVAVGVLGYLYWDAEHNTVFKAPGVEIKKN* |
Ga0068864_1015145011 | 3300005618 | Switchgrass Rhizosphere | MDGRSLLIGALVIGVAVLGYLYWDSHENTVVKLPG |
Ga0066905_1001014662 | 3300005713 | Tropical Forest Soil | MRSFLIGALFVAVGVLGYLYWDSEHNTVVKAPGIEIKK* |
Ga0066905_1001674862 | 3300005713 | Tropical Forest Soil | MRGFIIGVLLAAVGLLGYLYWDSQHNTVFKAPGVEIKKN* |
Ga0066905_1001969032 | 3300005713 | Tropical Forest Soil | MRSFVIGALIVAVGVLGYLYWDSEHNTVFKAPGVEIKNK* |
Ga0066905_1003907172 | 3300005713 | Tropical Forest Soil | MRSFIIGALFIAVGVLGYLYWDSEHNTVFKAPGIEIKNK* |
Ga0066905_1016315441 | 3300005713 | Tropical Forest Soil | MRSFIIGVLVVAVGVLGYLYWDSQHNTVFKASGVEIKKS* |
Ga0066905_1021687443 | 3300005713 | Tropical Forest Soil | VRGFIIGVLVIAVGVLGYLYWDSEHNTVLKAPGVEIKKN* |
Ga0068861_1000294695 | 3300005719 | Switchgrass Rhizosphere | MDGRSMLIGILLVTVLVLGYLYWDREHNTVLKAPGVEIRKN* |
Ga0068861_1006102762 | 3300005719 | Switchgrass Rhizosphere | MDGRSLLVGILLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN* |
Ga0066903_1006722034 | 3300005764 | Tropical Forest Soil | MDGKSLIIGVLLIGIVVLGYLYWDSQQNTVFKAPGVEIKKN* |
Ga0066903_1011767161 | 3300005764 | Tropical Forest Soil | MIAVLLVAVIVLGYLYWDSTQNTVFKAPGVEIKKS* |
Ga0066903_1012758014 | 3300005764 | Tropical Forest Soil | MKSFVIGALVVAVGVLGICIRDSRENTVLKAPGVEIKKN* |
Ga0066903_1033150083 | 3300005764 | Tropical Forest Soil | MRGFIIGVLVVVVGVLGYLYWDSEHNTLFKAPGVEIKKN* |
Ga0066903_1054410212 | 3300005764 | Tropical Forest Soil | MRGFIIGALLVTVRVLGYLSWDGEHNTLIKAPGVEIKRN* |
Ga0066903_1068030751 | 3300005764 | Tropical Forest Soil | FIIGVLVVVIGVLGYLYWDSEHNTLFKAPGVEIKKN* |
Ga0068863_1001448843 | 3300005841 | Switchgrass Rhizosphere | LKSILIGALIAAVAVLGYLYWDSRNNTIFRAPGIEIKKD* |
Ga0068858_1012471272 | 3300005842 | Switchgrass Rhizosphere | DGRSMLIGILLVTVLVLGYLYWDREHNTVLKAPGVEIRKN* |
Ga0081455_1000028239 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRGFIIGVLLVAVGVLGYLYWDSEHNTVLKAPGVEIKKN* |
Ga0081540_100061130 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MVTEPMEEEMRSFIIGALFVAVAVLGYLYWDSEHNTVFKAPGIEIKK* |
Ga0066652_1019149992 | 3300006046 | Soil | MNGKSILIGALIIAVAVLGYLYWDSQNNTIVKVPGVTIKKN* |
Ga0075417_104907641 | 3300006049 | Populus Rhizosphere | MRSFIIGALVIAVGVLGYLYWDSEHNTLFKAPGIEIKNK* |
Ga0070716_1011700312 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSFVMGALIIAVGVLGYLYWDSQYNTVLKAPGVEIKKN* |
Ga0070712_1005314812 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSVVIGALLVAVVILGYLYWDSRTNTVFKAPGIEIKKN* |
Ga0075427_101098011 | 3300006194 | Populus Rhizosphere | MRSFIIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIKKS* |
Ga0075422_101072482 | 3300006196 | Populus Rhizosphere | MDGRSLLIGALLVGIAVLGFLYWDTEHNTLFKAPGVEIKKN* |
Ga0075428_1000874374 | 3300006844 | Populus Rhizosphere | MDGKSMLIGALIIGVAVLGYLYWDSQHNTVLQVPGVTIKKN* |
Ga0075428_1002410471 | 3300006844 | Populus Rhizosphere | MRSFIIGVLVVAVGVLGYLYWDREHNTVFKAPGVEIKKN* |
Ga0075428_1004037673 | 3300006844 | Populus Rhizosphere | MRSFVIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIKKS* |
Ga0075428_1027233521 | 3300006844 | Populus Rhizosphere | MRSFIIGALLVAVGVLGYLYWDSQHNTVFKAPGVEIKKS* |
Ga0075421_1009804983 | 3300006845 | Populus Rhizosphere | MDGKSLLIGALIVGVGILGYLYWDSQHNTVVKLPGVEIKKN* |
Ga0075421_1014618593 | 3300006845 | Populus Rhizosphere | MDGRSLLIGVLLVGVAVLGFLYWDTEHNTLFKAPGVEIKKN* |
Ga0075433_100443393 | 3300006852 | Populus Rhizosphere | MRGFVIGILLVAVGVFGYLYWDSEHNTVFKAPGVEIKKN* |
Ga0075433_103194592 | 3300006852 | Populus Rhizosphere | LKSIVIGVLIAAVVVLGYLYWDSQHSTVFKAPGIEIKKN* |
Ga0075433_108511902 | 3300006852 | Populus Rhizosphere | MRSFVIGALVVAVGVLGYLYWDSQQNTRVKLPGVEIKKN* |
Ga0074063_113503771 | 3300006953 | Soil | ILVGALLVAVAVLGYLYWDSRHNTIFKAPGVEIKKN* |
Ga0075419_100824563 | 3300006969 | Populus Rhizosphere | MGGPIGKETSMRSFVIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIKKS* |
Ga0075435_1001295201 | 3300007076 | Populus Rhizosphere | MRGFVIGILLVAVGVFGYLYWDSEHNTVFKAPGVEIKK |
Ga0104349_10469393 | 3300007281 | Aeration Tank Of Activated Sludge Process | MIIGALLVAVGVLGYMYWDSEHNTVLKAPGVEIKKN* |
Ga0099795_102880301 | 3300007788 | Vadose Zone Soil | LKSIVIGALVAAVAVLGYLYWDSRNNTIFKAPGIEIKNN* |
Ga0111539_100482832 | 3300009094 | Populus Rhizosphere | MRSFVIGALVVAVAVLGYLYWDSQHNTLVKLPGVEIKKN* |
Ga0111539_102791043 | 3300009094 | Populus Rhizosphere | MEVEMRSFIIGALFIAVGVLGYLYWDSEHNTVFKAPGIEIKNK* |
Ga0111539_105472463 | 3300009094 | Populus Rhizosphere | MMDGRSLLVGALLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN* |
Ga0111539_110223382 | 3300009094 | Populus Rhizosphere | MRGFMIGALVVAVGVLGYLYWDAGHNTVFKAPGVEIKKN* |
Ga0111539_115339691 | 3300009094 | Populus Rhizosphere | MRGFIIGALVVAVGVLGYLYWDSQRNTVFKAPGVEIKKS* |
Ga0111539_120342192 | 3300009094 | Populus Rhizosphere | LALIVTVALLCYLYWDSRENTVVKLPGVEIKKNL* |
Ga0111539_121010162 | 3300009094 | Populus Rhizosphere | MRCFVIGALVVAVGVLGYLYWDSQQNTLVKLPGVEIKKN* |
Ga0111539_132278302 | 3300009094 | Populus Rhizosphere | MDGKSLVIGALLIGVVVLGYMVWDSRQNTVVKLPGVEIKKN* |
Ga0075418_100691365 | 3300009100 | Populus Rhizosphere | MEVEMRSFIIGALVIAVGVLGYLYWDSEHNTLFKAPGIEIKNK* |
Ga0075418_101183306 | 3300009100 | Populus Rhizosphere | MRSFVIGALVVAVAVLGYLYWDSQHNTLVMLPGVEIKKN* |
Ga0075418_103266183 | 3300009100 | Populus Rhizosphere | SGKEPQMRSFIIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIKKS* |
Ga0075418_104213731 | 3300009100 | Populus Rhizosphere | MRSFIIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIK |
Ga0105091_100191517 | 3300009146 | Freshwater Sediment | MRSFIIGALVVAVGVLGYLYWDSEHNTLFKAPGVEIKKN* |
Ga0105091_104458991 | 3300009146 | Freshwater Sediment | MTMRGFVIGALAVAVAVLGYLYWDSQHNTIVKVPGVEIKKN* |
Ga0105091_106543661 | 3300009146 | Freshwater Sediment | MNGKSMLIGALVVAVGVLGYLYWDSQHNTVLQVPGVTIKKN* |
Ga0114129_105227744 | 3300009147 | Populus Rhizosphere | FVIGALVVAVGVLGYLYWDSQQNTVVKLPGVEIKKN* |
Ga0105243_103717121 | 3300009148 | Miscanthus Rhizosphere | FIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS* |
Ga0105243_126924543 | 3300009148 | Miscanthus Rhizosphere | GFIIGVLVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS* |
Ga0111538_124658081 | 3300009156 | Populus Rhizosphere | MEVEMRSFIIGALFIVVGVLGYLYWDSEHNTLFKAPGIEIKNK* |
Ga0105092_104433482 | 3300009157 | Freshwater Sediment | MDGKSMLIGALVVGVAVFGYLYWDSKHNTVFKAPGVEIKKN* |
Ga0075423_102926593 | 3300009162 | Populus Rhizosphere | MEVEMRSFIIGALFIAVGVLGYLYWDSEHNTVFKAPGIEIKKQ* |
Ga0105241_105931661 | 3300009174 | Corn Rhizosphere | MEVEMRSFLIGALFIAVGVLGYLYWDSEHNTIFKAPGVEIKNK* |
Ga0105238_128266412 | 3300009551 | Corn Rhizosphere | MDGKSVVIGALLIGVAVLAYLYWDSQHNTVVKLPGVEIKKN* |
Ga0105249_102320982 | 3300009553 | Switchgrass Rhizosphere | MRSFVIGALVVAVGVLGYLYWDSQQNTLVKLPGVETKKN* |
Ga0126374_106578781 | 3300009792 | Tropical Forest Soil | MRGFIIGVLVVVIGVLGYLYWDSEHNTLFKAPGVEIKKN* |
Ga0126374_116381791 | 3300009792 | Tropical Forest Soil | MRGFIVVALVVIVGVLGYLYWDSENNTLFKAPGVEIKKN* |
Ga0126384_101112852 | 3300010046 | Tropical Forest Soil | MMGRSKEAAMRGVIIGALVVIVGVLGYLYWDSEHNTLFKAPGVEIKKN* |
Ga0126384_101705691 | 3300010046 | Tropical Forest Soil | MDGKSLIIGALLIGIVVLGYLYWDSQQNTVFKAPGVAIKKN* |
Ga0126382_105012622 | 3300010047 | Tropical Forest Soil | MEVEMRSFLIGALFVAVGVLGYLYWDSEHNTVVKAPGIEIKK* |
Ga0126382_112796511 | 3300010047 | Tropical Forest Soil | MRSFVIGALVVAVGVLGYLYWDSEHNTVFKAPGVEIK |
Ga0127503_100868461 | 3300010154 | Soil | LKSIVIGALVAAVAVLGYLYWDSQHNTIFKAPGIEIKKN* |
Ga0126370_100944382 | 3300010358 | Tropical Forest Soil | MIGALLIAVIVLGYLYWDSTQNTVFKAPGVEIKKS* |
Ga0126376_107517411 | 3300010359 | Tropical Forest Soil | SLLIGALVIGIGVLGYLYWDSHENTVFKAPGVEIKKE* |
Ga0126376_117015101 | 3300010359 | Tropical Forest Soil | MRGFIIGVLVVVIGVQGYLYWDSEHNTLFKAPGVEIKKN* |
Ga0126377_1000223513 | 3300010362 | Tropical Forest Soil | MRSFLIGALCIAVGVLGYLYWDSEHNTVFKAPGIEIKNK* |
Ga0126377_106958981 | 3300010362 | Tropical Forest Soil | MDGKSLLIGALVIGIGVLGYLYWDSHENTLFKAPGVEIKKE* |
Ga0126377_107443102 | 3300010362 | Tropical Forest Soil | MRSFLIGALLIAVGVLGYLYWDSEHNTVFKAPGIEIKKQ* |
Ga0134125_130096031 | 3300010371 | Terrestrial Soil | MRGLIIGVLVVAVGVLGYMYWDSHYNTVFKAPGVEIKKN* |
Ga0134124_106826262 | 3300010397 | Terrestrial Soil | LKSILIGALIAAVAVLGYLYWDSRNNTIFKAPGIEIKKD* |
Ga0126383_105925563 | 3300010398 | Tropical Forest Soil | MDGKSLVIGALLIGIVVLGYLYWDSQQNTVFKAPGVAIKKN* |
Ga0126383_109350273 | 3300010398 | Tropical Forest Soil | IGALLIGIVVLGYLYWDSQQNTVFKAPGFEIKRN* |
Ga0126383_127016632 | 3300010398 | Tropical Forest Soil | MDGKSLLIGALLIGVAVLGYLYWDSQHNTVFKAPGVEIKKN* |
Ga0134127_117631141 | 3300010399 | Terrestrial Soil | MDGKSLLIGVLLVGMGVLGYLYWDSQHNTVVKLPGV |
Ga0134122_100016938 | 3300010400 | Terrestrial Soil | MEVEMRSFIIGALFIAVGVLGYLYWDSEHNTIFKAPGIEIKNK* |
Ga0134121_120853492 | 3300010401 | Terrestrial Soil | VGQGVGVKVFVGVSVLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN* |
Ga0134121_130030351 | 3300010401 | Terrestrial Soil | MEAEMRSFLIGALFIAVGVLGYLYWDSEHNTIFKAPGVEIKNK* |
Ga0137380_108337333 | 3300012206 | Vadose Zone Soil | LKSLVIGALIVAVAVLGYLYWDSRNNTIFKAPGIEIKKN* |
Ga0150985_1101244412 | 3300012212 | Avena Fatua Rhizosphere | MRGFVIGALVVVVGVLGYLYWDSEHNTLVKAPGVEIKKN* |
Ga0150984_1236474301 | 3300012469 | Avena Fatua Rhizosphere | MLRRSWRSATMKSFIIGALVVAVREHNTIFKAPGVEIKKN* |
Ga0157216_104580292 | 3300012668 | Glacier Forefield Soil | MEVIMRGFVIGALVVAVGVLGYLYWDSQHNTVFKAPGIEIKKN* |
Ga0137397_100872574 | 3300012685 | Vadose Zone Soil | LKSLVIGALIVAVAVLGYLYSDSRNNTIFKAPGIEIKKN* |
Ga0157286_103800541 | 3300012908 | Soil | MRSFIIGVLVVGVGVLGYLYWDSQHNTVFKAPGVEIKKS* |
Ga0157301_101350353 | 3300012911 | Soil | MRSFVIGALVVAVGVLGYLYWNSQQNTLVKLPGVEIKKN* |
Ga0137394_102225403 | 3300012922 | Vadose Zone Soil | LKSLVIGALIVAVVVLGYLYWDSRNNTIFEASGIEIKKN* |
Ga0137404_115800402 | 3300012929 | Vadose Zone Soil | LKSIVIGALIVAVVVLGYLYWDSRNNTIFKAPGIEIKKN* |
Ga0164298_112903471 | 3300012955 | Soil | MLCRSKEVNMRGFVIGALVVAVAVLGYLYWDAEHNTVFKAPGVEIKKN* |
Ga0164298_114246841 | 3300012955 | Soil | MEATMRSFMIGALIIAVGVLGYLYWDSEHNTLFKAPGIEIKK* |
Ga0164298_116362192 | 3300012955 | Soil | MDGRSLLVGALLVGVAVLGYLYWDSQHNTVFKAPGVEIKKS* |
Ga0164301_109733442 | 3300012960 | Soil | MRSFMIGALIIVVGVLGYLYWDSEHNTLFKAPGIEIKK* |
Ga0157378_105100942 | 3300013297 | Miscanthus Rhizosphere | MDGRSLLIGALVIGVAVLGYLYWDSHENTGVKRPGVEIKKN* |
Ga0157380_109082572 | 3300014326 | Switchgrass Rhizosphere | NMRGFVIGALVVAVGVLGYLYWDAEHNTVFKAPGVEIKKN* |
Ga0157379_105387433 | 3300014968 | Switchgrass Rhizosphere | DGKSVVIGALLIGVAVLGYLYWDSQHNTVVKLPGVEIKKN* |
Ga0173483_105627441 | 3300015077 | Soil | MKSMLIGALIIAVAVLGYLYWDSQNNTIVKVPGVTIKKN* |
Ga0167654_10245243 | 3300015084 | Glacier Forefield Soil | MEGRSLLIGMLLVGVLVLGYLYWDSQHNTVFKAPGVEIKKN* |
Ga0120098_10612862 | 3300015170 | Fossill | MDGKSLLIGALTVGVGILGYLYWDSQHNTVVELPGVEIKKN* |
Ga0132258_101338393 | 3300015371 | Arabidopsis Rhizosphere | MRGFIIGVLVVIVGVLGYLYWDSEHNTLFKAPGVEIKKN* |
Ga0132258_103559035 | 3300015371 | Arabidopsis Rhizosphere | MRGLIIGALVLAVGVLGYLYWDSTQNTVFKAPGVEIKKS* |
Ga0132258_114413003 | 3300015371 | Arabidopsis Rhizosphere | MEVEMRSFLIGALFIAVGVLGYLYWDSEHNTIFKAPGV |
Ga0132258_120084311 | 3300015371 | Arabidopsis Rhizosphere | MRGFIIGALVVAVGVLGYMYWDREHNTVFKAPGVEIKKN* |
Ga0132256_1010656532 | 3300015372 | Arabidopsis Rhizosphere | MDGKSVVIGALLIGVAVLGYLYWDSQHNTVVKLPGVEVKKN* |
Ga0132255_1057199742 | 3300015374 | Arabidopsis Rhizosphere | MRGFIIGALVVVIGVLGYLYWDSEHNTLFKAPGVEIKKN* |
Ga0182035_113386942 | 3300016341 | Soil | VRGFIIGVLVVVVGVLGYLYWDSEHNALFKAPGVEIKRN |
Ga0182034_113148292 | 3300016371 | Soil | VRGFIIGVLVVVVGVLGYLYWDSEHNALFKAPGIEIKRN |
Ga0187825_101067161 | 3300017930 | Freshwater Sediment | MRGFIIGVLIIGVAVLGYLYWDSEHNTIFKAPGVEIKKN |
Ga0187786_106308173 | 3300017944 | Tropical Peatland | QGRSLLIGALLVGIAVLGYLYWDSQYNTVLKVPGVEIKKN |
Ga0187785_102934902 | 3300017947 | Tropical Peatland | MRGLVIGLLVVAVGVLGYMYWDAQYNTVFKAPGVEIKKN |
Ga0184605_105265481 | 3300018027 | Groundwater Sediment | VNGKSILIGALLVAVAVLGYLYWDSQQNTVLKAPA |
Ga0184626_100579502 | 3300018053 | Groundwater Sediment | MDGKSMLIGALVIGVAVLGYLYWDSQHNTVFKAPGVEIKKN |
Ga0184632_102946532 | 3300018075 | Groundwater Sediment | MRSFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKN |
Ga0190265_104009174 | 3300018422 | Soil | MDGKSLLIGALIVGMGILGYLYWDSQHNTVVKLPGVEIKKN |
Ga0190265_109052741 | 3300018422 | Soil | MDGKSLLIGALIIGMGVLGYMYWDSQHNTVFKAPGVEIKKN |
Ga0190265_110571442 | 3300018422 | Soil | MDGKSLVIGALLVGLAFVGYLYWDSEHNTVFKAPGVEIKKN |
Ga0190265_122307752 | 3300018422 | Soil | MDGKSLLIGALIVGMGVLGYMYWDSQHNTVFKAPGVEIKKN |
Ga0190265_128451531 | 3300018422 | Soil | MDGKSLLIGGLLVAVVVFGYLYWDSQNNVVFKAPGV |
Ga0190272_101092192 | 3300018429 | Soil | MDGKSLLIGALIAGMGILGYLYWDSQHNTVVKLPGVEIKKN |
Ga0190272_104212972 | 3300018429 | Soil | VVAAIGALIVGMGVLGYMYWDSQHNTVFKAPGVEIKKN |
Ga0190272_105757673 | 3300018429 | Soil | MDGKSLLIGALIVGMGVLGYMYWDSQHNTVVKLPGVEIKKN |
Ga0190272_106015261 | 3300018429 | Soil | HGRQSLLIGALIVGMGLLGYMYWDSQHNTVFKAPGVEIKKN |
Ga0190272_108784422 | 3300018429 | Soil | MRGFVIGALVVAVGVLGYLYWDSQHNTVFKAPGIEIKKN |
Ga0190272_111630031 | 3300018429 | Soil | MDGKSLLIGALLVGVVVLGYLYWDSQHNTVFKAPGVEIKAK |
Ga0190268_112679522 | 3300018466 | Soil | MDGKSLLIGALIVGMGVLGYMYWASQHNTVFKAPGVEIKKN |
Ga0190270_104744623 | 3300018469 | Soil | MDGRSMLIGILLVAVVVLGYLYWDRENNTLFKAPGVEIRKN |
Ga0190270_123368111 | 3300018469 | Soil | MKSFIIGALVIAVAVLGYLYWDSQHNTVVKLPGVEIKKN |
Ga0190270_129443492 | 3300018469 | Soil | LKQNQLYLLIGALVVAVAVLGYLYWDSQHNTVVKLPGVEIKKN |
Ga0190270_130319242 | 3300018469 | Soil | MRSFIIGVLVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS |
Ga0190270_132143201 | 3300018469 | Soil | MRGFVIGALAVAVAVLGYLYWDSQHNTIVKLPGVEIKKN |
Ga0190274_109708193 | 3300018476 | Soil | MDGRSLLVGILLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN |
Ga0066669_111193791 | 3300018482 | Grasslands Soil | MNGKSILIGALIIAVAVLGYLYWDSQNNTIVKVPGVTIKKN |
Ga0184646_12178831 | 3300019259 | Groundwater Sediment | REPIMDGKSMLIGALVIGVAVLGYLYWDSQHNTVFKAPGVEIRKN |
Ga0184644_13038552 | 3300019269 | Groundwater Sediment | MRGFVIGALVVAVGVLGYMYWDSEHNTLVKAPGIEIKKN |
Ga0173479_105728902 | 3300019362 | Soil | MDGRSMLIGILLVTVLVLGYLYWDREHNTVLKAPGVEIRKN |
Ga0193741_11451492 | 3300019884 | Soil | MRSFIIGVLVVAVGVLGYLYWDSQNNTIFKAPGVEIKKS |
Ga0193727_11924452 | 3300019886 | Soil | LKSLVIGALIVAVAVLGYLYWDSRNNTIFKAPGIEIKKN |
Ga0179594_100427461 | 3300020170 | Vadose Zone Soil | LKSIVIGALIAAIAVLGYLYWDSRNNTIFKAPGIEIKKN |
Ga0210399_105490371 | 3300020581 | Soil | MRSFVIGALVIGVGVLGYLYWDAHQNTVFKAPGVEIKKN |
Ga0210381_101130662 | 3300021078 | Groundwater Sediment | LKSIVIGALVAAVAVLGYLYWDSQHNTIFKAPGIEIKKN |
Ga0210380_100168833 | 3300021082 | Groundwater Sediment | MRSFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS |
Ga0210402_104130651 | 3300021478 | Soil | YARSKEAIMRGLMIAALLGAVIVLGYLYWDSTQNTVFKAPGVEIKRS |
Ga0126371_120702332 | 3300021560 | Tropical Forest Soil | MRGLMIGALLIAVIVLGYLYWDSTQNTVFKAPGVEIKKS |
Ga0126371_135010041 | 3300021560 | Tropical Forest Soil | IMRGLMIGALLIAVIVLGYLYWDSNQNTVFKAPGVEIKKS |
Ga0224505_101422172 | 3300022214 | Sediment | MRGFIIGALIVAVGLLGYLYWDSEHNTLFKAPGIEIKK |
Ga0179589_101041382 | 3300024288 | Vadose Zone Soil | MDGRSIVVGALLVAVAVLGYLYWDSRNNTIFKAPGVEIKKN |
Ga0207709_112931643 | 3300025935 | Miscanthus Rhizosphere | QEELVMDGKSLLIGVLLVGMGVLGYLYWDSQHNTVVKLPGVEIKKN |
Ga0207665_106219661 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSFVIGALVIGVGVLGYLYWDAHQNTVLKAPGVEIKKN |
Ga0207703_110940241 | 3300026035 | Switchgrass Rhizosphere | RSYDARGEADMDGRSMLIGILLVTVLVLGYLYWDREHNTVLKAPGVEIRKN |
Ga0207675_1012597461 | 3300026118 | Switchgrass Rhizosphere | MRSFVIGALVVAVAVLGYLYWDAQHNTVFKAPGVEIKKN |
Ga0207675_1015284423 | 3300026118 | Switchgrass Rhizosphere | MDGRSLLVGALLVGVAVLGYLYWDSQHNTVFKAPGV |
Ga0207683_114346001 | 3300026121 | Miscanthus Rhizosphere | MDGKSLLIGVLLVGMGVLGYLYWDSQHNTVVKLPGVEI |
Ga0209077_11261341 | 3300027675 | Freshwater Sediment | MRSFIIGALVVAVGVLGYLYWDSEHNTLFKAPGVEIKKN |
Ga0209813_100701563 | 3300027866 | Populus Endosphere | MDGRSLLVGALLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN |
Ga0209813_101872484 | 3300027866 | Populus Endosphere | LLVGILLVGVAVLGYLYWDSQHNTVFKAPGVEIKKN |
Ga0209814_105667141 | 3300027873 | Populus Rhizosphere | MRSFIIGALVIAVGVLGYLYWDSEHNTLFKAPGIEIKNK |
Ga0209465_101297652 | 3300027874 | Tropical Forest Soil | MIAVLLVAVIVLGYLYWDSTQNTVFKAPGVEIKKS |
Ga0209481_101884791 | 3300027880 | Populus Rhizosphere | MGGQSERKPQMRSFIIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIKKS |
Ga0207428_100400622 | 3300027907 | Populus Rhizosphere | MRGFVIGILLVAVGVFGYLYWDSEHNTVFKAPGVEIKKN |
Ga0209382_1000999514 | 3300027909 | Populus Rhizosphere | MDGKSMLIGALIIGVAVLGYLYWDSQHNTVLQVPGVTIKKN |
Ga0209382_100914972 | 3300027909 | Populus Rhizosphere | MRSFIIGVLVVAVGVLGYLYWDREHNTIFKAPGVEIKKS |
Ga0209382_101246701 | 3300027909 | Populus Rhizosphere | MRSFIIGVLVVAVGVLGYLYWDREHNTVFKAPGVEIKKN |
Ga0209382_103236363 | 3300027909 | Populus Rhizosphere | MDGKSLLIGALIVGVGILGYLYWDSQHNTVVKLPGVEIKKN |
Ga0209853_11040761 | 3300027961 | Groundwater Sand | MRSFIIGMLVVAVGVLGYLYWDSQHNTILKAPGVEIKKS |
Ga0209526_108476662 | 3300028047 | Forest Soil | MKTMLIGALIIAVAVLGYLYWDSQNNTIVKVPGVTIKKN |
Ga0268264_116723591 | 3300028381 | Switchgrass Rhizosphere | MRGFVIGALVVAVGVLGYMYWDSEHNTLVKAPGVEIKKN |
Ga0268264_122959911 | 3300028381 | Switchgrass Rhizosphere | MEVTMRGFIIGALVVAVGVLGYLYWDSQHNTVFKAPGVEIKKS |
Ga0247824_105858481 | 3300028809 | Soil | MDGKSLMIGALLVAVVVLGYLYWDSTHNTVFKAPGVEIRAK |
Ga0307302_103250262 | 3300028814 | Soil | LKSIVIGALIAAVAVLGYLYWDSQHNTIFKAPGIEIKKN |
Ga0247827_111927681 | 3300028889 | Soil | IIGTLVVAVGVLGYLYWDSQHNTIFKAPGVEIKKS |
Ga0102760_103439492 | 3300031039 | Soil | MRGFVIGALVVVVGVLGYLYWDSEHNTLVKAPGVEIKKN |
Ga0308189_105300843 | 3300031058 | Soil | GFVIGALVVAVAVLGYLYWDSQYNTVFKAPGVEIKKSP |
Ga0307501_101567481 | 3300031152 | Soil | LKSIVIGALVAAVAVLGYLYWDSQNNTIFKAPGIEIKKN |
Ga0307499_100530721 | 3300031184 | Soil | MRSFIIGALFIAVGVLGYLYWDSEHNTIFKAPGIEIKNK |
Ga0307499_101154973 | 3300031184 | Soil | LKSLVIGALIVAVVVLGYLYWDSRNNTIFKAPGIEIKKNP |
Ga0307499_103322591 | 3300031184 | Soil | MRSFIIGALVVAVGVLGYLYWDSQHNTIFKAPGVEIKKS |
Ga0307505_101900641 | 3300031455 | Soil | MNAKSLAIGGLLVAVAVFGYLYWDSQNNVLFKAPGVE |
Ga0318538_104703132 | 3300031546 | Soil | VRGFFIGVLVVVVGVLGYLYWDSEHNTLFKAPGVEIKKN |
Ga0307468_1002289702 | 3300031740 | Hardwood Forest Soil | MRSFLIGALFIAVGVLGYLYWDSEHNTVFKAPGIEIKNK |
Ga0307468_1004062472 | 3300031740 | Hardwood Forest Soil | MRSFVIGALVVAVGVLGYLYWDSQHNTLVKLPGVEIKKN |
Ga0318540_105246511 | 3300032094 | Soil | MRGFIIGVLVVVVGVLGYLYWDSEHNTLFKAPGVEIK |
Ga0307470_118491231 | 3300032174 | Hardwood Forest Soil | MRGLIIGALAVAVGVLGYLYWDAEHNTVFKAPGVEIKKN |
Ga0307472_1004947111 | 3300032205 | Hardwood Forest Soil | MRGFVIGVLLVAVGVFGYLYWDSEHNTVFKAPGVEIKKN |
Ga0306920_1006962631 | 3300032261 | Soil | MRGFIIGVLVVVVGVLGYLYWDSEHNTLFKAPGVEIKKN |
⦗Top⦘ |