Basic Information | |
---|---|
Family ID | F015672 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 253 |
Average Sequence Length | 46 residues |
Representative Sequence | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELD |
Number of Associated Samples | 193 |
Number of Associated Scaffolds | 253 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 70.36 % |
% of genes near scaffold ends (potentially truncated) | 45.45 % |
% of genes from short scaffolds (< 2000 bps) | 88.93 % |
Associated GOLD sequencing projects | 179 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (73.123 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.043 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.850 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.00% β-sheet: 0.00% Coil/Unstructured: 56.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 253 Family Scaffolds |
---|---|---|
PF00133 | tRNA-synt_1 | 49.01 |
PF00293 | NUDIX | 21.34 |
PF00144 | Beta-lactamase | 6.32 |
PF14803 | Nudix_N_2 | 3.56 |
PF13399 | LytR_C | 1.58 |
PF08264 | Anticodon_1 | 1.19 |
PF00282 | Pyridoxal_deC | 0.79 |
PF02012 | BNR | 0.40 |
PF13419 | HAD_2 | 0.40 |
PF03358 | FMN_red | 0.40 |
PF00571 | CBS | 0.40 |
PF07291 | MauE | 0.40 |
COG ID | Name | Functional Category | % Frequency in 253 Family Scaffolds |
---|---|---|---|
COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 49.01 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 49.01 |
COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 49.01 |
COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 49.01 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 6.32 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 6.32 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 6.32 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 73.12 % |
Unclassified | root | N/A | 26.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459016|G1P06HT02F1AF8 | Not Available | 558 | Open in IMG/M |
3300000878|AL9A1W_1004083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1297 | Open in IMG/M |
3300000956|JGI10216J12902_103797921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
3300001538|A10PFW1_11631288 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300002459|JGI24751J29686_10095106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 621 | Open in IMG/M |
3300002568|C688J35102_119520965 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300002568|C688J35102_119696109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
3300002568|C688J35102_120298503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
3300002568|C688J35102_120460212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1087 | Open in IMG/M |
3300002568|C688J35102_120465192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1091 | Open in IMG/M |
3300002568|C688J35102_120596726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1223 | Open in IMG/M |
3300002568|C688J35102_120896317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 2103 | Open in IMG/M |
3300002568|C688J35102_120949764 | All Organisms → cellular organisms → Bacteria | 2868 | Open in IMG/M |
3300002568|C688J35102_120949859 | All Organisms → cellular organisms → Bacteria | 2871 | Open in IMG/M |
3300003267|soilL1_10103819 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
3300003990|Ga0055455_10055809 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300004006|Ga0055453_10061908 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300004081|Ga0063454_100109221 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
3300004114|Ga0062593_100094841 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
3300004156|Ga0062589_100779834 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300004156|Ga0062589_101270906 | Not Available | 709 | Open in IMG/M |
3300004463|Ga0063356_100942254 | Not Available | 1225 | Open in IMG/M |
3300004479|Ga0062595_100116944 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
3300004479|Ga0062595_100438465 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300004479|Ga0062595_102486373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
3300004633|Ga0066395_11041229 | Not Available | 500 | Open in IMG/M |
3300004643|Ga0062591_102281032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 565 | Open in IMG/M |
3300005093|Ga0062594_101692878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
3300005147|Ga0066821_1007026 | Not Available | 743 | Open in IMG/M |
3300005158|Ga0066816_1010156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 687 | Open in IMG/M |
3300005163|Ga0066823_10060104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 707 | Open in IMG/M |
3300005164|Ga0066815_10005131 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
3300005167|Ga0066672_10436427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 856 | Open in IMG/M |
3300005172|Ga0066683_10328877 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300005179|Ga0066684_10283248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1097 | Open in IMG/M |
3300005179|Ga0066684_10979105 | Not Available | 547 | Open in IMG/M |
3300005187|Ga0066675_10380076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1039 | Open in IMG/M |
3300005329|Ga0070683_100000266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 36040 | Open in IMG/M |
3300005330|Ga0070690_100720473 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR26 | 768 | Open in IMG/M |
3300005332|Ga0066388_101144987 | Not Available | 1323 | Open in IMG/M |
3300005332|Ga0066388_101184325 | Not Available | 1304 | Open in IMG/M |
3300005334|Ga0068869_100162785 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
3300005335|Ga0070666_10887338 | Not Available | 659 | Open in IMG/M |
3300005336|Ga0070680_101186967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 660 | Open in IMG/M |
3300005337|Ga0070682_100178199 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
3300005338|Ga0068868_100080136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2616 | Open in IMG/M |
3300005345|Ga0070692_10445578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 827 | Open in IMG/M |
3300005353|Ga0070669_100990187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 721 | Open in IMG/M |
3300005355|Ga0070671_100330030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1300 | Open in IMG/M |
3300005355|Ga0070671_100451621 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300005366|Ga0070659_100040240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3652 | Open in IMG/M |
3300005434|Ga0070709_10209583 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
3300005434|Ga0070709_10850929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 719 | Open in IMG/M |
3300005434|Ga0070709_11037343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
3300005435|Ga0070714_100034462 | All Organisms → cellular organisms → Bacteria | 4239 | Open in IMG/M |
3300005435|Ga0070714_100192540 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
3300005435|Ga0070714_100299512 | Not Available | 1499 | Open in IMG/M |
3300005435|Ga0070714_100702741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 976 | Open in IMG/M |
3300005435|Ga0070714_100885357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 866 | Open in IMG/M |
3300005435|Ga0070714_101114197 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300005435|Ga0070714_101432018 | Not Available | 675 | Open in IMG/M |
3300005436|Ga0070713_101132874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 757 | Open in IMG/M |
3300005436|Ga0070713_101668012 | Not Available | 619 | Open in IMG/M |
3300005437|Ga0070710_11155374 | Not Available | 570 | Open in IMG/M |
3300005438|Ga0070701_10045165 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
3300005439|Ga0070711_100142123 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
3300005439|Ga0070711_100387578 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
3300005439|Ga0070711_100988169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 722 | Open in IMG/M |
3300005444|Ga0070694_100111798 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
3300005466|Ga0070685_10899865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 659 | Open in IMG/M |
3300005518|Ga0070699_100450271 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300005526|Ga0073909_10332020 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300005530|Ga0070679_100120479 | All Organisms → cellular organisms → Bacteria | 2609 | Open in IMG/M |
3300005533|Ga0070734_10812840 | Not Available | 531 | Open in IMG/M |
3300005536|Ga0070697_100777100 | Not Available | 847 | Open in IMG/M |
3300005543|Ga0070672_100333522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1291 | Open in IMG/M |
3300005546|Ga0070696_101006261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 696 | Open in IMG/M |
3300005547|Ga0070693_100222015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1238 | Open in IMG/M |
3300005549|Ga0070704_102107764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300005559|Ga0066700_10884205 | Not Available | 595 | Open in IMG/M |
3300005564|Ga0070664_100051279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3494 | Open in IMG/M |
3300005578|Ga0068854_101858310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
3300005616|Ga0068852_102105161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300005618|Ga0068864_100501996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1167 | Open in IMG/M |
3300005764|Ga0066903_103561630 | Not Available | 839 | Open in IMG/M |
3300005874|Ga0075288_1014972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1060 | Open in IMG/M |
3300006028|Ga0070717_10311569 | Not Available | 1401 | Open in IMG/M |
3300006028|Ga0070717_10329333 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
3300006028|Ga0070717_10417855 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300006028|Ga0070717_11498702 | Not Available | 612 | Open in IMG/M |
3300006046|Ga0066652_100190404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1757 | Open in IMG/M |
3300006163|Ga0070715_10299827 | Not Available | 859 | Open in IMG/M |
3300006175|Ga0070712_100564116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 960 | Open in IMG/M |
3300006573|Ga0074055_11848113 | All Organisms → cellular organisms → Bacteria | 2218 | Open in IMG/M |
3300006605|Ga0074057_10035499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 861 | Open in IMG/M |
3300006755|Ga0079222_10363083 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 986 | Open in IMG/M |
3300006755|Ga0079222_11732865 | Not Available | 601 | Open in IMG/M |
3300006804|Ga0079221_11379361 | Not Available | 559 | Open in IMG/M |
3300006871|Ga0075434_102576768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300006954|Ga0079219_10441823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 883 | Open in IMG/M |
3300007076|Ga0075435_101365343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
3300009090|Ga0099827_11636130 | Not Available | 561 | Open in IMG/M |
3300009098|Ga0105245_10123506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2421 | Open in IMG/M |
3300009098|Ga0105245_10315077 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
3300009098|Ga0105245_11618282 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300009098|Ga0105245_12355930 | Not Available | 586 | Open in IMG/M |
3300009100|Ga0075418_11422315 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300009137|Ga0066709_100167638 | All Organisms → cellular organisms → Bacteria | 2837 | Open in IMG/M |
3300009177|Ga0105248_10360035 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
3300009177|Ga0105248_11203542 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300010361|Ga0126378_10974897 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300010362|Ga0126377_11953214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
3300010371|Ga0134125_11142726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 852 | Open in IMG/M |
3300010371|Ga0134125_11878045 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300010371|Ga0134125_12942256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 517 | Open in IMG/M |
3300010373|Ga0134128_10917491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
3300010375|Ga0105239_11050312 | Not Available | 937 | Open in IMG/M |
3300010375|Ga0105239_11942978 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300010397|Ga0134124_10970209 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300010398|Ga0126383_13456557 | Not Available | 516 | Open in IMG/M |
3300010400|Ga0134122_12641455 | Not Available | 553 | Open in IMG/M |
3300010401|Ga0134121_12390472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
3300010999|Ga0138505_100048523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 610 | Open in IMG/M |
3300011106|Ga0151489_1196412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 802 | Open in IMG/M |
3300011107|Ga0151490_1797497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2343 | Open in IMG/M |
3300011999|Ga0120148_1077134 | Not Available | 653 | Open in IMG/M |
3300012004|Ga0120134_1015860 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300012004|Ga0120134_1051436 | Not Available | 715 | Open in IMG/M |
3300012011|Ga0120152_1191960 | Not Available | 514 | Open in IMG/M |
3300012212|Ga0150985_117039655 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR26 | 523 | Open in IMG/M |
3300012350|Ga0137372_10474868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 934 | Open in IMG/M |
3300012357|Ga0137384_11184417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 608 | Open in IMG/M |
3300012357|Ga0137384_11266274 | Not Available | 584 | Open in IMG/M |
3300012505|Ga0157339_1072206 | Not Available | 500 | Open in IMG/M |
3300012898|Ga0157293_10166926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 636 | Open in IMG/M |
3300012911|Ga0157301_10068456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 966 | Open in IMG/M |
3300012915|Ga0157302_10078815 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300012951|Ga0164300_10879100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
3300012955|Ga0164298_11202562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 574 | Open in IMG/M |
3300012960|Ga0164301_10632516 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300012961|Ga0164302_10768431 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300012961|Ga0164302_11906515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
3300012984|Ga0164309_11676628 | Not Available | 545 | Open in IMG/M |
3300012985|Ga0164308_10113327 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
3300012985|Ga0164308_11197243 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300012987|Ga0164307_10261723 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
3300012989|Ga0164305_10981212 | Not Available | 716 | Open in IMG/M |
3300013096|Ga0157307_1071108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
3300013296|Ga0157374_10832763 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300013766|Ga0120181_1039592 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300013832|Ga0120132_1084868 | Not Available | 651 | Open in IMG/M |
3300014058|Ga0120149_1162058 | Not Available | 618 | Open in IMG/M |
3300014326|Ga0157380_10324169 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
3300014745|Ga0157377_11399202 | Not Available | 551 | Open in IMG/M |
3300014969|Ga0157376_11197828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 788 | Open in IMG/M |
3300015089|Ga0167643_1017743 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300015200|Ga0173480_10566098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300015371|Ga0132258_11926675 | Not Available | 1488 | Open in IMG/M |
3300015372|Ga0132256_101857150 | Not Available | 710 | Open in IMG/M |
3300015374|Ga0132255_102844061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
3300016319|Ga0182033_11743851 | Not Available | 564 | Open in IMG/M |
3300017993|Ga0187823_10078217 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300018054|Ga0184621_10162942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 803 | Open in IMG/M |
3300018060|Ga0187765_11291735 | Not Available | 516 | Open in IMG/M |
3300018431|Ga0066655_11209316 | Not Available | 536 | Open in IMG/M |
3300018433|Ga0066667_10315095 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
3300018433|Ga0066667_12175172 | Not Available | 516 | Open in IMG/M |
3300018433|Ga0066667_12190230 | Not Available | 514 | Open in IMG/M |
3300018468|Ga0066662_10002060 | All Organisms → cellular organisms → Bacteria | 9435 | Open in IMG/M |
3300018476|Ga0190274_13863302 | Not Available | 507 | Open in IMG/M |
3300018482|Ga0066669_10605579 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300019356|Ga0173481_10007250 | All Organisms → cellular organisms → Bacteria | 3022 | Open in IMG/M |
3300019361|Ga0173482_10016268 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
3300019890|Ga0193728_1023595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3073 | Open in IMG/M |
3300019890|Ga0193728_1147750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1037 | Open in IMG/M |
3300020070|Ga0206356_11907790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1125 | Open in IMG/M |
3300020081|Ga0206354_11174400 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300020082|Ga0206353_11080631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 704 | Open in IMG/M |
3300025509|Ga0208848_1004643 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
3300025556|Ga0210120_1096745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 587 | Open in IMG/M |
3300025885|Ga0207653_10108994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 987 | Open in IMG/M |
3300025898|Ga0207692_10407461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 849 | Open in IMG/M |
3300025898|Ga0207692_11186264 | Not Available | 507 | Open in IMG/M |
3300025899|Ga0207642_10478828 | Not Available | 759 | Open in IMG/M |
3300025899|Ga0207642_10488321 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300025899|Ga0207642_10582892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
3300025914|Ga0207671_10051960 | All Organisms → cellular organisms → Bacteria | 3036 | Open in IMG/M |
3300025914|Ga0207671_10436751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1042 | Open in IMG/M |
3300025914|Ga0207671_11022200 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300025916|Ga0207663_10267555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1265 | Open in IMG/M |
3300025920|Ga0207649_10925059 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300025921|Ga0207652_10707886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 898 | Open in IMG/M |
3300025924|Ga0207694_11771452 | Not Available | 519 | Open in IMG/M |
3300025928|Ga0207700_11298826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 648 | Open in IMG/M |
3300025929|Ga0207664_10069220 | All Organisms → cellular organisms → Bacteria | 2838 | Open in IMG/M |
3300025929|Ga0207664_11005207 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300025929|Ga0207664_11863880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
3300025932|Ga0207690_11833351 | Not Available | 506 | Open in IMG/M |
3300025935|Ga0207709_11348558 | Not Available | 590 | Open in IMG/M |
3300025937|Ga0207669_11042969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 688 | Open in IMG/M |
3300025940|Ga0207691_10091337 | All Organisms → cellular organisms → Bacteria | 2728 | Open in IMG/M |
3300025941|Ga0207711_10960016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300026078|Ga0207702_10009569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8135 | Open in IMG/M |
3300026078|Ga0207702_10096894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2595 | Open in IMG/M |
3300026078|Ga0207702_10968590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
3300026121|Ga0207683_10603746 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300026317|Ga0209154_1303899 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300026325|Ga0209152_10412846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 533 | Open in IMG/M |
3300026552|Ga0209577_10333249 | Not Available | 1123 | Open in IMG/M |
3300026878|Ga0208891_1001740 | Not Available | 757 | Open in IMG/M |
3300027401|Ga0208637_1032505 | Not Available | 599 | Open in IMG/M |
3300027469|Ga0207628_101290 | Not Available | 612 | Open in IMG/M |
3300027775|Ga0209177_10048957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1190 | Open in IMG/M |
3300027775|Ga0209177_10217537 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300027869|Ga0209579_10397908 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300028558|Ga0265326_10250827 | Not Available | 511 | Open in IMG/M |
3300028710|Ga0307322_10177008 | Not Available | 576 | Open in IMG/M |
3300028718|Ga0307307_10076823 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR26 | 1001 | Open in IMG/M |
3300028718|Ga0307307_10135351 | Not Available | 765 | Open in IMG/M |
3300028719|Ga0307301_10077127 | Not Available | 1043 | Open in IMG/M |
3300028778|Ga0307288_10230432 | Not Available | 721 | Open in IMG/M |
3300028784|Ga0307282_10533536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
3300028790|Ga0307283_10180424 | Not Available | 596 | Open in IMG/M |
3300028800|Ga0265338_10023345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6363 | Open in IMG/M |
3300028802|Ga0307503_10704819 | Not Available | 568 | Open in IMG/M |
3300028812|Ga0247825_11177685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 559 | Open in IMG/M |
3300028819|Ga0307296_10186262 | Not Available | 1125 | Open in IMG/M |
3300028824|Ga0307310_10094445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1322 | Open in IMG/M |
3300028824|Ga0307310_10434228 | Not Available | 655 | Open in IMG/M |
3300028884|Ga0307308_10122014 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300028889|Ga0247827_10168132 | Not Available | 1182 | Open in IMG/M |
3300031251|Ga0265327_10003928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13616 | Open in IMG/M |
3300031544|Ga0318534_10311763 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300031670|Ga0307374_10182594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1544 | Open in IMG/M |
3300031799|Ga0318565_10610966 | Not Available | 524 | Open in IMG/M |
3300031805|Ga0318497_10745345 | Not Available | 549 | Open in IMG/M |
3300031890|Ga0306925_10813949 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR26 | 968 | Open in IMG/M |
3300031896|Ga0318551_10622902 | Not Available | 623 | Open in IMG/M |
3300031938|Ga0308175_100275099 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
3300031938|Ga0308175_101055965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 899 | Open in IMG/M |
3300031938|Ga0308175_102286034 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300031938|Ga0308175_102400914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
3300031939|Ga0308174_10121468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1906 | Open in IMG/M |
3300031939|Ga0308174_10241070 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300031939|Ga0308174_10735988 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR26 | 825 | Open in IMG/M |
3300032067|Ga0318524_10200334 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300032074|Ga0308173_12241188 | Not Available | 515 | Open in IMG/M |
3300032205|Ga0307472_101540708 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300032898|Ga0335072_10466962 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
3300032955|Ga0335076_10381400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1295 | Open in IMG/M |
3300033475|Ga0310811_11282195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 587 | Open in IMG/M |
3300034090|Ga0326723_0096903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1273 | Open in IMG/M |
3300034268|Ga0372943_0000168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 27606 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.04% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.95% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.95% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.56% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.56% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.77% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.37% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.37% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.19% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.19% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.19% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.19% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.19% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.19% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.19% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.19% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.19% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.58% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.79% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.40% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.40% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.40% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.40% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.40% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.40% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.40% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.40% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.40% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.40% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.40% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.40% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.40% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.40% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.40% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.40% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.40% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
3300000878 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
3300005158 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA | Environmental | Open in IMG/M |
3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026878 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC (SPAdes) | Environmental | Open in IMG/M |
3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
3300027469 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK07-E (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2ZMR_04567170 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID |
AL9A1W_10040831 | 3300000878 | Permafrost | PGGSDPMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCGNSDA* |
JGI10216J12902_1037979211 | 3300000956 | Soil | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHA |
A10PFW1_116312881 | 3300001538 | Permafrost | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCGNSDA* |
JGI24751J29686_100951062 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | EETTMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRRELS* |
C688J35102_1195209651 | 3300002568 | Soil | MDELQETQVEIDERWLAEWFEFGFAELGSYLAKYAAFDDYCHRRHIID* |
C688J35102_1196961092 | 3300002568 | Soil | MDELQEKHVEIDERWLSEWFEFGFSELGCYLAKHAAFDDYCHR |
C688J35102_1202985033 | 3300002568 | Soil | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRRYHD* |
C688J35102_1204602122 | 3300002568 | Soil | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELD* |
C688J35102_1204651922 | 3300002568 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID* |
C688J35102_1205967263 | 3300002568 | Soil | MDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDHSG |
C688J35102_1208963172 | 3300002568 | Soil | VIRALPEETMMDELQETTVEIDERWLSEWFEFGFSEMGSYLAKHAAFEEYCRREIS* |
C688J35102_1209497643 | 3300002568 | Soil | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD* |
C688J35102_1209498592 | 3300002568 | Soil | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRRYHD* |
soilL1_101038192 | 3300003267 | Sugarcane Root And Bulk Soil | MDELHQTHVEIDERWLAEWFEFGFSELGFYLAKHAAFDDYCHRREID* |
Ga0055455_100558092 | 3300003990 | Natural And Restored Wetlands | MDELDEKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCHKHELD* |
Ga0055453_100619083 | 3300004006 | Natural And Restored Wetlands | MDELHDTHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHE |
Ga0063454_1001092212 | 3300004081 | Soil | MMDELQETTVEIDERWLSEWFEFGFSEMGSYLAKHAAFEEYCRREIS* |
Ga0062593_1000948412 | 3300004114 | Soil | MDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS* |
Ga0062589_1007798342 | 3300004156 | Soil | MDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD* |
Ga0062589_1012709062 | 3300004156 | Soil | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDF |
Ga0063356_1009422542 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDELQEKHVEIDERWLAEWFEFGFAELGSYLAKYAAFDDYCHRHELD* |
Ga0062595_1001169443 | 3300004479 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSIDF* |
Ga0062595_1004384652 | 3300004479 | Soil | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID* |
Ga0062595_1024863731 | 3300004479 | Soil | MDELQEKHVEIDERWLSEWFEFGFSELGCYLAKYAAFDDYCHRHDHD* |
Ga0066395_110412291 | 3300004633 | Tropical Forest Soil | MDELHDKQVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHQLEY* |
Ga0062591_1022810322 | 3300004643 | Soil | HPGPRPEETTMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS* |
Ga0062594_1016928782 | 3300005093 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHEID* |
Ga0066821_10070262 | 3300005147 | Soil | PMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD* |
Ga0066816_10101561 | 3300005158 | Soil | KHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID* |
Ga0066823_100601042 | 3300005163 | Soil | MDELHDKQVEIDERWLAEWFEFGFSELGTYLAKYAAFDDYCHRHQLEL* |
Ga0066815_100051311 | 3300005164 | Soil | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHY |
Ga0066672_104364271 | 3300005167 | Soil | MDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHEHNG* |
Ga0066683_103288772 | 3300005172 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSKI* |
Ga0066684_102832482 | 3300005179 | Soil | TTMDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSTSR* |
Ga0066684_109791051 | 3300005179 | Soil | MDELYDKHVEIDERWLTEWFEFGFAELASYLAKHAAFDDFCHKNELD* |
Ga0066675_103800762 | 3300005187 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSTSR* |
Ga0070683_10000026612 | 3300005329 | Corn Rhizosphere | MDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRRELS* |
Ga0070690_1007204731 | 3300005330 | Switchgrass Rhizosphere | PGGDIEMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD* |
Ga0066388_1011449872 | 3300005332 | Tropical Forest Soil | MDELTDRHVEIDERWLAEWFEFGFTELGSYLAKHAAFDDYCHRRELD* |
Ga0066388_1011843251 | 3300005332 | Tropical Forest Soil | MDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDHNG* |
Ga0068869_1001627852 | 3300005334 | Miscanthus Rhizosphere | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDRHELD* |
Ga0070666_108873382 | 3300005335 | Switchgrass Rhizosphere | MDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD* |
Ga0070680_1011869671 | 3300005336 | Corn Rhizosphere | MDELQEKQVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCANNDAA* |
Ga0070682_1001781992 | 3300005337 | Corn Rhizosphere | MDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDQHELD* |
Ga0068868_1000801365 | 3300005338 | Miscanthus Rhizosphere | MDELQEKHVEIDERWLSEWFEFGFSELGCYLAKHAAFDDYCH |
Ga0070692_104455781 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | ELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDQHELD* |
Ga0070669_1009901871 | 3300005353 | Switchgrass Rhizosphere | DKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID* |
Ga0070671_1003300302 | 3300005355 | Switchgrass Rhizosphere | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHDHNG* |
Ga0070671_1004516212 | 3300005355 | Switchgrass Rhizosphere | GDIEMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD* |
Ga0070659_1000402401 | 3300005366 | Corn Rhizosphere | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCH |
Ga0070709_102095833 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELG* |
Ga0070709_108509292 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | EEAIMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD* |
Ga0070709_110373432 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCHKHELD* |
Ga0070714_1000344622 | 3300005435 | Agricultural Soil | MDELQETHVEIDERWLSEWFEFGFSELGCYLAKHAAFDDYCHRHEHNG* |
Ga0070714_1001925402 | 3300005435 | Agricultural Soil | MDELQEKHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDQLD* |
Ga0070714_1002995121 | 3300005435 | Agricultural Soil | MDELHEKHVEIDERWLSEWFEFGFAELASYLAKHAAFDDYCHRRELD* |
Ga0070714_1007027412 | 3300005435 | Agricultural Soil | CPEEAIMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD* |
Ga0070714_1008853572 | 3300005435 | Agricultural Soil | TPPEETTMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDSNG* |
Ga0070714_1011141971 | 3300005435 | Agricultural Soil | TMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD* |
Ga0070714_1014320181 | 3300005435 | Agricultural Soil | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELG* |
Ga0070713_1011328742 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EAIMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELG* |
Ga0070713_1016680121 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDFNG* |
Ga0070710_111553742 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD* |
Ga0070701_100451653 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID* |
Ga0070711_1001421232 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDAYCQRHEDLG* |
Ga0070711_1003875781 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PPPEETTMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHYHD* |
Ga0070711_1009881691 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDQHELD* |
Ga0070694_1001117983 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID* |
Ga0070685_108998652 | 3300005466 | Switchgrass Rhizosphere | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRH |
Ga0070699_1004502713 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHK |
Ga0073909_103320202 | 3300005526 | Surface Soil | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHYHD* |
Ga0070679_1001204791 | 3300005530 | Corn Rhizosphere | MDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYC |
Ga0070734_108128402 | 3300005533 | Surface Soil | MDELHDTHVEIDERWLTEWFEFGFAELGSYLAKHAAFDDYLHKHGIDEF* |
Ga0070697_1007771002 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELHETHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSIDI* |
Ga0070672_1003335222 | 3300005543 | Miscanthus Rhizosphere | MDELQEKQVEIDERWLSEWFEFGFSELSSYLAKHAAFDDYCQRHYHD* |
Ga0070696_1010062612 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID* |
Ga0070693_1002220151 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | IMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDQHELD* |
Ga0070704_1021077641 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHEI |
Ga0066700_108842052 | 3300005559 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDV* |
Ga0070664_1000512793 | 3300005564 | Corn Rhizosphere | DKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID* |
Ga0068854_1018583101 | 3300005578 | Corn Rhizosphere | MDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDD |
Ga0068852_1021051612 | 3300005616 | Corn Rhizosphere | MDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHA |
Ga0068864_1005019963 | 3300005618 | Switchgrass Rhizosphere | MDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDF |
Ga0066903_1035616302 | 3300005764 | Tropical Forest Soil | MDELQEKRVEIDERWLSEWFEFGFAEMSSYLAKHAAFDDYCTRHELD* |
Ga0075288_10149721 | 3300005874 | Rice Paddy Soil | MDELHDRHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID* |
Ga0070717_103115691 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELD* |
Ga0070717_103293332 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELQEKHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHDHFG* |
Ga0070717_104178552 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELQETHVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCHRHDFNG* |
Ga0070717_114987022 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKYAAFDDYCHRHELD* |
Ga0066652_1001904042 | 3300006046 | Soil | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYLHKNEID* |
Ga0070715_102998272 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDQHELD* |
Ga0070712_1005641162 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELKDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCANNDAA* |
Ga0074055_118481132 | 3300006573 | Soil | VEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD* |
Ga0074057_100354991 | 3300006605 | Soil | AMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHEID* |
Ga0079222_103630832 | 3300006755 | Agricultural Soil | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHA |
Ga0079222_117328652 | 3300006755 | Agricultural Soil | MDELHEKHVEIDERWLCEWFEFGFAELSSYLAKHAAFDDFIHRHELD* |
Ga0079221_113793612 | 3300006804 | Agricultural Soil | MDEVHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID* |
Ga0075434_1025767681 | 3300006871 | Populus Rhizosphere | MDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCH |
Ga0079219_104418232 | 3300006954 | Agricultural Soil | MDELQDKHVEIVERWLSECFEFGFAELSSYLAKHAAFDDYCHNNEID* |
Ga0075435_1013653431 | 3300007076 | Populus Rhizosphere | MDELQEKHVEIDERWLSEWFEFGFSELGCYLAKHAAFDDYCHRHDFE* |
Ga0099827_116361301 | 3300009090 | Vadose Zone Soil | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYLHKNEMD* |
Ga0105245_101235061 | 3300009098 | Miscanthus Rhizosphere | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFD |
Ga0105245_103150771 | 3300009098 | Miscanthus Rhizosphere | MDELQEKHVEIDERWLSEWFEFGFSELGCYLAKHAALDGYCHRHDFE |
Ga0105245_116182822 | 3300009098 | Miscanthus Rhizosphere | TTMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD* |
Ga0105245_123559302 | 3300009098 | Miscanthus Rhizosphere | PEEAIMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD* |
Ga0075418_114223152 | 3300009100 | Populus Rhizosphere | MDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCRREQS* |
Ga0066709_1001676385 | 3300009137 | Grasslands Soil | MDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSNI* |
Ga0105248_103600353 | 3300009177 | Switchgrass Rhizosphere | MDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELDEPR |
Ga0105248_112035421 | 3300009177 | Switchgrass Rhizosphere | MDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFYDFCDKHELD* |
Ga0126378_109748972 | 3300010361 | Tropical Forest Soil | MDELQEKRVEIDERWLSEWFEFGFAEMSSYLAKYAAFDDYCTRHELD* |
Ga0126377_119532142 | 3300010362 | Tropical Forest Soil | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID* |
Ga0134125_111427262 | 3300010371 | Terrestrial Soil | VEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELD* |
Ga0134125_118780452 | 3300010371 | Terrestrial Soil | MDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFADYCHKSEID* |
Ga0134125_129422562 | 3300010371 | Terrestrial Soil | DERWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS* |
Ga0134128_109174911 | 3300010373 | Terrestrial Soil | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEI |
Ga0105239_110503122 | 3300010375 | Corn Rhizosphere | EMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD* |
Ga0105239_119429781 | 3300010375 | Corn Rhizosphere | EKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD* |
Ga0134124_109702092 | 3300010397 | Terrestrial Soil | MDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD* |
Ga0126383_134565571 | 3300010398 | Tropical Forest Soil | MDELQEKHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDHNG* |
Ga0134122_126414551 | 3300010400 | Terrestrial Soil | PPEETTMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD* |
Ga0134121_123904721 | 3300010401 | Terrestrial Soil | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYH |
Ga0138505_1000485231 | 3300010999 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNESD* |
Ga0151489_11964122 | 3300011106 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEIV* |
Ga0151490_17974972 | 3300011107 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNDYLHKNEID* |
Ga0120148_10771342 | 3300011999 | Permafrost | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCGHNDG* |
Ga0120134_10158603 | 3300012004 | Permafrost | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAA |
Ga0120134_10514362 | 3300012004 | Permafrost | MDELYDKHVEIDERWLMEWFEFGFSELSSYLAKYAAFDDFCGNQDV* |
Ga0120152_11919601 | 3300012011 | Permafrost | MDELQDRHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDAL* |
Ga0150985_1170396551 | 3300012212 | Avena Fatua Rhizosphere | TPPGGDIEMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD* |
Ga0137372_104748682 | 3300012350 | Vadose Zone Soil | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKYAAFDEYLHKNELD* |
Ga0137384_111844171 | 3300012357 | Vadose Zone Soil | ERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELG* |
Ga0137384_112662742 | 3300012357 | Vadose Zone Soil | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCHQNELD* |
Ga0157339_10722061 | 3300012505 | Arabidopsis Rhizosphere | MDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID* |
Ga0157293_101669261 | 3300012898 | Soil | MDELQETTVEIDDRWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS* |
Ga0157301_100684561 | 3300012911 | Soil | ELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS* |
Ga0157302_100788151 | 3300012915 | Soil | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYC |
Ga0164300_108791001 | 3300012951 | Soil | MDELYDKHVEIDERWLTEWFEFGFAELSSYLTKHAAFDDFCDKHELG* |
Ga0164298_112025622 | 3300012955 | Soil | GGNRHPGPRPEETTMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS |
Ga0164301_106325161 | 3300012960 | Soil | ETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCANNDAA* |
Ga0164302_107684311 | 3300012961 | Soil | DERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD* |
Ga0164302_119065151 | 3300012961 | Soil | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCANNDAA* |
Ga0164309_116766282 | 3300012984 | Soil | EEAIMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELG* |
Ga0164308_101133272 | 3300012985 | Soil | MDELQEKQVEIDERWLSERFEFGFSELGSYLAKHAAFDDYCQRHYHD* |
Ga0164308_111972432 | 3300012985 | Soil | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHYHDEVIAP* |
Ga0164307_102617233 | 3300012987 | Soil | MDELYDKHVEIDERWLTEWFEFGFADLSSYLAKHAAFDDFCDKHELD* |
Ga0164305_109812122 | 3300012989 | Soil | MDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDSNG* |
Ga0157307_10711081 | 3300013096 | Soil | MDELQETTVEIDERWLSEWVELGFAEMGCYLAKHAAFDDYCRREQS* |
Ga0157374_108327632 | 3300013296 | Miscanthus Rhizosphere | QEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD* |
Ga0120181_10395923 | 3300013766 | Permafrost | MDELYDKHVEIDERWLTEWFEFGFSELSSYLAKYAAFDDFCGNQDV* |
Ga0120132_10848681 | 3300013832 | Permafrost | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCGNNDA* |
Ga0120149_11620582 | 3300014058 | Permafrost | MDELYDKHVEIDERWLMEWFEFGFSELSSYLAKYAAFDDFCGHNDG* |
Ga0157380_103241692 | 3300014326 | Switchgrass Rhizosphere | MDELQEKHVEIDERLLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD* |
Ga0157377_113992021 | 3300014745 | Miscanthus Rhizosphere | HVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD* |
Ga0157376_111978282 | 3300014969 | Miscanthus Rhizosphere | PSVEAEIASPSRTAALSGGSAMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHEID* |
Ga0167643_10177432 | 3300015089 | Glacier Forefield Soil | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCGDKDV* |
Ga0173480_105660981 | 3300015200 | Soil | MDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAF |
Ga0132258_119266752 | 3300015371 | Arabidopsis Rhizosphere | GGSLMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID* |
Ga0132256_1018571502 | 3300015372 | Arabidopsis Rhizosphere | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNE* |
Ga0132255_1028440611 | 3300015374 | Arabidopsis Rhizosphere | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDD |
Ga0182033_117438512 | 3300016319 | Soil | MDELQEKRVEIDERWLSEWFEFGFAEMSSYLAKHAAFDDYCTRHELS |
Ga0187823_100782171 | 3300017993 | Freshwater Sediment | MDELQETHVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCHRHDFNG |
Ga0184621_101629422 | 3300018054 | Groundwater Sediment | MDELHEKHVEIDERWLSEWFEFGFTELSSYLAKHAAFNEYLHNNEID |
Ga0187765_112917351 | 3300018060 | Tropical Peatland | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCHKHELD |
Ga0066655_112093162 | 3300018431 | Grasslands Soil | KHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD |
Ga0066667_103150952 | 3300018433 | Grasslands Soil | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELD |
Ga0066667_121751721 | 3300018433 | Grasslands Soil | MDELHEKHVEIAERWLSESFEFGFAELSCYLATHAAVNENLHKHEL |
Ga0066667_121902302 | 3300018433 | Grasslands Soil | HVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSTSR |
Ga0066662_100020602 | 3300018468 | Grasslands Soil | MDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHEHNG |
Ga0190274_138633022 | 3300018476 | Soil | MDELQEKHVEIDERWLAEWFEFGFAELGSYLAKYAAFDDYCHRHELD |
Ga0066669_106055792 | 3300018482 | Grasslands Soil | MDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSTSR |
Ga0173481_100072503 | 3300019356 | Soil | MDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS |
Ga0173482_100162683 | 3300019361 | Soil | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD |
Ga0193728_10235953 | 3300019890 | Soil | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCGNSDA |
Ga0193728_11477501 | 3300019890 | Soil | MDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCDKHELG |
Ga0206356_119077902 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDQHELD |
Ga0206354_111744002 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD |
Ga0206353_110806311 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | SLMDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID |
Ga0208848_10046433 | 3300025509 | Arctic Peat Soil | MDELYDKHVEIDERWLTEWFEFGFAELGSYLAKHAAFDDFCGDQDI |
Ga0210120_10967452 | 3300025556 | Natural And Restored Wetlands | MDELHDTHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFL |
Ga0207653_101089942 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD |
Ga0207692_104074612 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELG |
Ga0207692_111862642 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDSNG |
Ga0207642_104788282 | 3300025899 | Miscanthus Rhizosphere | MDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID |
Ga0207642_104883212 | 3300025899 | Miscanthus Rhizosphere | RPRPEEIIEMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD |
Ga0207642_105828922 | 3300025899 | Miscanthus Rhizosphere | MDELQEKHVEIDERWLAEWFEFGFAELGSYLAKYAAFDDYCH |
Ga0207671_100519605 | 3300025914 | Corn Rhizosphere | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHY |
Ga0207671_104367512 | 3300025914 | Corn Rhizosphere | AGCPEEAIMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD |
Ga0207671_110222002 | 3300025914 | Corn Rhizosphere | MDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCD |
Ga0207663_102675551 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EIDERWLSEWFEFGFSELGSYLAKHAAFDAYCQRHEDLG |
Ga0207649_109250592 | 3300025920 | Corn Rhizosphere | MDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRRELS |
Ga0207652_107078861 | 3300025921 | Corn Rhizosphere | GGDIEMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD |
Ga0207694_117714522 | 3300025924 | Corn Rhizosphere | VEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD |
Ga0207700_112988262 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ETTMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCANNDAA |
Ga0207664_100692203 | 3300025929 | Agricultural Soil | MDELQETHVEIDERWLSEWFEFGFSELGCYLAKHAAFDDYCHRHEHNG |
Ga0207664_110052072 | 3300025929 | Agricultural Soil | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELG |
Ga0207664_118638802 | 3300025929 | Agricultural Soil | MDELQEKHVEIDERWLSEWFEFGFSELGCYLAKYAAFDDYCHRHD |
Ga0207690_118333512 | 3300025932 | Corn Rhizosphere | NRHPGPRPEETTMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRRELS |
Ga0207709_113485582 | 3300025935 | Miscanthus Rhizosphere | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHEID |
Ga0207669_110429692 | 3300025937 | Miscanthus Rhizosphere | HEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHEID |
Ga0207691_100913373 | 3300025940 | Miscanthus Rhizosphere | MDELQEKQVEIDERWLSEWFEFGFSELSSYLAKHAAFDDYCQRHYHD |
Ga0207711_109600162 | 3300025941 | Switchgrass Rhizosphere | MDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHEL |
Ga0207702_100095691 | 3300026078 | Corn Rhizosphere | MDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHA |
Ga0207702_100968941 | 3300026078 | Corn Rhizosphere | MDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKN |
Ga0207702_109685903 | 3300026078 | Corn Rhizosphere | MDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYC |
Ga0207683_106037461 | 3300026121 | Miscanthus Rhizosphere | MDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDY |
Ga0209154_13038992 | 3300026317 | Soil | DELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHEHNG |
Ga0209152_104128462 | 3300026325 | Soil | IDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD |
Ga0209577_103332493 | 3300026552 | Soil | MDELYDKHVEIDERWLTEWFEFGFAELASYLAKHAAFDDFCHKNELD |
Ga0208891_10017402 | 3300026878 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID |
Ga0208637_10325051 | 3300027401 | Soil | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAF |
Ga0207628_1012902 | 3300027469 | Soil | MDELQEKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDQHELD |
Ga0209177_100489572 | 3300027775 | Agricultural Soil | ERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD |
Ga0209177_102175371 | 3300027775 | Agricultural Soil | MDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDD |
Ga0209579_103979082 | 3300027869 | Surface Soil | MDELHDTHVEIDERWLTEWFEFGFAELGSYLAKHAAFDDYLHKHGIDEF |
Ga0265326_102508271 | 3300028558 | Rhizosphere | DKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELD |
Ga0307322_101770082 | 3300028710 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDAFLHKHELD |
Ga0307307_100768232 | 3300028718 | Soil | PEETTMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHYHD |
Ga0307307_101353512 | 3300028718 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKYAAFDDFLHKNELD |
Ga0307301_100771272 | 3300028719 | Soil | MDELHEKHVEIDERWLSEWFEFGFTELSSYMAKHAAFNEYLHNNEID |
Ga0307288_102304322 | 3300028778 | Soil | MDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDFNG |
Ga0307282_105335361 | 3300028784 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKYAAFDDFLHKNEID |
Ga0307283_101804241 | 3300028790 | Soil | LQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHYHD |
Ga0265338_100233453 | 3300028800 | Rhizosphere | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELD |
Ga0307503_107048192 | 3300028802 | Soil | MDELQDKHVEIDERWLSEWFEFGFSELGCYLAKYAAFDDYCHRHEFD |
Ga0247825_111776851 | 3300028812 | Soil | SGGSLMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID |
Ga0307296_101862621 | 3300028819 | Soil | GGGNRTTRTAALSGGSLMDELHEKHVEIDERWLSEWFEFGFTELSSYLAKHAAFNEYLHNNEID |
Ga0307310_100944452 | 3300028824 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSIDI |
Ga0307310_104342282 | 3300028824 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHNHELD |
Ga0307308_101220143 | 3300028884 | Soil | MDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNE |
Ga0247827_101681321 | 3300028889 | Soil | PRPEEIIEMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKYAAFDDYCHRHELD |
Ga0265327_100039281 | 3300031251 | Rhizosphere | DMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELD |
Ga0318534_103117632 | 3300031544 | Soil | MDELQEKHVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHDQFD |
Ga0307374_101825942 | 3300031670 | Soil | MDELRDTHVEIDERWLTEWFEFGFAELGAYLAKHAAFEDYLHKHGIDEF |
Ga0318565_106109662 | 3300031799 | Soil | QTPPEETTMDELQEKHVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHDQFD |
Ga0318497_107453451 | 3300031805 | Soil | GRANRPEQTPPEETTMDELQEKHVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHDQFD |
Ga0306925_108139491 | 3300031890 | Soil | TPPEETTMDELQEKHVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHDQFD |
Ga0318551_106229021 | 3300031896 | Soil | MDELQEKRVEIDERWLSEWFEFGFAEMSSYLAKHAAFDDYCTRHELD |
Ga0308175_1002750992 | 3300031938 | Soil | MDELYDKHVEIDERWLTEWFEFGFAELSGYLAKHAAFDDFCDKHELD |
Ga0308175_1010559651 | 3300031938 | Soil | RTAALSGGSLMDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID |
Ga0308175_1022860342 | 3300031938 | Soil | MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKQA |
Ga0308175_1024009142 | 3300031938 | Soil | MDELYEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHNHELD |
Ga0308174_101214682 | 3300031939 | Soil | HVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID |
Ga0308174_102410702 | 3300031939 | Soil | MDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRRYHD |
Ga0308174_107359882 | 3300031939 | Soil | MDELQEKHVEIDERWLSEWFEFGFSELGCYLAKHAAFDDYCHRHDFE |
Ga0318524_102003342 | 3300032067 | Soil | MDELQEKHVEIDERWLSEWFEFGFSELGSYLAKLAAFDDYCQRHDQFD |
Ga0308173_122411882 | 3300032074 | Soil | LQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHEHNG |
Ga0307472_1015407082 | 3300032205 | Hardwood Forest Soil | MDELHEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD |
Ga0335072_104669622 | 3300032898 | Soil | MMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELD |
Ga0335076_103814002 | 3300032955 | Soil | MDELHDKHVEIDERWLSEWFEFGFAELASYLAKHAAFDDYCHRREID |
Ga0310811_112821951 | 3300033475 | Soil | IDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID |
Ga0326723_0096903_3_143 | 3300034090 | Peat Soil | DELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID |
Ga0372943_0000168_1595_1738 | 3300034268 | Soil | MDELQEKHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCDRHDTD |
⦗Top⦘ |