| Basic Information | |
|---|---|
| Family ID | F015727 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 252 |
| Average Sequence Length | 48 residues |
| Representative Sequence | KPTKEVKMNKARLISLMVSLSLLAFYLQGFARGLHFLGHPGSWFDGH |
| Number of Associated Samples | 197 |
| Number of Associated Scaffolds | 252 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 61.75 % |
| % of genes near scaffold ends (potentially truncated) | 36.90 % |
| % of genes from short scaffolds (< 2000 bps) | 89.68 % |
| Associated GOLD sequencing projects | 190 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.143 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.413 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.762 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 37.33% β-sheet: 0.00% Coil/Unstructured: 62.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 252 Family Scaffolds |
|---|---|---|
| PF13432 | TPR_16 | 26.19 |
| PF13424 | TPR_12 | 10.32 |
| PF13560 | HTH_31 | 3.57 |
| PF13181 | TPR_8 | 2.38 |
| PF03109 | ABC1 | 1.98 |
| PF02769 | AIRS_C | 1.98 |
| PF00586 | AIRS | 1.19 |
| PF01467 | CTP_transf_like | 1.19 |
| PF13473 | Cupredoxin_1 | 1.19 |
| PF13374 | TPR_10 | 0.79 |
| PF13627 | LPAM_2 | 0.79 |
| PF00929 | RNase_T | 0.40 |
| PF00501 | AMP-binding | 0.40 |
| PF00496 | SBP_bac_5 | 0.40 |
| PF00581 | Rhodanese | 0.40 |
| PF00005 | ABC_tran | 0.40 |
| PF12804 | NTP_transf_3 | 0.40 |
| PF00905 | Transpeptidase | 0.40 |
| PF07721 | TPR_4 | 0.40 |
| PF10143 | PhosphMutase | 0.40 |
| PF00515 | TPR_1 | 0.40 |
| COG ID | Name | Functional Category | % Frequency in 252 Family Scaffolds |
|---|---|---|---|
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 1.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.14 % |
| Unclassified | root | N/A | 42.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725000|GPWRP_F5MPXY302IWTOC | Not Available | 510 | Open in IMG/M |
| 2228664021|ICCgaii200_c0826593 | Not Available | 501 | Open in IMG/M |
| 2228664022|INPgaii200_c1079161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
| 3300000044|ARSoilOldRDRAFT_c007102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 934 | Open in IMG/M |
| 3300000156|NODE_c0725803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6758 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101248396 | Not Available | 784 | Open in IMG/M |
| 3300000880|AL20A1W_1279543 | Not Available | 568 | Open in IMG/M |
| 3300000956|JGI10216J12902_102876629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 838 | Open in IMG/M |
| 3300000956|JGI10216J12902_106619696 | Not Available | 523 | Open in IMG/M |
| 3300000956|JGI10216J12902_115562675 | Not Available | 678 | Open in IMG/M |
| 3300001205|C688J13580_1011911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 980 | Open in IMG/M |
| 3300001305|C688J14111_10099829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 884 | Open in IMG/M |
| 3300001532|A20PFW1_1147133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 842 | Open in IMG/M |
| 3300001536|A1565W1_11261121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1081 | Open in IMG/M |
| 3300002568|C688J35102_119158762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
| 3300002568|C688J35102_120233945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 940 | Open in IMG/M |
| 3300002568|C688J35102_120387612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
| 3300003267|soilL1_10166508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2197 | Open in IMG/M |
| 3300003659|JGI25404J52841_10041412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 975 | Open in IMG/M |
| 3300003911|JGI25405J52794_10036065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1037 | Open in IMG/M |
| 3300004081|Ga0063454_100027949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1925 | Open in IMG/M |
| 3300004114|Ga0062593_100201377 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300004114|Ga0062593_100769969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 952 | Open in IMG/M |
| 3300004114|Ga0062593_101310524 | Not Available | 768 | Open in IMG/M |
| 3300004156|Ga0062589_101494953 | Not Available | 664 | Open in IMG/M |
| 3300004156|Ga0062589_101998617 | Not Available | 588 | Open in IMG/M |
| 3300004157|Ga0062590_101475715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
| 3300004479|Ga0062595_102038898 | Not Available | 556 | Open in IMG/M |
| 3300004480|Ga0062592_100451554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1043 | Open in IMG/M |
| 3300004799|Ga0058863_10810557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300005093|Ga0062594_100104747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1703 | Open in IMG/M |
| 3300005093|Ga0062594_100229399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1332 | Open in IMG/M |
| 3300005105|Ga0066812_1003948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 856 | Open in IMG/M |
| 3300005162|Ga0066814_10017514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 963 | Open in IMG/M |
| 3300005168|Ga0066809_10020057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1346 | Open in IMG/M |
| 3300005169|Ga0066810_10005143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1705 | Open in IMG/M |
| 3300005171|Ga0066677_10629503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300005175|Ga0066673_10911170 | Not Available | 500 | Open in IMG/M |
| 3300005184|Ga0066671_10322888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 974 | Open in IMG/M |
| 3300005184|Ga0066671_10615777 | Not Available | 705 | Open in IMG/M |
| 3300005332|Ga0066388_100357148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2108 | Open in IMG/M |
| 3300005332|Ga0066388_101839676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1078 | Open in IMG/M |
| 3300005332|Ga0066388_102389036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 958 | Open in IMG/M |
| 3300005347|Ga0070668_100476551 | Not Available | 1077 | Open in IMG/M |
| 3300005355|Ga0070671_100151825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1956 | Open in IMG/M |
| 3300005434|Ga0070709_10125525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1745 | Open in IMG/M |
| 3300005434|Ga0070709_11529837 | Not Available | 542 | Open in IMG/M |
| 3300005435|Ga0070714_102151401 | Not Available | 543 | Open in IMG/M |
| 3300005436|Ga0070713_100064282 | All Organisms → cellular organisms → Bacteria | 3079 | Open in IMG/M |
| 3300005436|Ga0070713_100924466 | Not Available | 839 | Open in IMG/M |
| 3300005441|Ga0070700_100710106 | Not Available | 800 | Open in IMG/M |
| 3300005457|Ga0070662_100285915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1336 | Open in IMG/M |
| 3300005468|Ga0070707_101466913 | Not Available | 649 | Open in IMG/M |
| 3300005553|Ga0066695_10116471 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300005560|Ga0066670_10490914 | Not Available | 755 | Open in IMG/M |
| 3300005713|Ga0066905_100650201 | Not Available | 899 | Open in IMG/M |
| 3300005764|Ga0066903_100124129 | All Organisms → cellular organisms → Bacteria | 3602 | Open in IMG/M |
| 3300005937|Ga0081455_10394163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 963 | Open in IMG/M |
| 3300006057|Ga0075026_101070924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300006572|Ga0074051_11780907 | Not Available | 772 | Open in IMG/M |
| 3300006576|Ga0074047_12019713 | Not Available | 775 | Open in IMG/M |
| 3300006791|Ga0066653_10697520 | Not Available | 524 | Open in IMG/M |
| 3300006847|Ga0075431_100552474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1139 | Open in IMG/M |
| 3300006854|Ga0075425_101818286 | Not Available | 684 | Open in IMG/M |
| 3300006871|Ga0075434_101042464 | Not Available | 832 | Open in IMG/M |
| 3300006903|Ga0075426_10181409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1524 | Open in IMG/M |
| 3300006904|Ga0075424_101939877 | Not Available | 622 | Open in IMG/M |
| 3300007820|Ga0104324_102310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1036 | Open in IMG/M |
| 3300009012|Ga0066710_100290660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2388 | Open in IMG/M |
| 3300009012|Ga0066710_102578229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 732 | Open in IMG/M |
| 3300009012|Ga0066710_103260134 | Not Available | 621 | Open in IMG/M |
| 3300009090|Ga0099827_10840743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 795 | Open in IMG/M |
| 3300009094|Ga0111539_10311018 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300009094|Ga0111539_11083238 | Not Available | 931 | Open in IMG/M |
| 3300009100|Ga0075418_11740343 | Not Available | 678 | Open in IMG/M |
| 3300009137|Ga0066709_103427507 | Not Available | 576 | Open in IMG/M |
| 3300009137|Ga0066709_104462629 | Not Available | 511 | Open in IMG/M |
| 3300009162|Ga0075423_10268701 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300009162|Ga0075423_11282112 | Not Available | 783 | Open in IMG/M |
| 3300009553|Ga0105249_11551248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 735 | Open in IMG/M |
| 3300009789|Ga0126307_10000047 | All Organisms → cellular organisms → Bacteria | 63955 | Open in IMG/M |
| 3300009792|Ga0126374_11380106 | Not Available | 573 | Open in IMG/M |
| 3300009840|Ga0126313_10228158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1438 | Open in IMG/M |
| 3300009840|Ga0126313_10515156 | Not Available | 959 | Open in IMG/M |
| 3300009840|Ga0126313_10540329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 936 | Open in IMG/M |
| 3300009840|Ga0126313_10963907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
| 3300010039|Ga0126309_10001845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7655 | Open in IMG/M |
| 3300010039|Ga0126309_10062044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1823 | Open in IMG/M |
| 3300010039|Ga0126309_10356650 | Not Available | 862 | Open in IMG/M |
| 3300010039|Ga0126309_10573551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
| 3300010039|Ga0126309_10599992 | Not Available | 693 | Open in IMG/M |
| 3300010039|Ga0126309_10976375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300010039|Ga0126309_11092346 | Not Available | 541 | Open in IMG/M |
| 3300010043|Ga0126380_10381199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1039 | Open in IMG/M |
| 3300010043|Ga0126380_11968345 | Not Available | 534 | Open in IMG/M |
| 3300010043|Ga0126380_11988934 | Not Available | 531 | Open in IMG/M |
| 3300010043|Ga0126380_12168140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300010044|Ga0126310_10318004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1079 | Open in IMG/M |
| 3300010044|Ga0126310_10991050 | Not Available | 661 | Open in IMG/M |
| 3300010045|Ga0126311_10761175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
| 3300010099|Ga0127450_1004659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300010143|Ga0126322_1211713 | Not Available | 624 | Open in IMG/M |
| 3300010145|Ga0126321_1163001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1603 | Open in IMG/M |
| 3300010145|Ga0126321_1471750 | Not Available | 521 | Open in IMG/M |
| 3300010146|Ga0126320_1188312 | Not Available | 530 | Open in IMG/M |
| 3300010154|Ga0127503_11232882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1254 | Open in IMG/M |
| 3300010322|Ga0134084_10204932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300010358|Ga0126370_11869873 | Not Available | 583 | Open in IMG/M |
| 3300010359|Ga0126376_10275606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1447 | Open in IMG/M |
| 3300010360|Ga0126372_10238612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1549 | Open in IMG/M |
| 3300010362|Ga0126377_10022873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5174 | Open in IMG/M |
| 3300010373|Ga0134128_12477716 | Not Available | 572 | Open in IMG/M |
| 3300010375|Ga0105239_12294109 | Not Available | 628 | Open in IMG/M |
| 3300011332|Ga0126317_10125829 | Not Available | 671 | Open in IMG/M |
| 3300011332|Ga0126317_10790976 | Not Available | 620 | Open in IMG/M |
| 3300012005|Ga0120161_1140411 | Not Available | 541 | Open in IMG/M |
| 3300012019|Ga0120139_1074515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 831 | Open in IMG/M |
| 3300012200|Ga0137382_10213339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1329 | Open in IMG/M |
| 3300012201|Ga0137365_10346456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1098 | Open in IMG/M |
| 3300012201|Ga0137365_10467606 | Not Available | 928 | Open in IMG/M |
| 3300012204|Ga0137374_10000270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 49490 | Open in IMG/M |
| 3300012206|Ga0137380_10371148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1274 | Open in IMG/M |
| 3300012212|Ga0150985_103311441 | Not Available | 536 | Open in IMG/M |
| 3300012212|Ga0150985_103386554 | Not Available | 740 | Open in IMG/M |
| 3300012212|Ga0150985_118490283 | Not Available | 637 | Open in IMG/M |
| 3300012350|Ga0137372_10102350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2401 | Open in IMG/M |
| 3300012356|Ga0137371_10243763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1404 | Open in IMG/M |
| 3300012469|Ga0150984_115386607 | Not Available | 616 | Open in IMG/M |
| 3300012474|Ga0157356_1026722 | Not Available | 508 | Open in IMG/M |
| 3300012491|Ga0157329_1041042 | Not Available | 518 | Open in IMG/M |
| 3300012507|Ga0157342_1007550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1057 | Open in IMG/M |
| 3300012515|Ga0157338_1018746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 787 | Open in IMG/M |
| 3300012517|Ga0157354_1006542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1056 | Open in IMG/M |
| 3300012885|Ga0157287_1043125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300012898|Ga0157293_10297299 | Not Available | 532 | Open in IMG/M |
| 3300012899|Ga0157299_10006750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1820 | Open in IMG/M |
| 3300012901|Ga0157288_10020124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1264 | Open in IMG/M |
| 3300012910|Ga0157308_10130270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300012915|Ga0157302_10129638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
| 3300013294|Ga0120150_1004122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3423 | Open in IMG/M |
| 3300014488|Ga0182001_10391311 | Not Available | 601 | Open in IMG/M |
| 3300015077|Ga0173483_10316685 | Not Available | 770 | Open in IMG/M |
| 3300015265|Ga0182005_1136566 | Not Available | 706 | Open in IMG/M |
| 3300015371|Ga0132258_11753074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1566 | Open in IMG/M |
| 3300015371|Ga0132258_12160466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1398 | Open in IMG/M |
| 3300015372|Ga0132256_100055472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3699 | Open in IMG/M |
| 3300015372|Ga0132256_100220269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1954 | Open in IMG/M |
| 3300015372|Ga0132256_100430972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1423 | Open in IMG/M |
| 3300015372|Ga0132256_100643149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1176 | Open in IMG/M |
| 3300017654|Ga0134069_1332802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300017997|Ga0184610_1197115 | Not Available | 672 | Open in IMG/M |
| 3300018000|Ga0184604_10214096 | Not Available | 665 | Open in IMG/M |
| 3300018028|Ga0184608_10196378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 883 | Open in IMG/M |
| 3300018028|Ga0184608_10202594 | Not Available | 869 | Open in IMG/M |
| 3300018067|Ga0184611_1181133 | Not Available | 749 | Open in IMG/M |
| 3300018071|Ga0184618_10056779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1439 | Open in IMG/M |
| 3300018072|Ga0184635_10029156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2064 | Open in IMG/M |
| 3300018072|Ga0184635_10138301 | Not Available | 971 | Open in IMG/M |
| 3300018073|Ga0184624_10113002 | Not Available | 1171 | Open in IMG/M |
| 3300018073|Ga0184624_10256470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
| 3300018089|Ga0187774_10409988 | Not Available | 827 | Open in IMG/M |
| 3300018431|Ga0066655_11358815 | Not Available | 513 | Open in IMG/M |
| 3300018433|Ga0066667_11289809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300018465|Ga0190269_10251377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 996 | Open in IMG/M |
| 3300018465|Ga0190269_11594002 | Not Available | 544 | Open in IMG/M |
| 3300018482|Ga0066669_10430614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1127 | Open in IMG/M |
| 3300019254|Ga0184641_1212340 | Not Available | 561 | Open in IMG/M |
| 3300019279|Ga0184642_1372027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300019279|Ga0184642_1631030 | Not Available | 527 | Open in IMG/M |
| 3300019361|Ga0173482_10353048 | Not Available | 667 | Open in IMG/M |
| 3300019362|Ga0173479_10881510 | Not Available | 504 | Open in IMG/M |
| 3300019867|Ga0193704_1010242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1881 | Open in IMG/M |
| 3300019878|Ga0193715_1014331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1711 | Open in IMG/M |
| 3300019890|Ga0193728_1227659 | Not Available | 764 | Open in IMG/M |
| 3300021951|Ga0222624_1110647 | Not Available | 503 | Open in IMG/M |
| 3300022756|Ga0222622_10300679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1104 | Open in IMG/M |
| 3300023261|Ga0247796_1104590 | Not Available | 546 | Open in IMG/M |
| 3300024325|Ga0247678_1012903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1230 | Open in IMG/M |
| 3300025552|Ga0210142_1058779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300025901|Ga0207688_10113124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1577 | Open in IMG/M |
| 3300025903|Ga0207680_10586703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300025917|Ga0207660_10158627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1743 | Open in IMG/M |
| 3300025942|Ga0207689_10465233 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300025945|Ga0207679_11167711 | Not Available | 706 | Open in IMG/M |
| 3300025960|Ga0207651_10094268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2201 | Open in IMG/M |
| 3300025972|Ga0207668_10806077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
| 3300026088|Ga0207641_11307026 | Not Available | 726 | Open in IMG/M |
| 3300026295|Ga0209234_1018641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2622 | Open in IMG/M |
| 3300026763|Ga0207568_105621 | Not Available | 530 | Open in IMG/M |
| 3300026827|Ga0207591_104644 | Not Available | 647 | Open in IMG/M |
| 3300027523|Ga0208890_1007101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1400 | Open in IMG/M |
| 3300027523|Ga0208890_1036260 | Not Available | 756 | Open in IMG/M |
| 3300027874|Ga0209465_10568193 | Not Available | 563 | Open in IMG/M |
| 3300028281|Ga0247689_1029433 | Not Available | 745 | Open in IMG/M |
| 3300028380|Ga0268265_11970048 | Not Available | 591 | Open in IMG/M |
| 3300028710|Ga0307322_10042964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1091 | Open in IMG/M |
| 3300028714|Ga0307309_10044331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 951 | Open in IMG/M |
| 3300028716|Ga0307311_10042010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1199 | Open in IMG/M |
| 3300028716|Ga0307311_10177790 | Not Available | 619 | Open in IMG/M |
| 3300028717|Ga0307298_10008843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2487 | Open in IMG/M |
| 3300028719|Ga0307301_10011136 | Not Available | 2548 | Open in IMG/M |
| 3300028722|Ga0307319_10000366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13866 | Open in IMG/M |
| 3300028744|Ga0307318_10027911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1833 | Open in IMG/M |
| 3300028755|Ga0307316_10189424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300028755|Ga0307316_10328352 | Not Available | 561 | Open in IMG/M |
| 3300028771|Ga0307320_10048255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1570 | Open in IMG/M |
| 3300028784|Ga0307282_10169410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
| 3300028796|Ga0307287_10035071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1804 | Open in IMG/M |
| 3300028796|Ga0307287_10038530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1727 | Open in IMG/M |
| 3300028799|Ga0307284_10003054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4491 | Open in IMG/M |
| 3300028807|Ga0307305_10035021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2301 | Open in IMG/M |
| 3300028814|Ga0307302_10660903 | Not Available | 519 | Open in IMG/M |
| 3300028819|Ga0307296_10203504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1074 | Open in IMG/M |
| 3300028819|Ga0307296_10476996 | Not Available | 682 | Open in IMG/M |
| 3300028824|Ga0307310_10256994 | Not Available | 840 | Open in IMG/M |
| 3300028824|Ga0307310_10747407 | Not Available | 503 | Open in IMG/M |
| 3300028828|Ga0307312_10090194 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
| 3300028828|Ga0307312_11164406 | Not Available | 510 | Open in IMG/M |
| 3300028878|Ga0307278_10014665 | All Organisms → cellular organisms → Bacteria | 3646 | Open in IMG/M |
| 3300028880|Ga0307300_10189673 | Not Available | 662 | Open in IMG/M |
| 3300028889|Ga0247827_10470826 | Not Available | 779 | Open in IMG/M |
| 3300030511|Ga0268241_10025506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1181 | Open in IMG/M |
| 3300030511|Ga0268241_10066159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
| 3300030905|Ga0308200_1125422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300031058|Ga0308189_10394734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
| 3300031093|Ga0308197_10303027 | Not Available | 590 | Open in IMG/M |
| 3300031114|Ga0308187_10091913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 926 | Open in IMG/M |
| 3300031198|Ga0307500_10056769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 961 | Open in IMG/M |
| 3300031446|Ga0170820_15601624 | Not Available | 580 | Open in IMG/M |
| 3300031469|Ga0170819_10502110 | Not Available | 551 | Open in IMG/M |
| 3300031548|Ga0307408_102173696 | Not Available | 536 | Open in IMG/M |
| 3300031901|Ga0307406_10323069 | Not Available | 1195 | Open in IMG/M |
| 3300031938|Ga0308175_100026358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4732 | Open in IMG/M |
| 3300031996|Ga0308176_10212220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1829 | Open in IMG/M |
| 3300032002|Ga0307416_101150659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 881 | Open in IMG/M |
| 3300032074|Ga0308173_11876804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300032122|Ga0310895_10195765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 905 | Open in IMG/M |
| 3300032174|Ga0307470_11312122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300032205|Ga0307472_100587830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 980 | Open in IMG/M |
| 3300032770|Ga0335085_10010991 | All Organisms → cellular organisms → Bacteria | 13464 | Open in IMG/M |
| 3300032770|Ga0335085_10055540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5321 | Open in IMG/M |
| 3300032828|Ga0335080_11857162 | Not Available | 587 | Open in IMG/M |
| 3300033158|Ga0335077_10813277 | Not Available | 950 | Open in IMG/M |
| 3300033433|Ga0326726_10491213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1173 | Open in IMG/M |
| 3300033502|Ga0326731_1117541 | Not Available | 611 | Open in IMG/M |
| 3300033550|Ga0247829_11200480 | Not Available | 629 | Open in IMG/M |
| 3300033550|Ga0247829_11552167 | Not Available | 546 | Open in IMG/M |
| 3300033551|Ga0247830_10793254 | Not Available | 753 | Open in IMG/M |
| 3300034172|Ga0334913_017112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1649 | Open in IMG/M |
| 3300034818|Ga0373950_0050528 | Not Available | 816 | Open in IMG/M |
| 3300034820|Ga0373959_0219927 | Not Available | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.86% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.17% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.78% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.98% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.19% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.19% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.19% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.19% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.19% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.79% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.79% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.40% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.40% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.40% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.40% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.40% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.40% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.40% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.40% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.40% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.40% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.40% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725000 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001532 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005105 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007820 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010099 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010143 | Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012005 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_0M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026763 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026827 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWRP_01793370 | 2067725000 | Soil | MNKARLISLMVTLSMLAFYLEGFARGLGWFFGHGGSWFDGH |
| ICCgaii200_08265931 | 2228664021 | Soil | MSASKPKKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHGGSWFDGH |
| INPgaii200_10791611 | 2228664022 | Soil | MYKARLFTLMASLSLLAFSLQGFARGLNCLLGHPGSWFDGM |
| ARSoilOldRDRAFT_0071022 | 3300000044 | Arabidopsis Rhizosphere | MSASKPMKEVKMNKARLISLMVSLSLVAFYLEGFMRGLRFLGVPGSWFDGH* |
| NODE_07258032 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MNKARLISLMVSLSLLAFYLQGAAHGLHYVFGVPNSWFDGH* |
| INPhiseqgaiiFebDRAFT_1012483962 | 3300000364 | Soil | KPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHSGSWFDGH* |
| AL20A1W_12795431 | 3300000880 | Permafrost | MNKARLISLMVSLSVLAFSFQGYAKGLHFLGVPGSWFDGH* |
| JGI10216J12902_1028766292 | 3300000956 | Soil | MSASKPTKEVKMNKARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH* |
| JGI10216J12902_1066196962 | 3300000956 | Soil | SKPTKEVKMNKARLISLTVSMSLLAFSLQGFAHGLGCALGHPGSWFDGH* |
| JGI10216J12902_1155626752 | 3300000956 | Soil | SKPKKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHGGSWFDGH* |
| C688J13580_10119111 | 3300001205 | Soil | MSASKDPKEVKMNKARLISLMVTLSLTAVYLQGFVRGLGFLGHTGSWFDGH* |
| C688J14111_100998291 | 3300001305 | Soil | MNKTRLITLTVSLSLLAFYLQGFARGLGCLLGHPGSFFDGH* |
| A20PFW1_11471332 | 3300001532 | Permafrost | MSASKPRKEVKMNKARLISLMVSLSVLAFSFQGYARGLHFLGVPGSWFDGH* |
| A1565W1_112611211 | 3300001536 | Permafrost | ASKPRKEVKMNKARLISLMVSLSVLAFSFQGYAKGLHFLGVPGSWFDGH* |
| C688J35102_1191587621 | 3300002568 | Soil | MSASKPRKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFD |
| C688J35102_1202339451 | 3300002568 | Soil | MSASKEPKEVNMNKTRLITLTVSLSLLAFYLEGFARGLGCVLGHPGSWYEH* |
| C688J35102_1203876121 | 3300002568 | Soil | MSASKPTKEVKMYKARLITLMASLSLLAFSLQGFARGLHGLLGHPGSWFDGM* |
| soilL1_101665082 | 3300003267 | Sugarcane Root And Bulk Soil | MNKARLISLTVTLSLLAFSLQGAARGLHCLFGVPGSWFDGH* |
| JGI25404J52841_100414121 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MSASKPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHPGSWFDGH* |
| JGI25405J52794_100360652 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MNKARLISLTVTLSMLAFYLEGFARGLGCFFGHSGSWFDGH* |
| Ga0063454_1000279492 | 3300004081 | Soil | MNKARLISLMVTLSLTAVYLQGFVRGLGFLGHTGSWFDGH* |
| Ga0062593_1002013772 | 3300004114 | Soil | MNKARLISLMVTLSMLAFYLEGFARGLGWFFGHGGSWFDGH* |
| Ga0062593_1007699692 | 3300004114 | Soil | MSASKPKKEVKMNKARLISLMASLSLLAFYLQGFGRGLGLVLGHPGTWFDGH* |
| Ga0062593_1013105242 | 3300004114 | Soil | MYKARLFTLMASLSLLAFSLQGFARGLHCLLGHPGSWFDGM* |
| Ga0062589_1014949531 | 3300004156 | Soil | KEVKMNKARLISLMVSLSMVAFYLEGFMRGLRFLGVPGSWFDGH* |
| Ga0062589_1019986172 | 3300004156 | Soil | MSASKPTKEVKMYKARLFTLMASLSLLAFSLQGFARGLHCLLGHPGSWFDGM* |
| Ga0062590_1014757152 | 3300004157 | Soil | MKEVKMNKARLISLMVSLSMVAFYLEGFMRGLRFLGVPGSWFDGH* |
| Ga0062595_1020388982 | 3300004479 | Soil | MSASKPRKEVTMNKARLISLMVSLSLVAFYLEGFARGLRFLGIPGSWFDGH* |
| Ga0062592_1004515542 | 3300004480 | Soil | MSASRPMKEVKMYKARLISLTVSLSLLAFSLEGFARGLSGVLGHPGSWFDGH* |
| Ga0058863_108105571 | 3300004799 | Host-Associated | MSASKPKKEVKMNKARLISLMASLSLLAFYLQGFSRGLGLILGHPGTWFDGH* |
| Ga0062594_1001047472 | 3300005093 | Soil | MNKARLISLTVTLSMLAFYLEGFARGLGCFFGHPGSWFDGH* |
| Ga0062594_1002293992 | 3300005093 | Soil | MNKARLISLMVSLSLVAFYLEGFARGLRFLGIPGSWFDGH* |
| Ga0066812_10039482 | 3300005105 | Soil | MKKARLISLATSMCLLAFYFEGYARGFGRAFEYLGGPVSWFDGH* |
| Ga0066814_100175142 | 3300005162 | Soil | MKKARLISLTTSLCLLAFYLEGYAKGFGRAFTFLGGPGSWFDGH* |
| Ga0066809_100200571 | 3300005168 | Soil | MSASKPRKEVTMKKARLISLTTSLCLLAFYLEGYARGFGRAFTFLGGPGSWFDGH* |
| Ga0066810_100051432 | 3300005169 | Soil | MKKARLISLTTSLCLLAFYLEGYARGFGRAFTFLGGPGSWFDGH* |
| Ga0066677_106295031 | 3300005171 | Soil | TPPLPGSIAKPLKPFRTSASKPRKEVTMKKARLITLATSLCLLAFYMQGAMRPVARGLDLLGGPGSLFDGHGGG* |
| Ga0066673_109111701 | 3300005175 | Soil | MNKARLISLIASLSLLAFWLEACARGLHFLGGPGSWFDGH* |
| Ga0066671_103228881 | 3300005184 | Soil | MNKTRLITLTVSLSLLAFYLQGFARGLGGLFGHPGSYFDGH* |
| Ga0066671_106157771 | 3300005184 | Soil | MNKARLISLMVSLSLLAFYLQGFVRGLGWLFGHPGSNFDGH* |
| Ga0066388_1003571483 | 3300005332 | Tropical Forest Soil | MNKARLISLTVTLSMLAFYLEGFARGCGLFFGHGGSWFDGH* |
| Ga0066388_1018396762 | 3300005332 | Tropical Forest Soil | MSASNPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHPGSWFDGH* |
| Ga0066388_1023890362 | 3300005332 | Tropical Forest Soil | YRMSASKPKKEVKMNKARLISLMASLSLLAFYLQGFARGFGMILGHPGTWFDGH* |
| Ga0070668_1004765512 | 3300005347 | Switchgrass Rhizosphere | MSASKPTKEVKMYKARLFTLMASLSLLAFSLQGFARGLHCMLGHPGSWFDGM* |
| Ga0070671_1001518252 | 3300005355 | Switchgrass Rhizosphere | MSASRQKKEVKMNKARLISLMASLSLLAFYLQGFARGLGLLFGHPGTWFDGH* |
| Ga0070709_101255253 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASKPKKEVKMNKARLISLMASLSLLAFSLQGFGRGLGLILGHPGTWFDGH* |
| Ga0070709_115298372 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKARLISLMVSLSLLAFYLQGFVRGLGWLLGHPGSNFDGH* |
| Ga0070714_1021514012 | 3300005435 | Agricultural Soil | RQPRHSRMSASKPKKEVKMNKARLISLMASLSLLAFYLQGFGRGLGLILGHPGTWFDGH* |
| Ga0070713_1000642822 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASKPKKEVKMNKARLISLMASLSLLAFYLQGFGRGLGLILGHPGTWFDGH* |
| Ga0070713_1009244662 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SRMSASKPKKEVKMNKARLISLMASLSLLAFSLQGFGRGLGLILGHPGTWFDGH* |
| Ga0070700_1007101061 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASRQKKEVKMNKARLISLMASLSLLAFYLQGFSRGLGLILGHPGTWFDGH* |
| Ga0070662_1002859151 | 3300005457 | Corn Rhizosphere | ARPRKPYRMSASKPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHPGSWFDGH |
| Ga0070707_1014669131 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASKPRKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDGH* |
| Ga0066695_101164712 | 3300005553 | Soil | MNKARLISLTASLCLLAFYFEACARGLHFLGGPGSWFDGH* |
| Ga0066670_104909142 | 3300005560 | Soil | MNKTRLITLTVSLSLLAFYLQGFARGLGGLLGHPGSFFDGH* |
| Ga0066905_1006502012 | 3300005713 | Tropical Forest Soil | MSASKPKKEVKMNKARLISLTVTLSTLAFYLEGFARGLGCFFGHPGSWFDGH* |
| Ga0066903_1001241291 | 3300005764 | Tropical Forest Soil | QPRRYRMSASKPKKEVKMNKARLISLMASLSLLAFYLQGFARGFGMILGHPGTWFDGH* |
| Ga0081455_103941631 | 3300005937 | Tabebuia Heterophylla Rhizosphere | RHASIERLPRHYRTSASKPTKEVTMHKARLISLMATLALLAFYLQGAAQGLQFLGLPSSWFDGH* |
| Ga0075026_1010709241 | 3300006057 | Watersheds | MKKARLISLTASLCLLAFYLEGYARGFGRAFEFLGGPGSWFDGH* |
| Ga0074051_117809072 | 3300006572 | Soil | CIARQLKPYRMSASKPRKEVTMKKARLISLTTSLCLLAFYLEGYARGFGRAFTFLGGPGSWFDGH* |
| Ga0074047_120197132 | 3300006576 | Soil | RQLKPYRMSASKPRKEVTMKKARLISLTTSLCLLAFYLEGYARGFGRAFTFLGGPGSWFDGH* |
| Ga0066653_106975201 | 3300006791 | Soil | MNKARLISLTASLCLLAFYFEACARGLHFLGGPGS |
| Ga0075431_1005524741 | 3300006847 | Populus Rhizosphere | MSASKPKKEVKMNKARLISLMVSLSLVAFYLEGFMRGLRFLGVPGSWFDGH* |
| Ga0075425_1018182862 | 3300006854 | Populus Rhizosphere | MNKARLISLMVSLSMVAFYLEGFMRGLRFLGVPGSWFDGH* |
| Ga0075434_1010424642 | 3300006871 | Populus Rhizosphere | MNKARLISLMVSLSLVAFYLEGFMRGLRFLGVPGSWFDGH* |
| Ga0075426_101814091 | 3300006903 | Populus Rhizosphere | PLGCTARPQRHYRMSASKPKKEVKMNKARLISLMASLSLLAFYLQGFGRGLGLILGHPGTWFDGH* |
| Ga0075424_1019398772 | 3300006904 | Populus Rhizosphere | GCTARPRKPYRMSASKPMKEVTMTKARLISLMASLSLLAFYFEGAARGLGHVGGYCFGWGPGSWFDGH* |
| Ga0104324_1023101 | 3300007820 | Soil | MFASKPRKEVKMNKARLISLMVSLSVLAFSLEGYARGLRFLGIPGSWFDGH* |
| Ga0066710_1002906603 | 3300009012 | Grasslands Soil | SASKPIKEVTMNKARLISLTASLCLLAFYLEGAMRGLHFLGGPGSWFDGH |
| Ga0066710_1025782293 | 3300009012 | Grasslands Soil | PRPYRMSASKPTKEVTMKARLISLTASLCLLAFYFQGAARGLGYFADVLGGPGSWFDGH |
| Ga0066710_1032601341 | 3300009012 | Grasslands Soil | ARTRRQPGFIARPQKPYRMSASKPRKEVTINKERLIYLIASLSLLAFWLEPCARGLHFLGGPGSWFDGH |
| Ga0099827_108407432 | 3300009090 | Vadose Zone Soil | VVKMKARLISLTVSLSFLAFYLQGFARGLHVLGVPGSWFEGS* |
| Ga0111539_103110184 | 3300009094 | Populus Rhizosphere | RKPYRMSASKPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHPGSWFDGH* |
| Ga0111539_110832382 | 3300009094 | Populus Rhizosphere | MKEVKMNKARLISLMVSLSLVAFYLEGFMRGLRFLGVPGSWFDGH* |
| Ga0075418_117403432 | 3300009100 | Populus Rhizosphere | ISLMVSLSMVAFYLEGFMRGLRFLGVPGSWFDGH* |
| Ga0066709_1034275071 | 3300009137 | Grasslands Soil | PLPGSIAKPQKPFRTSASKPRKEVTMKKARLITLATSMCLLAFYLQGAMKPLARGLDFLGGPGSLFDGHGGG* |
| Ga0066709_1044626292 | 3300009137 | Grasslands Soil | MSASKPIKEVTMNKARLISLTASLCLLAFYLEGAMRGLHFLGGPGSWFDG |
| Ga0075423_102687012 | 3300009162 | Populus Rhizosphere | MNKARLISLMASLSLLAFYLQGFGRGLGLILGHPGTWFDGH* |
| Ga0075423_112821121 | 3300009162 | Populus Rhizosphere | MKEVKMNKARLISLMVSLSLVAFYLEGFMRGLRFFGVPGSWFDGH* |
| Ga0105249_115512482 | 3300009553 | Switchgrass Rhizosphere | MYKARLFTLMASLSLLAFSLQGFARGLHCMLGHPGSWFDGM* |
| Ga0126307_1000004761 | 3300009789 | Serpentine Soil | MSASKPRKEVTMNKARLISLMVSLSLLAFSFEGYIRGLRFLGVPGSWFDGH* |
| Ga0126374_113801062 | 3300009792 | Tropical Forest Soil | ASKPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHPGSWFDGH* |
| Ga0126313_102281581 | 3300009840 | Serpentine Soil | MNKVRLISLMVTLSLVAGSLQGFARGLQFLGHGCSWFDGH* |
| Ga0126313_105151562 | 3300009840 | Serpentine Soil | MYKARLISLTVTLSLLAFYLEGFARGLGCFFGQPGSWFDGH* |
| Ga0126313_105403292 | 3300009840 | Serpentine Soil | MSASKPKKEVKMNKARLISLTVTLSLLAFYLQGAAHGLHCFLGAPGSWFDGH* |
| Ga0126313_109639072 | 3300009840 | Serpentine Soil | MSASKPRKEVTMNKTRLISLMVSLSLLAFYLQGFTFGLRCLGVGGSWFDGH* |
| Ga0126309_100018454 | 3300010039 | Serpentine Soil | MSASKPRKEVTMNKARLISLMVSLSLLAFYFEGYVRGLRFLGVPGSWFDGH* |
| Ga0126309_100620442 | 3300010039 | Serpentine Soil | MNKARLISLTVTLSLLAFYLQGAARGLSFLGVPGSWFDGH* |
| Ga0126309_103566502 | 3300010039 | Serpentine Soil | MHKARLISLMVALSLTAVYLQGFARGLEFLGYSGSWFDGH* |
| Ga0126309_105735512 | 3300010039 | Serpentine Soil | MSASKPRKEVKMNKARLISLMVSLSLLAFYLQGFARGLRFLGLPGSWFDGH* |
| Ga0126309_105999921 | 3300010039 | Serpentine Soil | MSASKPTKEVTMKARLISLTVSLSLLAFSFQGFARGLSFLCGGPGSWFDGH* |
| Ga0126309_109763751 | 3300010039 | Serpentine Soil | MHKARLISLMVTLSLTAVYLQGFARGLEFLGHSGSWF |
| Ga0126309_110923461 | 3300010039 | Serpentine Soil | MNKARLISLLSSLCLLAFYLQATGGGTGSWFDGH* |
| Ga0126380_103811991 | 3300010043 | Tropical Forest Soil | MSASKPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHPTSWFDGH* |
| Ga0126380_119683452 | 3300010043 | Tropical Forest Soil | MTKARLISLTTSLCLLAFYFEGYMRGLRFFIGGPGGSWFDGH* |
| Ga0126380_119889341 | 3300010043 | Tropical Forest Soil | MSASKPKKEVKMNKARLISLMASLSLLAFYLQGFARGFGMILGHPGTWFDGH* |
| Ga0126380_121681402 | 3300010043 | Tropical Forest Soil | MSASKSKKEVKMNKTRLISLMASLSLLAFYLQGFARGFGLLLGHPGTWFDGH* |
| Ga0126310_103180042 | 3300010044 | Serpentine Soil | MSASKPRKEVTMNKARLISLMVSLSLLAFYFEGYARGLRFLGVPGSWFDGH* |
| Ga0126310_109910502 | 3300010044 | Serpentine Soil | NKTRLISLMVSLSLLAFYLQGFTFGLRCLGVGGSWFDGH* |
| Ga0126311_107611752 | 3300010045 | Serpentine Soil | KPRKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDGH* |
| Ga0127450_10046592 | 3300010099 | Grasslands Soil | MNKARLISLIASLSLMAFWLEACARGLHFLGGPGSWFDGH* |
| Ga0126322_12117131 | 3300010143 | Soil | MSASKPKKEVKMNKARLISLMASLSLLAFYLQGFARGLGLLLGHPGTWFDGH* |
| Ga0126321_11630012 | 3300010145 | Soil | MKEVKMNKARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH* |
| Ga0126321_14717502 | 3300010145 | Soil | MSASKPKKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHGTSWFDGH* |
| Ga0126320_11883122 | 3300010146 | Soil | MYKARLITLMASLSLLAFSLQGFARGLHGLLGHPGSWFDGM* |
| Ga0127503_112328822 | 3300010154 | Soil | MSASKPIKEVKMNKARLISLMASLSLLAFYLQGFARGFGLLLGHPGTWFDGH* |
| Ga0134084_102049321 | 3300010322 | Grasslands Soil | MKTRLISLIVSLSLLAFWLEACARGLHFLGGGGSWFDGH* |
| Ga0126370_118698731 | 3300010358 | Tropical Forest Soil | RLGFTARQPRRYRMSASKPKKEVKMNKARLISLMASLSLLAFYLQGFGRGLGLILGHPGTWFDGH* |
| Ga0126376_102756062 | 3300010359 | Tropical Forest Soil | MSASKPIKEVKMNKTRLISLMASLSLLAFYLQGFARGFSMLLGHPGTWFDGH* |
| Ga0126372_102386122 | 3300010360 | Tropical Forest Soil | MSASKPKKEVKMNKARLISLMASLSLLAFYLQGFCRGLGMILGHPGTWFDGH* |
| Ga0126377_100228732 | 3300010362 | Tropical Forest Soil | MNKARLISLTVTLSMLAFYLEGFARGLGCFFGHPTSWFDGH* |
| Ga0134128_124777162 | 3300010373 | Terrestrial Soil | RLRACTARPQRLYRMSASKPRKEVTMNKARLISLMVSLSLVAFYLEGFARGLRFLGIPGSWFDGH* |
| Ga0105239_122941092 | 3300010375 | Corn Rhizosphere | MSASRQEKEVKMNKARLISLMASLSLLAFYLQGFARGLGLLFGHPGTWFDGH* |
| Ga0126317_101258292 | 3300011332 | Soil | MNKARLISLMVTLSLLAVYLQGFARGLGYLGHPGSWFDGH* |
| Ga0126317_107909762 | 3300011332 | Soil | MYKTRLITLMASLSLLAFSLQGFARGLNCLLGHPGSWFDGV* |
| Ga0120161_11404111 | 3300012005 | Permafrost | PRPHGCTARPPRPYRMSASKPRKEVKMNKARLISLMVSLSVLAFSLEGYARGLRFLGIPGSWFDGH* |
| Ga0120139_10745152 | 3300012019 | Permafrost | MSASKPRKEVKMNKARLISLMVSLSVLAFSFQGYAKGLHFLGVPG |
| Ga0137382_102133392 | 3300012200 | Vadose Zone Soil | MYKARLITLMASLSLLAFSLQGFARGLHCLLGHPGSWFDGM* |
| Ga0137365_103464562 | 3300012201 | Vadose Zone Soil | MSASKPRKEVKMNKARLIYLTALLCVMAFYFQGFMRLSFLGVPGSWFDGH* |
| Ga0137365_104676062 | 3300012201 | Vadose Zone Soil | MSASKPRKEVKMTKARLISLTTSLCLLAFSFEGYFRGLRFFLGAPGSWFDGH* |
| Ga0137374_1000027032 | 3300012204 | Vadose Zone Soil | MSASKPRKEVKMSKARLISLTASLCMLVFYFAGYMRGLSFFLGHGGSWFDGH* |
| Ga0137380_103711482 | 3300012206 | Vadose Zone Soil | MSASKPIKEVTMNKARLISLTASLCLLAFYLEGAMRGLHFLGGPGSWFDGH* |
| Ga0150985_1033114412 | 3300012212 | Avena Fatua Rhizosphere | MSASKEPKEVNMNKTRLITLTVSLSLLAFYLEGFARGLGSLLGHPGSWYEH* |
| Ga0150985_1033865541 | 3300012212 | Avena Fatua Rhizosphere | MSKARLISLTASLCMLVFYFAGYMRGLGFFLGHGGSWFDVH* |
| Ga0150985_1184902832 | 3300012212 | Avena Fatua Rhizosphere | MNKARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH* |
| Ga0137372_101023502 | 3300012350 | Vadose Zone Soil | MNKARLISLLASLCLLAFYLQAYGGGGTGSWFDGH* |
| Ga0137371_102437632 | 3300012356 | Vadose Zone Soil | MSASKPIKEVTMNKARLISLTASLCLLAFYLEGAMRGLHFLGGPGSWF |
| Ga0150984_1153866072 | 3300012469 | Avena Fatua Rhizosphere | MSKARLISLTASLCMLVFYFAGYMRGLGFFLGHGGSWFDGH* |
| Ga0157356_10267221 | 3300012474 | Unplanted Soil | MNKARLISLTVTLSMLAFYLEGFARGCGWFFGHGGSWFDGH* |
| Ga0157329_10410421 | 3300012491 | Arabidopsis Rhizosphere | MKEVKMNKARLISLMVSLSLVAFYLEGFMRGLRFLGVPGCW |
| Ga0157342_10075502 | 3300012507 | Arabidopsis Rhizosphere | MNKARLISLTVTLSMLAFYLEGFARGLGCFFGHGGSWFDGH* |
| Ga0157338_10187462 | 3300012515 | Arabidopsis Rhizosphere | MSASKPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHGGSWFDGH* |
| Ga0157354_10065422 | 3300012517 | Unplanted Soil | MSASKPKKEVKMNKARLISLTVTLSMLAFYLEGFARGCGWFFGHGGSWFDGH* |
| Ga0157287_10431251 | 3300012885 | Soil | MSASKPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGH |
| Ga0157293_102972991 | 3300012898 | Soil | KARLISLMASLSLLAFYLQGFGRGLGLVLGHPGTWFDGH* |
| Ga0157299_100067502 | 3300012899 | Soil | MSASKPKKEVKMNKARLISLMVSLSLVGFYLEGFARGLGWFFGHGGSWFDGH* |
| Ga0157288_100201241 | 3300012901 | Soil | ASKPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHSGSWFDGH* |
| Ga0157308_101302701 | 3300012910 | Soil | RLISLMVSLSLVAFYLEGFMRGLRFLGVPGSWFDGH* |
| Ga0157302_101296382 | 3300012915 | Soil | LGFTARQPRRSRMSASKPKKEVKMNKARLISLMVSLSLVAFYLEGFMRGLRFLGVPGSWFDGH* |
| Ga0120150_10041222 | 3300013294 | Permafrost | MSASKPRKEVKMNKARLISLMVSLSVLAFSFQGYAKGLHFLGVPGSWFDGH* |
| Ga0182001_103913111 | 3300014488 | Soil | MSASRPKKEVTMNKARLISLTVSLSLLAFYLQGFARVLGFFHPPSMFDGH* |
| Ga0173483_103166851 | 3300015077 | Soil | RMSASKPKKEVKMNKARLISLMASLSLLAFYLQGFGRGLGLVLGHPGTWFDGH* |
| Ga0182005_11365662 | 3300015265 | Rhizosphere | MSASKPKKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHGGSWFDGH* |
| Ga0132258_117530741 | 3300015371 | Arabidopsis Rhizosphere | MSASKPKKEVKMNKARLISLMASLSLLAFYLQGFSRGLGLILGHP |
| Ga0132258_121604661 | 3300015371 | Arabidopsis Rhizosphere | MNKARLISLTVTLSMLAFYLEGFARGCGFFFGHGGSWFDGH* |
| Ga0132256_1000554725 | 3300015372 | Arabidopsis Rhizosphere | ASKPKKEVKMNKARLISLMASLSLLAFYLQGFSRGLGLILGHPGTWFDGH* |
| Ga0132256_1002202692 | 3300015372 | Arabidopsis Rhizosphere | MKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHPGSWFDGH* |
| Ga0132256_1004309721 | 3300015372 | Arabidopsis Rhizosphere | RMSASKPKKEVKMNKARLISLMASLSLLAFSLQGFGRGLGLILGHPGTWFDGH* |
| Ga0132256_1006431492 | 3300015372 | Arabidopsis Rhizosphere | MSASKPKKEVKMNKARLISLMASLSLLAFYLQGFSRGLGLIFRHSGTWFDGH* |
| Ga0134069_13328022 | 3300017654 | Grasslands Soil | EVTMNKARLISLIASLSLLAFWLEACARGLHFLGGPGSWFDGH |
| Ga0187786_101226202 | 3300017944 | Tropical Peatland | MKKARLISLTTSLCLLAFYFEGYAKGFGRAFTFLGGPGSWFDGH |
| Ga0184610_11971151 | 3300017997 | Groundwater Sediment | MSASKPRKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDGH |
| Ga0184604_102140961 | 3300018000 | Groundwater Sediment | MNKARLISLMVSLSLLAFYFEGYVRGLRFLGVPGSWFDGH |
| Ga0184608_101963781 | 3300018028 | Groundwater Sediment | MSASKPTKEVKMNKARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0184608_102025942 | 3300018028 | Groundwater Sediment | MNKARLISLMVSLSLLAFSLQGFARGLHFLGHTGSWFDGH |
| Ga0184611_11811332 | 3300018067 | Groundwater Sediment | MNKARLISLMVSLSLLAFYLQGFARGLHFLGHTGSWFDGH |
| Ga0184618_100567792 | 3300018071 | Groundwater Sediment | MNKARLISLMVSLSVLAFSLQGYARGLHFLGVPGSWFDGH |
| Ga0184635_100291562 | 3300018072 | Groundwater Sediment | MNKARLISLMVSLSLVAFYLEGFARGLRFLGIPGSWFDGH |
| Ga0184635_101383011 | 3300018072 | Groundwater Sediment | RMSASKPTKEVKMNKARLISLTVTLSLLAFYLHGAAHGLHCFLGVPGSWFDGH |
| Ga0184624_101130021 | 3300018073 | Groundwater Sediment | KPTKEVKMNKARLISLMVSLSLLAFYLQGFARGLHFLGHPGSWFDGH |
| Ga0184624_102564702 | 3300018073 | Groundwater Sediment | MNKARLISLTVTLSMLAFYLEGFARGLGCFFGHSGSWFDGH |
| Ga0187774_104099882 | 3300018089 | Tropical Peatland | KKARLISLATSMCLLAFYLQGYAHGFGRAFEYLGGPVSWFDGH |
| Ga0066655_113588151 | 3300018431 | Grasslands Soil | MNKTRLITLTVSLSLLAFYLQGFARGLGGLLGHPGSFFDGH |
| Ga0066667_112898091 | 3300018433 | Grasslands Soil | MNKARLISLTASLCLLAFYLEGFMRGLHFLGGPGSWFDGH |
| Ga0190269_102513772 | 3300018465 | Soil | MSKARLISLTASLCMLVFYFAGYMRGLGFFLGHGGSWFDGH |
| Ga0190269_115940022 | 3300018465 | Soil | LISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0066669_104306142 | 3300018482 | Grasslands Soil | MNKARLISLIASLSLLAFWLEACARGLHFLGGPGSWFDGH |
| Ga0184641_12123402 | 3300019254 | Groundwater Sediment | MNKARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0184642_13720272 | 3300019279 | Groundwater Sediment | MSASKPTKEVKMKARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0184642_16310301 | 3300019279 | Groundwater Sediment | ERTPQQHGCTAKPQKPYRMSASKPTKEVKMNKARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0173482_103530481 | 3300019361 | Soil | MSASKPKKEVKMNKARLISLMASLSLLAFYLQGFGRGLGLVLGHPGTWFDGH |
| Ga0173479_108815101 | 3300019362 | Soil | MYKARLFTLMASLSLLAFSLQGFARGLHCLLGHPGSWFDGM |
| Ga0193704_10102423 | 3300019867 | Soil | MNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDGH |
| Ga0193715_10143312 | 3300019878 | Soil | MNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSC |
| Ga0193728_12276592 | 3300019890 | Soil | MSASKPRKEVKMNKARLISLMVSLSVLAFSFQGYARGLHFLGVPGSWFDGH |
| Ga0222624_11106472 | 3300021951 | Groundwater Sediment | MSASKPRKEVTMNKARLISLMVSLSLVAFYLEGFARGLRFLGIPGSWFDGH |
| Ga0222622_103006791 | 3300022756 | Groundwater Sediment | FRTSASKPRKEVTMKKARLITLATSLCFLAFYLQGAMRPVARGLDFLGGPGSLFDGHGGG |
| Ga0247796_11045902 | 3300023261 | Soil | ARLISLTVTLSMLAFYLEGFARGLGCFFGHSGSWFDGH |
| Ga0247678_10129032 | 3300024325 | Soil | MSASRQKKEVKMNKARLISLMASLSLLAFYLQGFARGLGLLFGHPGTWFDGH |
| Ga0210142_10587791 | 3300025552 | Natural And Restored Wetlands | MNKARLITLMASLSLLAFSLQGFARGLHGLLGHPGSWFDGF |
| Ga0207688_101131241 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKARLISLTVTLSMLAFYLEGFARGLGCFFGHPGSWFDGH |
| Ga0207680_105867032 | 3300025903 | Switchgrass Rhizosphere | KARLISLMASLSLLAFYLQGFGRGLGLILGHPGTWFDGH |
| Ga0207660_101586272 | 3300025917 | Corn Rhizosphere | MSASKPKKEVKMNKARLISLMASLSLLAFYLQGFGRGHGLILGHPGTWFDGH |
| Ga0207689_104652332 | 3300025942 | Miscanthus Rhizosphere | MQPLTVSLSLVAFYLEGFARGLRFLGIPGSWFDGH |
| Ga0207679_111677112 | 3300025945 | Corn Rhizosphere | KARLISLMASLSLLAFYLQGFSRGLGLILGHPGTWFDGH |
| Ga0207651_100942682 | 3300025960 | Switchgrass Rhizosphere | MSASRQKKEVKMNKARLISLMASLSLLAFYLQGFSRGLGLILGHPGTWFDGH |
| Ga0207668_108060771 | 3300025972 | Switchgrass Rhizosphere | MYKARLFTLMASLSLLAFSLQGFARGLHCMLGHPGSWFDGM |
| Ga0207641_113070262 | 3300026088 | Switchgrass Rhizosphere | MSASRQKKEVKMNKARLISLMASLSLLAFYLQGFGRGLGLILGHPGTWFDGH |
| Ga0209234_10186412 | 3300026295 | Grasslands Soil | MNKARLISLTASLCLLAFYFEACARGLHFLGGPGSWFDGH |
| Ga0207568_1056212 | 3300026763 | Soil | QHGCTARPRKPYRMSASKPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHSGSWFDGH |
| Ga0207591_1046442 | 3300026827 | Soil | MSASKPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHSGSWFDGH |
| Ga0208890_10071011 | 3300027523 | Soil | MKKARLISLTTSLCLLAFYLEGYARGFGRAFTFLGGPGSWFDGH |
| Ga0208890_10362601 | 3300027523 | Soil | MKKARLISLATSMCLLAFYFEGYARGFGRAFEYLGGPVSWFDGH |
| Ga0209465_105681932 | 3300027874 | Tropical Forest Soil | MSASKPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHPGSWFDGH |
| Ga0247689_10294332 | 3300028281 | Soil | MNKARLISLMASLSLLAFYLQGFARGLGLLFGHPGTWFDGH |
| Ga0268265_119700482 | 3300028380 | Switchgrass Rhizosphere | EVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHSGSWFDGH |
| Ga0307322_100429641 | 3300028710 | Soil | CTARLPRPYRMSASKPRKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDG |
| Ga0307309_100443312 | 3300028714 | Soil | PHGCTARLPRPYRMSASKPRKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDGH |
| Ga0307311_100420102 | 3300028716 | Soil | TARPPRPYRMSASKPRKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDGH |
| Ga0307311_101777901 | 3300028716 | Soil | TARLPRPYRMSASKPRKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDGH |
| Ga0307298_100088431 | 3300028717 | Soil | SKPRKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDGH |
| Ga0307301_100111361 | 3300028719 | Soil | KARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0307319_100003663 | 3300028722 | Soil | MNKARLFSLTVTLSLMAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0307318_100279112 | 3300028744 | Soil | MNKARLISLMVSLSLLAFYLQGFACGLHFLGHPGSWFDGH |
| Ga0307316_101894242 | 3300028755 | Soil | RLRACTARPQRLYRMSASKPRKEVTMNKARLISLMVSLSLVAFYLEGFARGLRFLGIPGSWFDGH |
| Ga0307316_103283522 | 3300028755 | Soil | MNKARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFD |
| Ga0307320_100482552 | 3300028771 | Soil | MNKARLFSLTVSLSLMAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0307282_101694101 | 3300028784 | Soil | KARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDGH |
| Ga0307287_100350711 | 3300028796 | Soil | RKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDGH |
| Ga0307287_100385302 | 3300028796 | Soil | MSASKPKKEVKMNKARLFSLTVTLSLMAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0307284_100030542 | 3300028799 | Soil | MKARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0307305_100350213 | 3300028807 | Soil | GCTARLPRPYRMSASKPRKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDGH |
| Ga0307302_106609031 | 3300028814 | Soil | NKARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0307296_102035042 | 3300028819 | Soil | ARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDGH |
| Ga0307296_104769961 | 3300028819 | Soil | KPYRMSASKPTKEVKMNKARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0307310_102569942 | 3300028824 | Soil | MSASKPRKEVTMNKARLISLMVSLSLLAFSFEGYVRGLHFLGAPGSWFDGH |
| Ga0307310_107474071 | 3300028824 | Soil | MNKARLISLTVTLSLLAFSLQGCAHGLHFLGVPGSWFDGH |
| Ga0307312_100901943 | 3300028828 | Soil | SASKPRKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDGH |
| Ga0307312_111644061 | 3300028828 | Soil | KMNKARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0307278_100146651 | 3300028878 | Soil | QHGCTAKPQKPYRMSASKPTKEVKMNKARLISLTVTLSLLAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0307300_101896731 | 3300028880 | Soil | PHGCTARLPRPYRMSASKPRKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGAPGSWFDGH |
| Ga0247827_104708262 | 3300028889 | Soil | MSASKPTKEVKMYKARLFTLMASLSLLAFSLQGFARGLHCMLGHPGSWFDGM |
| Ga0268241_100255062 | 3300030511 | Soil | MSASKPKKEVKMNKARLISLMASLSLLAFYLQGFSRGLGFILGHPGTWFDGH |
| Ga0268241_100661591 | 3300030511 | Soil | MNKARLISLTVTLSMLAFYLEGFARGCGFFFGHGGSWFDGH |
| Ga0308200_11254222 | 3300030905 | Soil | MNKARLISLMVSLSLLAMYLEGFARGLRFLGHGGSWFDG |
| Ga0308189_103947341 | 3300031058 | Soil | MSASKPRKEVKMNKARLISLMVSLSLLAFYFEGFARGLHFLGGSGSWFDGH |
| Ga0308197_103030272 | 3300031093 | Soil | CTARPPRPYRMSASKPRKEVTMNKARLISLMVSLSVLAFSLQGFARGLHFLGVPGSWFDG |
| Ga0308187_100919131 | 3300031114 | Soil | MSASKPKKEVKMNKARLFSLTVSLSLMAFYLQGAAHGLHCFLGVPGSWFDGH |
| Ga0307500_100567691 | 3300031198 | Soil | MNKARLISLMVSLSLVAFYLEGFARGLRFLGIPGS |
| Ga0170820_156016241 | 3300031446 | Forest Soil | PRHSRMSASKPKKEVKMNKARLISLMASLSLLAFYLQGFSRGLGLILGHPGTWFDGH |
| Ga0170819_105021101 | 3300031469 | Forest Soil | RQPRRYRMSASKPKKEVKMNKARLISLMASLSLLAFYLQGFSRGLGLILGHPGTWFDGH |
| Ga0307408_1021736961 | 3300031548 | Rhizosphere | CTARPPKPYRMSASKPTKEVKMNKARLISLMVSLSLLAFYLEGAARGLRFLGGPGSWFDG |
| Ga0307406_103230692 | 3300031901 | Rhizosphere | MNKARLISLTVTLSMLAFYLEGFARGLGCFFGHPTSWFDGH |
| Ga0308175_1000263584 | 3300031938 | Soil | MNKARLISLTVTLSMLAFYFEGFARGLGCFFGHGGSWFDGH |
| Ga0308176_102122201 | 3300031996 | Soil | MNKARLISLTVTLSMLAFYLEGFARGLGCFFGHGGSWFDGH |
| Ga0307416_1011506591 | 3300032002 | Rhizosphere | LISLMVSLSLLAFYLEGAARGLRFLGGPGSWFDGH |
| Ga0308173_118768041 | 3300032074 | Soil | MSASKEPKEVNMKTRLITLTVSLSLLAFYLEGFARGLGCLLGHPGSWYEH |
| Ga0310895_101957652 | 3300032122 | Soil | ISLMASLSLLAFYLQGFGRGLGLILGHPGTWFDGH |
| Ga0307470_113121222 | 3300032174 | Hardwood Forest Soil | MNKARLISLMASLSLLAFYLQGFGRGLGLILGHPGTW |
| Ga0307472_1005878302 | 3300032205 | Hardwood Forest Soil | NKARLISLMASLSLLAFYLQGFGRGLGLILGHPGTWFDGH |
| Ga0335085_100109919 | 3300032770 | Soil | MKKARLISLTASMCLLAFYLQGYARGFGKAFEFLGGPGSWFDGH |
| Ga0335085_100555401 | 3300032770 | Soil | LTTSLCLLAFYFEGYAKGFGRAFTFLGGPGSWFDGH |
| Ga0335080_118571622 | 3300032828 | Soil | MSASKPIKEVKMNKARLISLMASLSLLAFYLQGFARGFGLLLGHPGTWFDGH |
| Ga0335077_108132772 | 3300033158 | Soil | TPPLPGCIAKPQKPFRTSASKPTKEVKMKKARLISLATTLCLLAFYMQGAMRPFARGLDFLGGPGSLFDGHGGG |
| Ga0326726_104912131 | 3300033433 | Peat Soil | MKKARLISLTASLCLLAFYLEGYARGFGRAFEFLGGPGSWFDGH |
| Ga0326731_11175411 | 3300033502 | Peat Soil | KPRKEVTMNKARLISLMVSLSLVAFYLEGFARGLRFLGIPGSWFDGH |
| Ga0247829_112004802 | 3300033550 | Soil | MNKARLISLTVTLSLLAFYLEGFARGLGWFFGHPGSWFDGH |
| Ga0247829_115521671 | 3300033550 | Soil | SRMSASKPTKEVKMYKARLFTLMASLSLLAFSLQGFARGLHCMLGHPGSWFDGM |
| Ga0247830_107932542 | 3300033551 | Soil | MNKARLISLTVTLSMLAFSLEGFARGLGCFFGHPGSWFDGH |
| Ga0334913_017112_1365_1520 | 3300034172 | Sub-Biocrust Soil | MSASKPRKEVKMKARLISLTVSLSLLAFSLQGFARGLQVLCGGPGSWFDGH |
| Ga0373950_0050528_527_685 | 3300034818 | Rhizosphere Soil | MSASKPRKEVKMNKARLISLTVSLSMLAFYLEGFARGLGCFFGHPVSWFDGH |
| Ga0373959_0219927_61_219 | 3300034820 | Rhizosphere Soil | MSASKPRKEVKMNKARLISLTVTLSMLAFYLEGFARGLGCFFGHPVSWFDGH |
| ⦗Top⦘ |