NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F015672

Metagenome / Metatranscriptome Family F015672

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F015672
Family Type Metagenome / Metatranscriptome
Number of Sequences 253
Average Sequence Length 46 residues
Representative Sequence MDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELD
Number of Associated Samples 193
Number of Associated Scaffolds 253

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 70.36 %
% of genes near scaffold ends (potentially truncated) 45.45 %
% of genes from short scaffolds (< 2000 bps) 88.93 %
Associated GOLD sequencing projects 179
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.123 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.043 % of family members)
Environment Ontology (ENVO) Unclassified
(27.273 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.850 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.00%    β-sheet: 0.00%    Coil/Unstructured: 56.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 253 Family Scaffolds
PF00133tRNA-synt_1 49.01
PF00293NUDIX 21.34
PF00144Beta-lactamase 6.32
PF14803Nudix_N_2 3.56
PF13399LytR_C 1.58
PF08264Anticodon_1 1.19
PF00282Pyridoxal_deC 0.79
PF02012BNR 0.40
PF13419HAD_2 0.40
PF03358FMN_red 0.40
PF00571CBS 0.40
PF07291MauE 0.40

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 253 Family Scaffolds
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 49.01
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 49.01
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 49.01
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 49.01
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 6.32
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 6.32
COG2367Beta-lactamase class ADefense mechanisms [V] 6.32
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.12 %
UnclassifiedrootN/A26.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459016|G1P06HT02F1AF8Not Available558Open in IMG/M
3300000878|AL9A1W_1004083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1297Open in IMG/M
3300000956|JGI10216J12902_103797921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium693Open in IMG/M
3300001538|A10PFW1_11631288All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300002459|JGI24751J29686_10095106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi621Open in IMG/M
3300002568|C688J35102_119520965All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300002568|C688J35102_119696109All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300002568|C688J35102_120298503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria975Open in IMG/M
3300002568|C688J35102_120460212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1087Open in IMG/M
3300002568|C688J35102_120465192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1091Open in IMG/M
3300002568|C688J35102_120596726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1223Open in IMG/M
3300002568|C688J35102_120896317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium2103Open in IMG/M
3300002568|C688J35102_120949764All Organisms → cellular organisms → Bacteria2868Open in IMG/M
3300002568|C688J35102_120949859All Organisms → cellular organisms → Bacteria2871Open in IMG/M
3300003267|soilL1_10103819All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300003990|Ga0055455_10055809All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300004006|Ga0055453_10061908All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300004081|Ga0063454_100109221All Organisms → cellular organisms → Bacteria1346Open in IMG/M
3300004114|Ga0062593_100094841All Organisms → cellular organisms → Bacteria2078Open in IMG/M
3300004156|Ga0062589_100779834All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300004156|Ga0062589_101270906Not Available709Open in IMG/M
3300004463|Ga0063356_100942254Not Available1225Open in IMG/M
3300004479|Ga0062595_100116944All Organisms → cellular organisms → Bacteria1464Open in IMG/M
3300004479|Ga0062595_100438465All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300004479|Ga0062595_102486373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300004633|Ga0066395_11041229Not Available500Open in IMG/M
3300004643|Ga0062591_102281032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi565Open in IMG/M
3300005093|Ga0062594_101692878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium660Open in IMG/M
3300005147|Ga0066821_1007026Not Available743Open in IMG/M
3300005158|Ga0066816_1010156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium687Open in IMG/M
3300005163|Ga0066823_10060104All Organisms → cellular organisms → Bacteria → Terrabacteria group707Open in IMG/M
3300005164|Ga0066815_10005131All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300005167|Ga0066672_10436427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium856Open in IMG/M
3300005172|Ga0066683_10328877All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300005179|Ga0066684_10283248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1097Open in IMG/M
3300005179|Ga0066684_10979105Not Available547Open in IMG/M
3300005187|Ga0066675_10380076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1039Open in IMG/M
3300005329|Ga0070683_100000266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria36040Open in IMG/M
3300005330|Ga0070690_100720473All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR26768Open in IMG/M
3300005332|Ga0066388_101144987Not Available1323Open in IMG/M
3300005332|Ga0066388_101184325Not Available1304Open in IMG/M
3300005334|Ga0068869_100162785All Organisms → cellular organisms → Bacteria1738Open in IMG/M
3300005335|Ga0070666_10887338Not Available659Open in IMG/M
3300005336|Ga0070680_101186967All Organisms → cellular organisms → Bacteria → Terrabacteria group660Open in IMG/M
3300005337|Ga0070682_100178199All Organisms → cellular organisms → Bacteria1482Open in IMG/M
3300005338|Ga0068868_100080136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2616Open in IMG/M
3300005345|Ga0070692_10445578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium827Open in IMG/M
3300005353|Ga0070669_100990187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium721Open in IMG/M
3300005355|Ga0070671_100330030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1300Open in IMG/M
3300005355|Ga0070671_100451621All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300005366|Ga0070659_100040240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3652Open in IMG/M
3300005434|Ga0070709_10209583All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300005434|Ga0070709_10850929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium719Open in IMG/M
3300005434|Ga0070709_11037343All Organisms → cellular organisms → Bacteria → Terrabacteria group654Open in IMG/M
3300005435|Ga0070714_100034462All Organisms → cellular organisms → Bacteria4239Open in IMG/M
3300005435|Ga0070714_100192540All Organisms → cellular organisms → Bacteria1862Open in IMG/M
3300005435|Ga0070714_100299512Not Available1499Open in IMG/M
3300005435|Ga0070714_100702741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium976Open in IMG/M
3300005435|Ga0070714_100885357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium866Open in IMG/M
3300005435|Ga0070714_101114197All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300005435|Ga0070714_101432018Not Available675Open in IMG/M
3300005436|Ga0070713_101132874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium757Open in IMG/M
3300005436|Ga0070713_101668012Not Available619Open in IMG/M
3300005437|Ga0070710_11155374Not Available570Open in IMG/M
3300005438|Ga0070701_10045165All Organisms → cellular organisms → Bacteria2260Open in IMG/M
3300005439|Ga0070711_100142123All Organisms → cellular organisms → Bacteria1801Open in IMG/M
3300005439|Ga0070711_100387578All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300005439|Ga0070711_100988169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium722Open in IMG/M
3300005444|Ga0070694_100111798All Organisms → cellular organisms → Bacteria1947Open in IMG/M
3300005466|Ga0070685_10899865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium659Open in IMG/M
3300005518|Ga0070699_100450271All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300005526|Ga0073909_10332020All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300005530|Ga0070679_100120479All Organisms → cellular organisms → Bacteria2609Open in IMG/M
3300005533|Ga0070734_10812840Not Available531Open in IMG/M
3300005536|Ga0070697_100777100Not Available847Open in IMG/M
3300005543|Ga0070672_100333522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1291Open in IMG/M
3300005546|Ga0070696_101006261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium696Open in IMG/M
3300005547|Ga0070693_100222015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1238Open in IMG/M
3300005549|Ga0070704_102107764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300005559|Ga0066700_10884205Not Available595Open in IMG/M
3300005564|Ga0070664_100051279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3494Open in IMG/M
3300005578|Ga0068854_101858310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium553Open in IMG/M
3300005616|Ga0068852_102105161All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300005618|Ga0068864_100501996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1167Open in IMG/M
3300005764|Ga0066903_103561630Not Available839Open in IMG/M
3300005874|Ga0075288_1014972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1060Open in IMG/M
3300006028|Ga0070717_10311569Not Available1401Open in IMG/M
3300006028|Ga0070717_10329333All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300006028|Ga0070717_10417855All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300006028|Ga0070717_11498702Not Available612Open in IMG/M
3300006046|Ga0066652_100190404All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1757Open in IMG/M
3300006163|Ga0070715_10299827Not Available859Open in IMG/M
3300006175|Ga0070712_100564116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium960Open in IMG/M
3300006573|Ga0074055_11848113All Organisms → cellular organisms → Bacteria2218Open in IMG/M
3300006605|Ga0074057_10035499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium861Open in IMG/M
3300006755|Ga0079222_10363083All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae986Open in IMG/M
3300006755|Ga0079222_11732865Not Available601Open in IMG/M
3300006804|Ga0079221_11379361Not Available559Open in IMG/M
3300006871|Ga0075434_102576768All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300006954|Ga0079219_10441823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium883Open in IMG/M
3300007076|Ga0075435_101365343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300009090|Ga0099827_11636130Not Available561Open in IMG/M
3300009098|Ga0105245_10123506All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2421Open in IMG/M
3300009098|Ga0105245_10315077All Organisms → cellular organisms → Bacteria1539Open in IMG/M
3300009098|Ga0105245_11618282All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300009098|Ga0105245_12355930Not Available586Open in IMG/M
3300009100|Ga0075418_11422315All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300009137|Ga0066709_100167638All Organisms → cellular organisms → Bacteria2837Open in IMG/M
3300009177|Ga0105248_10360035All Organisms → cellular organisms → Bacteria1638Open in IMG/M
3300009177|Ga0105248_11203542All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300010361|Ga0126378_10974897All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300010362|Ga0126377_11953214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300010371|Ga0134125_11142726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium852Open in IMG/M
3300010371|Ga0134125_11878045All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300010371|Ga0134125_12942256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi517Open in IMG/M
3300010373|Ga0134128_10917491All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium969Open in IMG/M
3300010375|Ga0105239_11050312Not Available937Open in IMG/M
3300010375|Ga0105239_11942978All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300010397|Ga0134124_10970209All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300010398|Ga0126383_13456557Not Available516Open in IMG/M
3300010400|Ga0134122_12641455Not Available553Open in IMG/M
3300010401|Ga0134121_12390472All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300010999|Ga0138505_100048523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium610Open in IMG/M
3300011106|Ga0151489_1196412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium802Open in IMG/M
3300011107|Ga0151490_1797497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2343Open in IMG/M
3300011999|Ga0120148_1077134Not Available653Open in IMG/M
3300012004|Ga0120134_1015860All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300012004|Ga0120134_1051436Not Available715Open in IMG/M
3300012011|Ga0120152_1191960Not Available514Open in IMG/M
3300012212|Ga0150985_117039655All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR26523Open in IMG/M
3300012350|Ga0137372_10474868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium934Open in IMG/M
3300012357|Ga0137384_11184417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium608Open in IMG/M
3300012357|Ga0137384_11266274Not Available584Open in IMG/M
3300012505|Ga0157339_1072206Not Available500Open in IMG/M
3300012898|Ga0157293_10166926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium636Open in IMG/M
3300012911|Ga0157301_10068456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium966Open in IMG/M
3300012915|Ga0157302_10078815All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300012951|Ga0164300_10879100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300012955|Ga0164298_11202562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi574Open in IMG/M
3300012960|Ga0164301_10632516All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300012961|Ga0164302_10768431All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300012961|Ga0164302_11906515All Organisms → cellular organisms → Bacteria → Terrabacteria group505Open in IMG/M
3300012984|Ga0164309_11676628Not Available545Open in IMG/M
3300012985|Ga0164308_10113327All Organisms → cellular organisms → Bacteria1934Open in IMG/M
3300012985|Ga0164308_11197243All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300012987|Ga0164307_10261723All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300012989|Ga0164305_10981212Not Available716Open in IMG/M
3300013096|Ga0157307_1071108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300013296|Ga0157374_10832763All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300013766|Ga0120181_1039592All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300013832|Ga0120132_1084868Not Available651Open in IMG/M
3300014058|Ga0120149_1162058Not Available618Open in IMG/M
3300014326|Ga0157380_10324169All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300014745|Ga0157377_11399202Not Available551Open in IMG/M
3300014969|Ga0157376_11197828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium788Open in IMG/M
3300015089|Ga0167643_1017743All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300015200|Ga0173480_10566098All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300015371|Ga0132258_11926675Not Available1488Open in IMG/M
3300015372|Ga0132256_101857150Not Available710Open in IMG/M
3300015374|Ga0132255_102844061All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300016319|Ga0182033_11743851Not Available564Open in IMG/M
3300017993|Ga0187823_10078217All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300018054|Ga0184621_10162942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium803Open in IMG/M
3300018060|Ga0187765_11291735Not Available516Open in IMG/M
3300018431|Ga0066655_11209316Not Available536Open in IMG/M
3300018433|Ga0066667_10315095All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300018433|Ga0066667_12175172Not Available516Open in IMG/M
3300018433|Ga0066667_12190230Not Available514Open in IMG/M
3300018468|Ga0066662_10002060All Organisms → cellular organisms → Bacteria9435Open in IMG/M
3300018476|Ga0190274_13863302Not Available507Open in IMG/M
3300018482|Ga0066669_10605579All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300019356|Ga0173481_10007250All Organisms → cellular organisms → Bacteria3022Open in IMG/M
3300019361|Ga0173482_10016268All Organisms → cellular organisms → Bacteria2030Open in IMG/M
3300019890|Ga0193728_1023595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3073Open in IMG/M
3300019890|Ga0193728_1147750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1037Open in IMG/M
3300020070|Ga0206356_11907790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1125Open in IMG/M
3300020081|Ga0206354_11174400All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300020082|Ga0206353_11080631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium704Open in IMG/M
3300025509|Ga0208848_1004643All Organisms → cellular organisms → Bacteria2747Open in IMG/M
3300025556|Ga0210120_1096745All Organisms → cellular organisms → Bacteria → Terrabacteria group587Open in IMG/M
3300025885|Ga0207653_10108994All Organisms → cellular organisms → Bacteria → Terrabacteria group987Open in IMG/M
3300025898|Ga0207692_10407461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium849Open in IMG/M
3300025898|Ga0207692_11186264Not Available507Open in IMG/M
3300025899|Ga0207642_10478828Not Available759Open in IMG/M
3300025899|Ga0207642_10488321All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300025899|Ga0207642_10582892All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300025914|Ga0207671_10051960All Organisms → cellular organisms → Bacteria3036Open in IMG/M
3300025914|Ga0207671_10436751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1042Open in IMG/M
3300025914|Ga0207671_11022200All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300025916|Ga0207663_10267555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1265Open in IMG/M
3300025920|Ga0207649_10925059All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300025921|Ga0207652_10707886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium898Open in IMG/M
3300025924|Ga0207694_11771452Not Available519Open in IMG/M
3300025928|Ga0207700_11298826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium648Open in IMG/M
3300025929|Ga0207664_10069220All Organisms → cellular organisms → Bacteria2838Open in IMG/M
3300025929|Ga0207664_11005207All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300025929|Ga0207664_11863880All Organisms → cellular organisms → Bacteria → Terrabacteria group524Open in IMG/M
3300025932|Ga0207690_11833351Not Available506Open in IMG/M
3300025935|Ga0207709_11348558Not Available590Open in IMG/M
3300025937|Ga0207669_11042969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium688Open in IMG/M
3300025940|Ga0207691_10091337All Organisms → cellular organisms → Bacteria2728Open in IMG/M
3300025941|Ga0207711_10960016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium794Open in IMG/M
3300026078|Ga0207702_10009569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8135Open in IMG/M
3300026078|Ga0207702_10096894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2595Open in IMG/M
3300026078|Ga0207702_10968590All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium844Open in IMG/M
3300026121|Ga0207683_10603746All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300026317|Ga0209154_1303899All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300026325|Ga0209152_10412846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium533Open in IMG/M
3300026552|Ga0209577_10333249Not Available1123Open in IMG/M
3300026878|Ga0208891_1001740Not Available757Open in IMG/M
3300027401|Ga0208637_1032505Not Available599Open in IMG/M
3300027469|Ga0207628_101290Not Available612Open in IMG/M
3300027775|Ga0209177_10048957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1190Open in IMG/M
3300027775|Ga0209177_10217537All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300027869|Ga0209579_10397908All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300028558|Ga0265326_10250827Not Available511Open in IMG/M
3300028710|Ga0307322_10177008Not Available576Open in IMG/M
3300028718|Ga0307307_10076823All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR261001Open in IMG/M
3300028718|Ga0307307_10135351Not Available765Open in IMG/M
3300028719|Ga0307301_10077127Not Available1043Open in IMG/M
3300028778|Ga0307288_10230432Not Available721Open in IMG/M
3300028784|Ga0307282_10533536All Organisms → cellular organisms → Bacteria → Terrabacteria group570Open in IMG/M
3300028790|Ga0307283_10180424Not Available596Open in IMG/M
3300028800|Ga0265338_10023345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6363Open in IMG/M
3300028802|Ga0307503_10704819Not Available568Open in IMG/M
3300028812|Ga0247825_11177685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium559Open in IMG/M
3300028819|Ga0307296_10186262Not Available1125Open in IMG/M
3300028824|Ga0307310_10094445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1322Open in IMG/M
3300028824|Ga0307310_10434228Not Available655Open in IMG/M
3300028884|Ga0307308_10122014All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300028889|Ga0247827_10168132Not Available1182Open in IMG/M
3300031251|Ga0265327_10003928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13616Open in IMG/M
3300031544|Ga0318534_10311763All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300031670|Ga0307374_10182594All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1544Open in IMG/M
3300031799|Ga0318565_10610966Not Available524Open in IMG/M
3300031805|Ga0318497_10745345Not Available549Open in IMG/M
3300031890|Ga0306925_10813949All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR26968Open in IMG/M
3300031896|Ga0318551_10622902Not Available623Open in IMG/M
3300031938|Ga0308175_100275099All Organisms → cellular organisms → Bacteria1704Open in IMG/M
3300031938|Ga0308175_101055965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium899Open in IMG/M
3300031938|Ga0308175_102286034All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300031938|Ga0308175_102400914All Organisms → cellular organisms → Bacteria → Terrabacteria group591Open in IMG/M
3300031939|Ga0308174_10121468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1906Open in IMG/M
3300031939|Ga0308174_10241070All Organisms → cellular organisms → Bacteria1400Open in IMG/M
3300031939|Ga0308174_10735988All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR26825Open in IMG/M
3300032067|Ga0318524_10200334All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300032074|Ga0308173_12241188Not Available515Open in IMG/M
3300032205|Ga0307472_101540708All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300032898|Ga0335072_10466962All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300032955|Ga0335076_10381400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1295Open in IMG/M
3300033475|Ga0310811_11282195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium587Open in IMG/M
3300034090|Ga0326723_0096903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1273Open in IMG/M
3300034268|Ga0372943_0000168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria27606Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.04%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil3.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.56%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.37%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.98%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.19%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.19%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.19%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.19%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.19%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.19%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.19%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.19%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.58%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.79%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.40%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.40%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.40%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.40%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.40%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.40%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.40%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.40%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.40%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.40%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.40%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.40%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.40%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.40%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.40%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.40%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.40%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
3300000878Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002459Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004006Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005147Soil and rhizosphere microbial communities from Laval, Canada - mgLMCEnvironmentalOpen in IMG/M
3300005158Soil and rhizosphere microbial communities from Laval, Canada - mgHAAEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011999Permafrost microbial communities from Nunavut, Canada - A28_65cm_6MEnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012505Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610Host-AssociatedOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015089Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025556Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026878Soil and rhizosphere microbial communities from Laval, Canada - mgHPC (SPAdes)EnvironmentalOpen in IMG/M
3300027401Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes)EnvironmentalOpen in IMG/M
3300027469Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK07-E (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
2ZMR_045671702170459016Switchgrass, Maize And Mischanthus LitterMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID
AL9A1W_100408313300000878PermafrostPGGSDPMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCGNSDA*
JGI10216J12902_10379792113300000956SoilMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHA
A10PFW1_1163128813300001538PermafrostMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCGNSDA*
JGI24751J29686_1009510623300002459Corn, Switchgrass And Miscanthus RhizosphereEETTMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRRELS*
C688J35102_11952096513300002568SoilMDELQETQVEIDERWLAEWFEFGFAELGSYLAKYAAFDDYCHRRHIID*
C688J35102_11969610923300002568SoilMDELQEKHVEIDERWLSEWFEFGFSELGCYLAKHAAFDDYCHR
C688J35102_12029850333300002568SoilMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRRYHD*
C688J35102_12046021223300002568SoilMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELD*
C688J35102_12046519223300002568SoilMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID*
C688J35102_12059672633300002568SoilMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDHSG
C688J35102_12089631723300002568SoilVIRALPEETMMDELQETTVEIDERWLSEWFEFGFSEMGSYLAKHAAFEEYCRREIS*
C688J35102_12094976433300002568SoilMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD*
C688J35102_12094985923300002568SoilMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRRYHD*
soilL1_1010381923300003267Sugarcane Root And Bulk SoilMDELHQTHVEIDERWLAEWFEFGFSELGFYLAKHAAFDDYCHRREID*
Ga0055455_1005580923300003990Natural And Restored WetlandsMDELDEKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCHKHELD*
Ga0055453_1006190833300004006Natural And Restored WetlandsMDELHDTHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHE
Ga0063454_10010922123300004081SoilMMDELQETTVEIDERWLSEWFEFGFSEMGSYLAKHAAFEEYCRREIS*
Ga0062593_10009484123300004114SoilMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS*
Ga0062589_10077983423300004156SoilMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD*
Ga0062589_10127090623300004156SoilMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDF
Ga0063356_10094225423300004463Arabidopsis Thaliana RhizosphereMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKYAAFDDYCHRHELD*
Ga0062595_10011694433300004479SoilMDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSIDF*
Ga0062595_10043846523300004479SoilMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID*
Ga0062595_10248637313300004479SoilMDELQEKHVEIDERWLSEWFEFGFSELGCYLAKYAAFDDYCHRHDHD*
Ga0066395_1104122913300004633Tropical Forest SoilMDELHDKQVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHQLEY*
Ga0062591_10228103223300004643SoilHPGPRPEETTMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS*
Ga0062594_10169287823300005093SoilMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHEID*
Ga0066821_100702623300005147SoilPMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD*
Ga0066816_101015613300005158SoilKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID*
Ga0066823_1006010423300005163SoilMDELHDKQVEIDERWLAEWFEFGFSELGTYLAKYAAFDDYCHRHQLEL*
Ga0066815_1000513113300005164SoilMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHY
Ga0066672_1043642713300005167SoilMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHEHNG*
Ga0066683_1032887723300005172SoilMDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSKI*
Ga0066684_1028324823300005179SoilTTMDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSTSR*
Ga0066684_1097910513300005179SoilMDELYDKHVEIDERWLTEWFEFGFAELASYLAKHAAFDDFCHKNELD*
Ga0066675_1038007623300005187SoilMDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSTSR*
Ga0070683_100000266123300005329Corn RhizosphereMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRRELS*
Ga0070690_10072047313300005330Switchgrass RhizospherePGGDIEMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD*
Ga0066388_10114498723300005332Tropical Forest SoilMDELTDRHVEIDERWLAEWFEFGFTELGSYLAKHAAFDDYCHRRELD*
Ga0066388_10118432513300005332Tropical Forest SoilMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDHNG*
Ga0068869_10016278523300005334Miscanthus RhizosphereMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDRHELD*
Ga0070666_1088733823300005335Switchgrass RhizosphereMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD*
Ga0070680_10118696713300005336Corn RhizosphereMDELQEKQVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCANNDAA*
Ga0070682_10017819923300005337Corn RhizosphereMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDQHELD*
Ga0068868_10008013653300005338Miscanthus RhizosphereMDELQEKHVEIDERWLSEWFEFGFSELGCYLAKHAAFDDYCH
Ga0070692_1044557813300005345Corn, Switchgrass And Miscanthus RhizosphereELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDQHELD*
Ga0070669_10099018713300005353Switchgrass RhizosphereDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID*
Ga0070671_10033003023300005355Switchgrass RhizosphereMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHDHNG*
Ga0070671_10045162123300005355Switchgrass RhizosphereGDIEMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD*
Ga0070659_10004024013300005366Corn RhizosphereMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCH
Ga0070709_1020958333300005434Corn, Switchgrass And Miscanthus RhizosphereMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELG*
Ga0070709_1085092923300005434Corn, Switchgrass And Miscanthus RhizosphereEEAIMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD*
Ga0070709_1103734323300005434Corn, Switchgrass And Miscanthus RhizosphereMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCHKHELD*
Ga0070714_10003446223300005435Agricultural SoilMDELQETHVEIDERWLSEWFEFGFSELGCYLAKHAAFDDYCHRHEHNG*
Ga0070714_10019254023300005435Agricultural SoilMDELQEKHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDQLD*
Ga0070714_10029951213300005435Agricultural SoilMDELHEKHVEIDERWLSEWFEFGFAELASYLAKHAAFDDYCHRRELD*
Ga0070714_10070274123300005435Agricultural SoilCPEEAIMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD*
Ga0070714_10088535723300005435Agricultural SoilTPPEETTMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDSNG*
Ga0070714_10111419713300005435Agricultural SoilTMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD*
Ga0070714_10143201813300005435Agricultural SoilMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELG*
Ga0070713_10113287423300005436Corn, Switchgrass And Miscanthus RhizosphereEAIMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELG*
Ga0070713_10166801213300005436Corn, Switchgrass And Miscanthus RhizosphereMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDFNG*
Ga0070710_1115537423300005437Corn, Switchgrass And Miscanthus RhizosphereELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD*
Ga0070701_1004516533300005438Corn, Switchgrass And Miscanthus RhizosphereMDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID*
Ga0070711_10014212323300005439Corn, Switchgrass And Miscanthus RhizosphereMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDAYCQRHEDLG*
Ga0070711_10038757813300005439Corn, Switchgrass And Miscanthus RhizospherePPPEETTMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHYHD*
Ga0070711_10098816913300005439Corn, Switchgrass And Miscanthus RhizosphereELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDQHELD*
Ga0070694_10011179833300005444Corn, Switchgrass And Miscanthus RhizosphereMDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID*
Ga0070685_1089986523300005466Switchgrass RhizosphereMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRH
Ga0070699_10045027133300005518Corn, Switchgrass And Miscanthus RhizosphereMDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHK
Ga0073909_1033202023300005526Surface SoilMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHYHD*
Ga0070679_10012047913300005530Corn RhizosphereMDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYC
Ga0070734_1081284023300005533Surface SoilMDELHDTHVEIDERWLTEWFEFGFAELGSYLAKHAAFDDYLHKHGIDEF*
Ga0070697_10077710023300005536Corn, Switchgrass And Miscanthus RhizosphereMDELHETHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSIDI*
Ga0070672_10033352223300005543Miscanthus RhizosphereMDELQEKQVEIDERWLSEWFEFGFSELSSYLAKHAAFDDYCQRHYHD*
Ga0070696_10100626123300005546Corn, Switchgrass And Miscanthus RhizosphereELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID*
Ga0070693_10022201513300005547Corn, Switchgrass And Miscanthus RhizosphereIMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDQHELD*
Ga0070704_10210776413300005549Corn, Switchgrass And Miscanthus RhizosphereMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHEI
Ga0066700_1088420523300005559SoilMDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDV*
Ga0070664_10005127933300005564Corn RhizosphereDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID*
Ga0068854_10185831013300005578Corn RhizosphereMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDD
Ga0068852_10210516123300005616Corn RhizosphereMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHA
Ga0068864_10050199633300005618Switchgrass RhizosphereMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDF
Ga0066903_10356163023300005764Tropical Forest SoilMDELQEKRVEIDERWLSEWFEFGFAEMSSYLAKHAAFDDYCTRHELD*
Ga0075288_101497213300005874Rice Paddy SoilMDELHDRHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID*
Ga0070717_1031156913300006028Corn, Switchgrass And Miscanthus RhizosphereMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELD*
Ga0070717_1032933323300006028Corn, Switchgrass And Miscanthus RhizosphereMDELQEKHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHDHFG*
Ga0070717_1041785523300006028Corn, Switchgrass And Miscanthus RhizosphereMDELQETHVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCHRHDFNG*
Ga0070717_1149870223300006028Corn, Switchgrass And Miscanthus RhizosphereMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKYAAFDDYCHRHELD*
Ga0066652_10019040423300006046SoilMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYLHKNEID*
Ga0070715_1029982723300006163Corn, Switchgrass And Miscanthus RhizosphereMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDQHELD*
Ga0070712_10056411623300006175Corn, Switchgrass And Miscanthus RhizosphereMDELKDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCANNDAA*
Ga0074055_1184811323300006573SoilVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD*
Ga0074057_1003549913300006605SoilAMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHEID*
Ga0079222_1036308323300006755Agricultural SoilMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHA
Ga0079222_1173286523300006755Agricultural SoilMDELHEKHVEIDERWLCEWFEFGFAELSSYLAKHAAFDDFIHRHELD*
Ga0079221_1137936123300006804Agricultural SoilMDEVHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID*
Ga0075434_10257676813300006871Populus RhizosphereMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCH
Ga0079219_1044182323300006954Agricultural SoilMDELQDKHVEIVERWLSECFEFGFAELSSYLAKHAAFDDYCHNNEID*
Ga0075435_10136534313300007076Populus RhizosphereMDELQEKHVEIDERWLSEWFEFGFSELGCYLAKHAAFDDYCHRHDFE*
Ga0099827_1163613013300009090Vadose Zone SoilMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYLHKNEMD*
Ga0105245_1012350613300009098Miscanthus RhizosphereMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFD
Ga0105245_1031507713300009098Miscanthus RhizosphereMDELQEKHVEIDERWLSEWFEFGFSELGCYLAKHAALDGYCHRHDFE
Ga0105245_1161828223300009098Miscanthus RhizosphereTTMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD*
Ga0105245_1235593023300009098Miscanthus RhizospherePEEAIMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD*
Ga0075418_1142231523300009100Populus RhizosphereMDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCRREQS*
Ga0066709_10016763853300009137Grasslands SoilMDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSNI*
Ga0105248_1036003533300009177Switchgrass RhizosphereMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELDEPR
Ga0105248_1120354213300009177Switchgrass RhizosphereMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFYDFCDKHELD*
Ga0126378_1097489723300010361Tropical Forest SoilMDELQEKRVEIDERWLSEWFEFGFAEMSSYLAKYAAFDDYCTRHELD*
Ga0126377_1195321423300010362Tropical Forest SoilMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID*
Ga0134125_1114272623300010371Terrestrial SoilVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELD*
Ga0134125_1187804523300010371Terrestrial SoilMDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFADYCHKSEID*
Ga0134125_1294225623300010371Terrestrial SoilDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS*
Ga0134128_1091749113300010373Terrestrial SoilMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEI
Ga0105239_1105031223300010375Corn RhizosphereEMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD*
Ga0105239_1194297813300010375Corn RhizosphereEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD*
Ga0134124_1097020923300010397Terrestrial SoilMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD*
Ga0126383_1345655713300010398Tropical Forest SoilMDELQEKHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDHNG*
Ga0134122_1264145513300010400Terrestrial SoilPPEETTMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD*
Ga0134121_1239047213300010401Terrestrial SoilMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYH
Ga0138505_10004852313300010999SoilMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNESD*
Ga0151489_119641223300011106SoilMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEIV*
Ga0151490_179749723300011107SoilMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNDYLHKNEID*
Ga0120148_107713423300011999PermafrostMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCGHNDG*
Ga0120134_101586033300012004PermafrostMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAA
Ga0120134_105143623300012004PermafrostMDELYDKHVEIDERWLMEWFEFGFSELSSYLAKYAAFDDFCGNQDV*
Ga0120152_119196013300012011PermafrostMDELQDRHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDAL*
Ga0150985_11703965513300012212Avena Fatua RhizosphereTPPGGDIEMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD*
Ga0137372_1047486823300012350Vadose Zone SoilMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKYAAFDEYLHKNELD*
Ga0137384_1118441713300012357Vadose Zone SoilERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELG*
Ga0137384_1126627423300012357Vadose Zone SoilMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCHQNELD*
Ga0157339_107220613300012505Arabidopsis RhizosphereMDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID*
Ga0157293_1016692613300012898SoilMDELQETTVEIDDRWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS*
Ga0157301_1006845613300012911SoilELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS*
Ga0157302_1007881513300012915SoilMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYC
Ga0164300_1087910013300012951SoilMDELYDKHVEIDERWLTEWFEFGFAELSSYLTKHAAFDDFCDKHELG*
Ga0164298_1120256223300012955SoilGGNRHPGPRPEETTMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS
Ga0164301_1063251613300012960SoilETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCANNDAA*
Ga0164302_1076843113300012961SoilDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD*
Ga0164302_1190651513300012961SoilMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCANNDAA*
Ga0164309_1167662823300012984SoilEEAIMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELG*
Ga0164308_1011332723300012985SoilMDELQEKQVEIDERWLSERFEFGFSELGSYLAKHAAFDDYCQRHYHD*
Ga0164308_1119724323300012985SoilMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHYHDEVIAP*
Ga0164307_1026172333300012987SoilMDELYDKHVEIDERWLTEWFEFGFADLSSYLAKHAAFDDFCDKHELD*
Ga0164305_1098121223300012989SoilMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDSNG*
Ga0157307_107110813300013096SoilMDELQETTVEIDERWLSEWVELGFAEMGCYLAKHAAFDDYCRREQS*
Ga0157374_1083276323300013296Miscanthus RhizosphereQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD*
Ga0120181_103959233300013766PermafrostMDELYDKHVEIDERWLTEWFEFGFSELSSYLAKYAAFDDFCGNQDV*
Ga0120132_108486813300013832PermafrostMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCGNNDA*
Ga0120149_116205823300014058PermafrostMDELYDKHVEIDERWLMEWFEFGFSELSSYLAKYAAFDDFCGHNDG*
Ga0157380_1032416923300014326Switchgrass RhizosphereMDELQEKHVEIDERLLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD*
Ga0157377_1139920213300014745Miscanthus RhizosphereHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD*
Ga0157376_1119782823300014969Miscanthus RhizospherePSVEAEIASPSRTAALSGGSAMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHEID*
Ga0167643_101774323300015089Glacier Forefield SoilMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCGDKDV*
Ga0173480_1056609813300015200SoilMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAF
Ga0132258_1192667523300015371Arabidopsis RhizosphereGGSLMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID*
Ga0132256_10185715023300015372Arabidopsis RhizosphereMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNE*
Ga0132255_10284406113300015374Arabidopsis RhizosphereMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDD
Ga0182033_1174385123300016319SoilMDELQEKRVEIDERWLSEWFEFGFAEMSSYLAKHAAFDDYCTRHELS
Ga0187823_1007821713300017993Freshwater SedimentMDELQETHVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCHRHDFNG
Ga0184621_1016294223300018054Groundwater SedimentMDELHEKHVEIDERWLSEWFEFGFTELSSYLAKHAAFNEYLHNNEID
Ga0187765_1129173513300018060Tropical PeatlandMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCHKHELD
Ga0066655_1120931623300018431Grasslands SoilKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD
Ga0066667_1031509523300018433Grasslands SoilMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELD
Ga0066667_1217517213300018433Grasslands SoilMDELHEKHVEIAERWLSESFEFGFAELSCYLATHAAVNENLHKHEL
Ga0066667_1219023023300018433Grasslands SoilHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSTSR
Ga0066662_1000206023300018468Grasslands SoilMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHEHNG
Ga0190274_1386330223300018476SoilMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKYAAFDDYCHRHELD
Ga0066669_1060557923300018482Grasslands SoilMDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSTSR
Ga0173481_1000725033300019356SoilMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRREQS
Ga0173482_1001626833300019361SoilMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD
Ga0193728_102359533300019890SoilMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCGNSDA
Ga0193728_114775013300019890SoilMDELYDKHVEIDERWLTEWFEFGFAELSSYLAKYAAFDDFCDKHELG
Ga0206356_1190779023300020070Corn, Switchgrass And Miscanthus RhizosphereMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDQHELD
Ga0206354_1117440023300020081Corn, Switchgrass And Miscanthus RhizosphereMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD
Ga0206353_1108063113300020082Corn, Switchgrass And Miscanthus RhizosphereSLMDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID
Ga0208848_100464333300025509Arctic Peat SoilMDELYDKHVEIDERWLTEWFEFGFAELGSYLAKHAAFDDFCGDQDI
Ga0210120_109674523300025556Natural And Restored WetlandsMDELHDTHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFL
Ga0207653_1010899423300025885Corn, Switchgrass And Miscanthus RhizosphereMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD
Ga0207692_1040746123300025898Corn, Switchgrass And Miscanthus RhizosphereVEIDERWLTEWFEFGFAELSSYLAKHAAFDDFCDKHELG
Ga0207692_1118626423300025898Corn, Switchgrass And Miscanthus RhizosphereMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDSNG
Ga0207642_1047882823300025899Miscanthus RhizosphereMDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID
Ga0207642_1048832123300025899Miscanthus RhizosphereRPRPEEIIEMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD
Ga0207642_1058289223300025899Miscanthus RhizosphereMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKYAAFDDYCH
Ga0207671_1005196053300025914Corn RhizosphereMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHY
Ga0207671_1043675123300025914Corn RhizosphereAGCPEEAIMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD
Ga0207671_1102220023300025914Corn RhizosphereMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCD
Ga0207663_1026755513300025916Corn, Switchgrass And Miscanthus RhizosphereEIDERWLSEWFEFGFSELGSYLAKHAAFDAYCQRHEDLG
Ga0207649_1092505923300025920Corn RhizosphereMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRRELS
Ga0207652_1070788613300025921Corn RhizosphereGGDIEMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHELD
Ga0207694_1177145223300025924Corn RhizosphereVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD
Ga0207700_1129882623300025928Corn, Switchgrass And Miscanthus RhizosphereETTMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCANNDAA
Ga0207664_1006922033300025929Agricultural SoilMDELQETHVEIDERWLSEWFEFGFSELGCYLAKHAAFDDYCHRHEHNG
Ga0207664_1100520723300025929Agricultural SoilMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELG
Ga0207664_1186388023300025929Agricultural SoilMDELQEKHVEIDERWLSEWFEFGFSELGCYLAKYAAFDDYCHRHD
Ga0207690_1183335123300025932Corn RhizosphereNRHPGPRPEETTMDELQETTVEIDERWLSEWFEFGFAEMGCYLAKHAAFDDYCRRELS
Ga0207709_1134855823300025935Miscanthus RhizosphereMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHEID
Ga0207669_1104296923300025937Miscanthus RhizosphereHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHKHEID
Ga0207691_1009133733300025940Miscanthus RhizosphereMDELQEKQVEIDERWLSEWFEFGFSELSSYLAKHAAFDDYCQRHYHD
Ga0207711_1096001623300025941Switchgrass RhizosphereMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYCHRHEL
Ga0207702_1000956913300026078Corn RhizosphereMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHA
Ga0207702_1009689413300026078Corn RhizosphereMDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKN
Ga0207702_1096859033300026078Corn RhizosphereMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKHAAFDDYC
Ga0207683_1060374613300026121Miscanthus RhizosphereMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDY
Ga0209154_130389923300026317SoilDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHEHNG
Ga0209152_1041284623300026325SoilIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD
Ga0209577_1033324933300026552SoilMDELYDKHVEIDERWLTEWFEFGFAELASYLAKHAAFDDFCHKNELD
Ga0208891_100174023300026878SoilMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID
Ga0208637_103250513300027401SoilMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAF
Ga0207628_10129023300027469SoilMDELQEKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDQHELD
Ga0209177_1004895723300027775Agricultural SoilERWLTEWFEFGFAEMSSYLAKHAAFDDFCDKHELD
Ga0209177_1021753713300027775Agricultural SoilMDELYDKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDD
Ga0209579_1039790823300027869Surface SoilMDELHDTHVEIDERWLTEWFEFGFAELGSYLAKHAAFDDYLHKHGIDEF
Ga0265326_1025082713300028558RhizosphereDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELD
Ga0307322_1017700823300028710SoilMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDAFLHKHELD
Ga0307307_1007682323300028718SoilPEETTMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHYHD
Ga0307307_1013535123300028718SoilMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKYAAFDDFLHKNELD
Ga0307301_1007712723300028719SoilMDELHEKHVEIDERWLSEWFEFGFTELSSYMAKHAAFNEYLHNNEID
Ga0307288_1023043223300028778SoilMDELQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHDFNG
Ga0307282_1053353613300028784SoilMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKYAAFDDFLHKNEID
Ga0307283_1018042413300028790SoilLQEKQVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHYHD
Ga0265338_1002334533300028800RhizosphereMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELD
Ga0307503_1070481923300028802SoilMDELQDKHVEIDERWLSEWFEFGFSELGCYLAKYAAFDDYCHRHEFD
Ga0247825_1117768513300028812SoilSGGSLMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID
Ga0307296_1018626213300028819SoilGGGNRTTRTAALSGGSLMDELHEKHVEIDERWLSEWFEFGFTELSSYLAKHAAFNEYLHNNEID
Ga0307310_1009444523300028824SoilMDELHEKHVEIDERWLSEWFEFGFAELGSYLAKYAAFDDYCHRHDSIDI
Ga0307310_1043422823300028824SoilMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHNHELD
Ga0307308_1012201433300028884SoilMDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNE
Ga0247827_1016813213300028889SoilPRPEEIIEMDELQEKHVEIDERWLAEWFEFGFAELGSYLAKYAAFDDYCHRHELD
Ga0265327_1000392813300031251RhizosphereDMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELD
Ga0318534_1031176323300031544SoilMDELQEKHVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHDQFD
Ga0307374_1018259423300031670SoilMDELRDTHVEIDERWLTEWFEFGFAELGAYLAKHAAFEDYLHKHGIDEF
Ga0318565_1061096623300031799SoilQTPPEETTMDELQEKHVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHDQFD
Ga0318497_1074534513300031805SoilGRANRPEQTPPEETTMDELQEKHVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHDQFD
Ga0306925_1081394913300031890SoilTPPEETTMDELQEKHVEIDERWLSEWFEFGFSELGSYLAKYAAFDDYCQRHDQFD
Ga0318551_1062290213300031896SoilMDELQEKRVEIDERWLSEWFEFGFAEMSSYLAKHAAFDDYCTRHELD
Ga0308175_10027509923300031938SoilMDELYDKHVEIDERWLTEWFEFGFAELSGYLAKHAAFDDFCDKHELD
Ga0308175_10105596513300031938SoilRTAALSGGSLMDELQDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHKNEID
Ga0308175_10228603423300031938SoilMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKQA
Ga0308175_10240091423300031938SoilMDELYEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDFLHNHELD
Ga0308174_1012146823300031939SoilHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID
Ga0308174_1024107023300031939SoilMDELQEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRRYHD
Ga0308174_1073598823300031939SoilMDELQEKHVEIDERWLSEWFEFGFSELGCYLAKHAAFDDYCHRHDFE
Ga0318524_1020033423300032067SoilMDELQEKHVEIDERWLSEWFEFGFSELGSYLAKLAAFDDYCQRHDQFD
Ga0308173_1224118823300032074SoilLQETHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCHRHEHNG
Ga0307472_10154070823300032205Hardwood Forest SoilMDELHEKQVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCQRHYHD
Ga0335072_1046696223300032898SoilMMDELHDKHVEIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHRHELD
Ga0335076_1038140023300032955SoilMDELHDKHVEIDERWLSEWFEFGFAELASYLAKHAAFDDYCHRREID
Ga0310811_1128219513300033475SoilIDERWLSEWFEFGFAELSSYLAKHAAFDDYCHNNEID
Ga0326723_0096903_3_1433300034090Peat SoilDELHEKHVEIDERWLSEWFEFGFAELSSYLAKHAAFNEYLHKNEID
Ga0372943_0000168_1595_17383300034268SoilMDELQEKHVEIDERWLSEWFEFGFSELGSYLAKHAAFDDYCDRHDTD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.