Basic Information | |
---|---|
Family ID | F014514 |
Family Type | Metagenome |
Number of Sequences | 262 |
Average Sequence Length | 46 residues |
Representative Sequence | VTLLADLEEFVRDHRPHGTLTSDATEPAWNGYLLTVACPCGVVFE |
Number of Associated Samples | 161 |
Number of Associated Scaffolds | 262 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 54.17 % |
% of genes near scaffold ends (potentially truncated) | 67.56 % |
% of genes from short scaffolds (< 2000 bps) | 82.44 % |
Associated GOLD sequencing projects | 141 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.71 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.351 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (17.939 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.809 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.420 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.55% β-sheet: 16.44% Coil/Unstructured: 63.01% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.71 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 262 Family Scaffolds |
---|---|---|
PF02518 | HATPase_c | 3.05 |
PF04392 | ABC_sub_bind | 3.05 |
PF00072 | Response_reg | 2.67 |
PF00067 | p450 | 2.29 |
PF07366 | SnoaL | 1.91 |
PF04185 | Phosphoesterase | 1.53 |
PF13424 | TPR_12 | 1.15 |
PF13185 | GAF_2 | 1.15 |
PF13416 | SBP_bac_8 | 0.76 |
PF01066 | CDP-OH_P_transf | 0.76 |
PF07589 | PEP-CTERM | 0.76 |
PF00296 | Bac_luciferase | 0.76 |
PF00872 | Transposase_mut | 0.76 |
PF01694 | Rhomboid | 0.76 |
PF07045 | DUF1330 | 0.76 |
PF01223 | Endonuclease_NS | 0.76 |
PF13646 | HEAT_2 | 0.76 |
PF00903 | Glyoxalase | 0.76 |
PF00106 | adh_short | 0.76 |
PF00378 | ECH_1 | 0.38 |
PF01590 | GAF | 0.38 |
PF01258 | zf-dskA_traR | 0.38 |
PF02417 | Chromate_transp | 0.38 |
PF14534 | DUF4440 | 0.38 |
PF12836 | HHH_3 | 0.38 |
PF07719 | TPR_2 | 0.38 |
PF13936 | HTH_38 | 0.38 |
PF13683 | rve_3 | 0.38 |
PF13649 | Methyltransf_25 | 0.38 |
PF05036 | SPOR | 0.38 |
PF08241 | Methyltransf_11 | 0.38 |
PF12850 | Metallophos_2 | 0.38 |
PF07883 | Cupin_2 | 0.38 |
PF00743 | FMO-like | 0.38 |
PF02641 | DUF190 | 0.38 |
PF10771 | DUF2582 | 0.38 |
PF05494 | MlaC | 0.38 |
PF04020 | Phage_holin_4_2 | 0.38 |
PF00300 | His_Phos_1 | 0.38 |
PF00775 | Dioxygenase_C | 0.38 |
PF13191 | AAA_16 | 0.38 |
PF01541 | GIY-YIG | 0.38 |
PF00891 | Methyltransf_2 | 0.38 |
PF02604 | PhdYeFM_antitox | 0.38 |
PF00496 | SBP_bac_5 | 0.38 |
PF13561 | adh_short_C2 | 0.38 |
PF07578 | LAB_N | 0.38 |
PF04120 | Iron_permease | 0.38 |
PF01734 | Patatin | 0.38 |
PF09335 | SNARE_assoc | 0.38 |
PF13474 | SnoaL_3 | 0.38 |
PF00571 | CBS | 0.38 |
PF03167 | UDG | 0.38 |
PF01209 | Ubie_methyltran | 0.38 |
PF03729 | DUF308 | 0.38 |
PF09900 | DUF2127 | 0.38 |
PF01435 | Peptidase_M48 | 0.38 |
PF11154 | DUF2934 | 0.38 |
PF01842 | ACT | 0.38 |
COG ID | Name | Functional Category | % Frequency in 262 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.05 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 2.29 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 1.53 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.76 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.76 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.76 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.76 |
COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.76 |
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.76 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.76 |
COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.38 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.38 |
COG3952 | Uncharacterized N-terminal domain of lipid-A-disaccharide synthase | General function prediction only [R] | 0.38 |
COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.38 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.38 |
COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.38 |
COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.38 |
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.38 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.38 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.38 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.38 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.38 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.38 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.38 |
COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.38 |
COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.38 |
COG1993 | PII-like signaling protein | Signal transduction mechanisms [T] | 0.38 |
COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 0.38 |
COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.38 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.38 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.11 % |
Unclassified | root | N/A | 14.89 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664022|INPgaii200_c0906321 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0649969 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300000443|F12B_10078250 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 969 | Open in IMG/M |
3300000550|F24TB_12402019 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 511 | Open in IMG/M |
3300000564|RepKanNP_BrdU_F12BDRAFT_1002681 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300000787|JGI11643J11755_11683236 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300000955|JGI1027J12803_101361912 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300001431|F14TB_100641638 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300001431|F14TB_101100001 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
3300001431|F14TB_101500749 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
3300002561|JGI25384J37096_10097575 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1030 | Open in IMG/M |
3300002908|JGI25382J43887_10407620 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 575 | Open in IMG/M |
3300002912|JGI25386J43895_10092456 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300004114|Ga0062593_102937249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 545 | Open in IMG/M |
3300004267|Ga0066396_10004426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1466 | Open in IMG/M |
3300005166|Ga0066674_10051717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 1854 | Open in IMG/M |
3300005171|Ga0066677_10477897 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 715 | Open in IMG/M |
3300005174|Ga0066680_10844763 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 547 | Open in IMG/M |
3300005177|Ga0066690_10554912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
3300005178|Ga0066688_10052438 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2364 | Open in IMG/M |
3300005178|Ga0066688_10976729 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
3300005180|Ga0066685_10247293 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300005180|Ga0066685_10604172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 755 | Open in IMG/M |
3300005186|Ga0066676_10533146 | Not Available | 796 | Open in IMG/M |
3300005186|Ga0066676_11162925 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300005295|Ga0065707_10656836 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 638 | Open in IMG/M |
3300005332|Ga0066388_100788861 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | 1544 | Open in IMG/M |
3300005332|Ga0066388_101150210 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1320 | Open in IMG/M |
3300005332|Ga0066388_101729102 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300005332|Ga0066388_104518668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 708 | Open in IMG/M |
3300005332|Ga0066388_105390101 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300005445|Ga0070708_101197447 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 711 | Open in IMG/M |
3300005445|Ga0070708_101505260 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 627 | Open in IMG/M |
3300005445|Ga0070708_101833619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
3300005446|Ga0066686_10658608 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 710 | Open in IMG/M |
3300005447|Ga0066689_10158907 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
3300005447|Ga0066689_11016550 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
3300005467|Ga0070706_100092764 | All Organisms → cellular organisms → Bacteria | 2801 | Open in IMG/M |
3300005467|Ga0070706_100715273 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 928 | Open in IMG/M |
3300005468|Ga0070707_100407633 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
3300005471|Ga0070698_100268257 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
3300005518|Ga0070699_100123349 | All Organisms → cellular organisms → Bacteria | 2279 | Open in IMG/M |
3300005526|Ga0073909_10399620 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 647 | Open in IMG/M |
3300005552|Ga0066701_10588124 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
3300005553|Ga0066695_10471721 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 773 | Open in IMG/M |
3300005556|Ga0066707_10807285 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
3300005558|Ga0066698_10375144 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 981 | Open in IMG/M |
3300005558|Ga0066698_10988167 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300005559|Ga0066700_10422248 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 939 | Open in IMG/M |
3300005586|Ga0066691_10640564 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 631 | Open in IMG/M |
3300005598|Ga0066706_11270341 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
3300005615|Ga0070702_101049012 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 648 | Open in IMG/M |
3300005713|Ga0066905_100119610 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
3300005713|Ga0066905_101128578 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 697 | Open in IMG/M |
3300005764|Ga0066903_100829468 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1659 | Open in IMG/M |
3300005764|Ga0066903_101603330 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300005764|Ga0066903_102755185 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 954 | Open in IMG/M |
3300005764|Ga0066903_102932322 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 925 | Open in IMG/M |
3300005764|Ga0066903_106199226 | Not Available | 625 | Open in IMG/M |
3300005764|Ga0066903_107050412 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 583 | Open in IMG/M |
3300005841|Ga0068863_101046747 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 820 | Open in IMG/M |
3300006034|Ga0066656_10826477 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300006049|Ga0075417_10080307 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
3300006049|Ga0075417_10209435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 925 | Open in IMG/M |
3300006050|Ga0075028_100932906 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
3300006194|Ga0075427_10008673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1510 | Open in IMG/M |
3300006194|Ga0075427_10046931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 737 | Open in IMG/M |
3300006796|Ga0066665_10762882 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 765 | Open in IMG/M |
3300006797|Ga0066659_10115879 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1850 | Open in IMG/M |
3300006797|Ga0066659_10173757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 1553 | Open in IMG/M |
3300006797|Ga0066659_10204001 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
3300006800|Ga0066660_11402047 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
3300006844|Ga0075428_100151012 | All Organisms → cellular organisms → Bacteria | 2523 | Open in IMG/M |
3300006844|Ga0075428_100511383 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1285 | Open in IMG/M |
3300006844|Ga0075428_100963884 | Not Available | 904 | Open in IMG/M |
3300006844|Ga0075428_102250689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300006845|Ga0075421_100321108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1877 | Open in IMG/M |
3300006845|Ga0075421_101104011 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 891 | Open in IMG/M |
3300006845|Ga0075421_101953951 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 626 | Open in IMG/M |
3300006846|Ga0075430_100026282 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4954 | Open in IMG/M |
3300006847|Ga0075431_102185091 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
3300006852|Ga0075433_10686989 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300006852|Ga0075433_10946438 | Not Available | 751 | Open in IMG/M |
3300006852|Ga0075433_11623128 | Not Available | 557 | Open in IMG/M |
3300006854|Ga0075425_102995293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
3300006871|Ga0075434_101094987 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 810 | Open in IMG/M |
3300006871|Ga0075434_101847387 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
3300006880|Ga0075429_100609859 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 956 | Open in IMG/M |
3300006880|Ga0075429_101939967 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
3300006904|Ga0075424_100475170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1335 | Open in IMG/M |
3300006904|Ga0075424_100959730 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 912 | Open in IMG/M |
3300006904|Ga0075424_102082602 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300006914|Ga0075436_100875926 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 671 | Open in IMG/M |
3300006954|Ga0079219_10321038 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 974 | Open in IMG/M |
3300006969|Ga0075419_10645297 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 747 | Open in IMG/M |
3300006969|Ga0075419_10695573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 721 | Open in IMG/M |
3300006969|Ga0075419_10811851 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 670 | Open in IMG/M |
3300007255|Ga0099791_10662433 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
3300009012|Ga0066710_102561159 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 735 | Open in IMG/M |
3300009012|Ga0066710_102938269 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 667 | Open in IMG/M |
3300009012|Ga0066710_103116341 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 640 | Open in IMG/M |
3300009012|Ga0066710_103682511 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 577 | Open in IMG/M |
3300009038|Ga0099829_10064639 | All Organisms → cellular organisms → Bacteria | 2758 | Open in IMG/M |
3300009038|Ga0099829_11391673 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
3300009088|Ga0099830_10759716 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300009088|Ga0099830_11418176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
3300009089|Ga0099828_10264754 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1543 | Open in IMG/M |
3300009089|Ga0099828_11876286 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
3300009090|Ga0099827_10000198 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 24057 | Open in IMG/M |
3300009090|Ga0099827_10039789 | All Organisms → cellular organisms → Bacteria | 3467 | Open in IMG/M |
3300009094|Ga0111539_11416815 | Not Available | 806 | Open in IMG/M |
3300009100|Ga0075418_11607406 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 706 | Open in IMG/M |
3300009100|Ga0075418_12356574 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
3300009137|Ga0066709_103174514 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 600 | Open in IMG/M |
3300009137|Ga0066709_103260709 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
3300009162|Ga0075423_10681330 | Not Available | 1085 | Open in IMG/M |
3300009162|Ga0075423_12115482 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 610 | Open in IMG/M |
3300009162|Ga0075423_12718373 | Not Available | 542 | Open in IMG/M |
3300009162|Ga0075423_13224169 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
3300009553|Ga0105249_11583599 | Not Available | 728 | Open in IMG/M |
3300009792|Ga0126374_11770694 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
3300010043|Ga0126380_10285341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1165 | Open in IMG/M |
3300010043|Ga0126380_11408000 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 613 | Open in IMG/M |
3300010046|Ga0126384_10863756 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 815 | Open in IMG/M |
3300010304|Ga0134088_10136865 | Not Available | 1162 | Open in IMG/M |
3300010329|Ga0134111_10341283 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 631 | Open in IMG/M |
3300010329|Ga0134111_10418974 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
3300010336|Ga0134071_10108624 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1323 | Open in IMG/M |
3300010336|Ga0134071_10165917 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1079 | Open in IMG/M |
3300010336|Ga0134071_10273125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 845 | Open in IMG/M |
3300010359|Ga0126376_10482529 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300010359|Ga0126376_11081873 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 808 | Open in IMG/M |
3300010359|Ga0126376_11326585 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 741 | Open in IMG/M |
3300010359|Ga0126376_12763854 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
3300010362|Ga0126377_11522750 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 743 | Open in IMG/M |
3300010362|Ga0126377_12996459 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300010366|Ga0126379_10961754 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 958 | Open in IMG/M |
3300010398|Ga0126383_11731685 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 714 | Open in IMG/M |
3300011269|Ga0137392_10024757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4274 | Open in IMG/M |
3300012096|Ga0137389_10230477 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1551 | Open in IMG/M |
3300012189|Ga0137388_11406671 | Not Available | 636 | Open in IMG/M |
3300012189|Ga0137388_11804596 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
3300012189|Ga0137388_11872509 | Not Available | 530 | Open in IMG/M |
3300012199|Ga0137383_10881314 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300012200|Ga0137382_10223174 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1300 | Open in IMG/M |
3300012201|Ga0137365_10978256 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 615 | Open in IMG/M |
3300012204|Ga0137374_10342455 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1209 | Open in IMG/M |
3300012204|Ga0137374_11202497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
3300012206|Ga0137380_11182890 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 650 | Open in IMG/M |
3300012207|Ga0137381_10904398 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 763 | Open in IMG/M |
3300012210|Ga0137378_10604542 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1007 | Open in IMG/M |
3300012210|Ga0137378_11661449 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
3300012211|Ga0137377_10871556 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 832 | Open in IMG/M |
3300012355|Ga0137369_10149849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 1853 | Open in IMG/M |
3300012355|Ga0137369_10563292 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 797 | Open in IMG/M |
3300012355|Ga0137369_10742904 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 672 | Open in IMG/M |
3300012361|Ga0137360_10320658 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
3300012362|Ga0137361_10137049 | All Organisms → cellular organisms → Bacteria | 2173 | Open in IMG/M |
3300012362|Ga0137361_10763579 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 881 | Open in IMG/M |
3300012582|Ga0137358_10405606 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 922 | Open in IMG/M |
3300012918|Ga0137396_10444517 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300012918|Ga0137396_10724743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 733 | Open in IMG/M |
3300012923|Ga0137359_10677997 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 900 | Open in IMG/M |
3300012923|Ga0137359_10752755 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300012923|Ga0137359_11702327 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
3300012925|Ga0137419_10310008 | Not Available | 1209 | Open in IMG/M |
3300012925|Ga0137419_10673008 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 837 | Open in IMG/M |
3300012929|Ga0137404_10123180 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2122 | Open in IMG/M |
3300012930|Ga0137407_10733872 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 931 | Open in IMG/M |
3300012944|Ga0137410_10365328 | Not Available | 1156 | Open in IMG/M |
3300012948|Ga0126375_10115316 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1625 | Open in IMG/M |
3300012948|Ga0126375_10186160 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1348 | Open in IMG/M |
3300012948|Ga0126375_10187153 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1346 | Open in IMG/M |
3300012948|Ga0126375_11398623 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 593 | Open in IMG/M |
3300012971|Ga0126369_13329912 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
3300012972|Ga0134077_10021237 | All Organisms → cellular organisms → Bacteria | 2232 | Open in IMG/M |
3300012976|Ga0134076_10057265 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1481 | Open in IMG/M |
3300014154|Ga0134075_10591304 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
3300015359|Ga0134085_10055531 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1590 | Open in IMG/M |
3300015371|Ga0132258_11623438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1632 | Open in IMG/M |
3300015371|Ga0132258_12234273 | All Organisms → Viruses → Predicted Viral | 1373 | Open in IMG/M |
3300015374|Ga0132255_103179206 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 700 | Open in IMG/M |
3300017656|Ga0134112_10296276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
3300018054|Ga0184621_10059549 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1293 | Open in IMG/M |
3300018056|Ga0184623_10003011 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 7223 | Open in IMG/M |
3300018078|Ga0184612_10354990 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RIFCSPLOWO2_02_FULL_62_14 | 743 | Open in IMG/M |
3300018082|Ga0184639_10039409 | All Organisms → cellular organisms → Bacteria | 2423 | Open in IMG/M |
3300018431|Ga0066655_10111564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1553 | Open in IMG/M |
3300018431|Ga0066655_10384491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 925 | Open in IMG/M |
3300018431|Ga0066655_10681956 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 695 | Open in IMG/M |
3300019789|Ga0137408_1294750 | All Organisms → cellular organisms → Bacteria | 4079 | Open in IMG/M |
3300025910|Ga0207684_10060343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3221 | Open in IMG/M |
3300025910|Ga0207684_10157380 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1956 | Open in IMG/M |
3300025910|Ga0207684_10319249 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
3300025910|Ga0207684_10566509 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 971 | Open in IMG/M |
3300025910|Ga0207684_11330159 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
3300025922|Ga0207646_10040589 | All Organisms → cellular organisms → Bacteria | 4185 | Open in IMG/M |
3300026089|Ga0207648_10735480 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 916 | Open in IMG/M |
3300026297|Ga0209237_1068801 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1676 | Open in IMG/M |
3300026297|Ga0209237_1289905 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
3300026307|Ga0209469_1097558 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 823 | Open in IMG/M |
3300026313|Ga0209761_1089539 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1568 | Open in IMG/M |
3300026317|Ga0209154_1040177 | All Organisms → cellular organisms → Bacteria | 2117 | Open in IMG/M |
3300026469|Ga0257169_1019105 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300026528|Ga0209378_1073583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 1565 | Open in IMG/M |
3300026536|Ga0209058_1075764 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1785 | Open in IMG/M |
3300026536|Ga0209058_1357709 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300026538|Ga0209056_10015534 | All Organisms → cellular organisms → Bacteria | 7571 | Open in IMG/M |
3300027332|Ga0209861_1068679 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
3300027846|Ga0209180_10009756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4935 | Open in IMG/M |
3300027846|Ga0209180_10292941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
3300027862|Ga0209701_10381528 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300027874|Ga0209465_10364192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 724 | Open in IMG/M |
3300027882|Ga0209590_10000552 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 12534 | Open in IMG/M |
3300027907|Ga0207428_11136616 | Not Available | 545 | Open in IMG/M |
3300027909|Ga0209382_10280764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1882 | Open in IMG/M |
3300027909|Ga0209382_10713199 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300027909|Ga0209382_11391619 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 705 | Open in IMG/M |
3300027961|Ga0209853_1017930 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10147866 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 645 | Open in IMG/M |
3300031226|Ga0307497_10062673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1344 | Open in IMG/M |
3300031668|Ga0318542_10211324 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 980 | Open in IMG/M |
3300031680|Ga0318574_10624978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411 | 631 | Open in IMG/M |
3300031720|Ga0307469_10065052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2382 | Open in IMG/M |
3300031740|Ga0307468_100640370 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 876 | Open in IMG/M |
3300031740|Ga0307468_101572504 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 613 | Open in IMG/M |
3300031751|Ga0318494_10818348 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300031820|Ga0307473_10030728 | Not Available | 2335 | Open in IMG/M |
3300031893|Ga0318536_10522743 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300031942|Ga0310916_10575271 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 958 | Open in IMG/M |
3300032001|Ga0306922_10920273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411 | 907 | Open in IMG/M |
3300032012|Ga0310902_10817309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
3300032051|Ga0318532_10376182 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300032052|Ga0318506_10324546 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300032180|Ga0307471_100392595 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1512 | Open in IMG/M |
3300032180|Ga0307471_100777323 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
3300032180|Ga0307471_101114997 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 955 | Open in IMG/M |
3300032180|Ga0307471_101173091 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 933 | Open in IMG/M |
3300032205|Ga0307472_100542450 | Not Available | 1013 | Open in IMG/M |
3300032205|Ga0307472_100741659 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 889 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.94% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 17.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.74% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.49% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.11% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.11% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.05% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.05% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.53% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.76% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.76% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.38% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.38% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.38% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.38% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.38% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.38% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.38% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.38% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000564 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B | Environmental | Open in IMG/M |
3300000709 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_09063212 | 2228664022 | Soil | MESTSRNDGVTLFADLAEFVSGHRPHGAMTADATEPVWNGYLLTVAWPCGVTFERWV |
ICChiseqgaiiDRAFT_06499691 | 3300000033 | Soil | LGDGVNSSRVDDLQEFVHDHRVHGALTADATEAARNGYPLTVACGVVFER |
F12B_100782501 | 3300000443 | Soil | VILLADLEDFVHDHRPDGPLAADATPPAWNGYLLT |
F24TB_124020192 | 3300000550 | Soil | MNPPADLPDFVQNHRPHGPLTADATQPAWNGYLLTVACACG |
RepKanNP_BrdU_F12BDRAFT_10026812 | 3300000564 | Soil | MTLQADLVLHHRPHGTLTGDATEPAWNGYLLAVACPC* |
KanNP_Total_F14TBDRAFT_10168512 | 3300000709 | Soil | VNLSDLDEFLDDHGPHGPLIADATEPAWNGYLLTVACRYGWWADADLF |
JGI11643J11755_116832361 | 3300000787 | Soil | IADLEDFVHDHRPHSPLTADATEPGWSGYLLTVACPWWGGV* |
JGI1027J12803_1013619122 | 3300000955 | Soil | LGDGVNSSRVDDLQEFVHDHRVHGALTADATEAARNGYPLTVACGVVFERWITPV |
F14TB_1006416382 | 3300001431 | Soil | VTLPDLEDFVHSHRPHGPMTADATEPAWNGYLLTVACLCGTVFER |
F14TB_1011000011 | 3300001431 | Soil | DLADFIAEHRPHGPLTADATPPAWNGYLLTVACSCGAVFERWAAIS* |
F14TB_1015007491 | 3300001431 | Soil | VNTLSLLADLDDFIGKHHPHGALTAAATEPAWNGYLLTVACSCGVLFERWVTP |
JGI25384J37096_100975752 | 3300002561 | Grasslands Soil | VNLLADLEDFVHDHRPHGPMTGDATEPAWNGYLLTVACPCGVVFGR* |
JGI25382J37095_102256991 | 3300002562 | Grasslands Soil | VTILTDLEEFGCNHRHHGPLTADATEPAWNGYLTTVAGASRI* |
JGI25382J43887_104076202 | 3300002908 | Grasslands Soil | MTLLADLEEFISDHCPHGPLTADATEPARNGYLLTVACPCGVTFER* |
JGI25386J43895_100924561 | 3300002912 | Grasslands Soil | VNLLADLEDFVHDHRPHGPMTGDATEPAWNGXLLTVACPCG |
Ga0062593_1029372491 | 3300004114 | Soil | VNLLADLQGFVSDHRSHGPLTADATEPAWNGYLLTVACSCGVV |
Ga0066396_100044262 | 3300004267 | Tropical Forest Soil | LLADLTEFAEDHHARGSLTADASEPAWNGYLLTVACPCGVVFERW* |
Ga0066674_100517172 | 3300005166 | Soil | MSLLTDLEEFISDHRPHGSMTADATEPAWKGYLLTVTCPCGVAFERWMTQSEAAVG* |
Ga0066677_104778972 | 3300005171 | Soil | VNPVNLLADLQDFVHDHRAHGPLTADATEPAWNGYLLTEVCPCGVVFER* |
Ga0066680_108447631 | 3300005174 | Soil | MTLLAELEEFVRDHRAHGALTGDATEPAWNGYLLTVACPCGVTFERWI |
Ga0066690_105549121 | 3300005177 | Soil | MTLLADLDEFVHDHRHGTLTGDATGRLLTVTCPCGVVFERWVT |
Ga0066688_100524387 | 3300005178 | Soil | VIQMTLLAELEEFVRDHRAHGALTGDATEPAWNGYLLTVAC |
Ga0066688_109767291 | 3300005178 | Soil | VTQMTLLAELEEFVRDHRAHGALTGDATEPAWNGYLLTVAC |
Ga0066685_102472932 | 3300005180 | Soil | VNLLADRQDFVHDHRAHGPLTADATPPAWNGYLLTVGVPVWRSI* |
Ga0066685_106041723 | 3300005180 | Soil | RTHLVNPVNLLAELNEFIHDHCPHGPLTGDATEPASNGYLLTVACPCGVVLER* |
Ga0066676_105331462 | 3300005186 | Soil | MVFEVSLLADLEDFVHDHRPHGPLTADAMEPAWDGYLLAVAGPCGVVF* |
Ga0066676_111629252 | 3300005186 | Soil | MILLLDLEAVYDHSSHGSLTADATPPAWNGYLLTVACPCGVVFERGSRLGRLS* |
Ga0065707_106568363 | 3300005295 | Switchgrass Rhizosphere | VDLFSDLTDFLHSHSPHGVLTADATEPAWNGYLLTVACSCGVVFEQWAMPADAE |
Ga0066388_1007888611 | 3300005332 | Tropical Forest Soil | MTLLSDLEEFVHDHRPHGGMTGDATTPAWNGYRLTVACACGV |
Ga0066388_1011502101 | 3300005332 | Tropical Forest Soil | VRMTLLADLEEFVHDHRAHGGMTGDATEPASNGYRLTVACACGVVFERWVTP |
Ga0066388_1017291021 | 3300005332 | Tropical Forest Soil | MTLLADLEEFVPDHRPHGGMTGDATEPLSNGYLLTVVCSGGVVFARW |
Ga0066388_1045186681 | 3300005332 | Tropical Forest Soil | MTLLADLEEFIRDHRPHGGMTGDATQPAWNGYRLTVACACGVVFERW |
Ga0066388_1053901011 | 3300005332 | Tropical Forest Soil | VRMTLLADLEEFVPDHRPHGGMTGDATEPLSNGYLLTVVCSGGVVFARW |
Ga0070674_1003781882 | 3300005356 | Miscanthus Rhizosphere | LTDLQEFVSDYHPHGPLSGDATEPEWNGYLLTVSCSCGVVFERWGTAMEANADLISWARQS* |
Ga0070708_1011974471 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLLADLEDFVRDHRSHGTLTADATEPAWNGYRLTVACPCGVV |
Ga0070708_1015052602 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MASLLADLREFISDHRPHGSLTADATEPAWNGYLLTVACPCGV |
Ga0070708_1018336191 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLLPDLEAFVRNHRRHGALTSDATEPAWNGYLLTVACPCGVVFERW |
Ga0066686_106586083 | 3300005446 | Soil | VNPVNLLAELDEFIHDHRAHGPLTCDAMEPAWNGYLLTVAC |
Ga0066689_101589071 | 3300005447 | Soil | LSEPLSDLREFVHDHRPHGTMTGDATVPAWNGYLVTVACPCGVVF |
Ga0066689_110165501 | 3300005447 | Soil | MPLQTDLEEFASDHCLHGPLTGDATKPAWNGYLLTVACPCGVV |
Ga0070706_1000927645 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSRNNPVTLLTDPEEFIADRRPHSPLTADATEPVWNDDLLTVACPCGVVFERG* |
Ga0070706_1007152731 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHMNLLTELEEFAHDHCPHGPLTADATEPAWNGYLLTAACPPCGV* |
Ga0070706_1012095851 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VTILTDLEEFGCNHRHHGPLTADATEPAWNGYLTTVAAASRI* |
Ga0070707_1004076334 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ELEAFVGDHRPHGPLTADATEPAWNGYLLTVACPCGATSSS* |
Ga0070698_1002682573 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLLAELEAFVGDHRPHGPLTADATEPAWNGYLLTVACPCGATSSS* |
Ga0070699_1001233491 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | NSRNNPVTLLTDPEEFIADRRPHSPLTADATEPVWNDDLLTVACPCGVVFERG* |
Ga0073909_103996201 | 3300005526 | Surface Soil | VNLLADLQGFVSDHRSHGPLTADATEPAWNGYRLTVACACGVVFG |
Ga0066701_105881241 | 3300005552 | Soil | MTLLAELEEFVRDHRAHGALTGDATEPAWNGYLLTVAC |
Ga0066695_104717212 | 3300005553 | Soil | VTLLADLEEFVRDHRPHGTLTSDATEPAWNGYLLTVACPCGVVFE |
Ga0066707_108072851 | 3300005556 | Soil | VNLLADLQDFVHDHRRHGSLTGDATEPAWNGYLVTVACPCGVVFERWVTPEERTRTC |
Ga0066698_103751441 | 3300005558 | Soil | VNAVTYLADLEEFVHEHRSHGTLTGDATEPAWNGY |
Ga0066698_109881671 | 3300005558 | Soil | VNLLTDLEEFVADHRPHGTLTGDATKPAWNGYLLTVTCPCGV |
Ga0066700_104222482 | 3300005559 | Soil | MRERWVTLMILLAELEEFVSAHRPHGALTADATEPAWNGYLLTVACPRCGV* |
Ga0066691_106405643 | 3300005586 | Soil | MSGQDILSADLADFIADHRPHGSLTADATTPAWNGYLLTVACSCGVVFERW |
Ga0066706_112703411 | 3300005598 | Soil | VNRVNLLADLEEFVHDHRPHGPLTGDATEPAWNGYLLTVACPCG |
Ga0070702_1010490122 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLADLQDFVSTHHPHGALAADATEPAWNGYLLTVAGACGVVFER* |
Ga0066905_1001196101 | 3300005713 | Tropical Forest Soil | MTLLADLEEFVHDHRRHGGMTGDATEPASNGYRLTVACACGVVFER* |
Ga0066905_1011285782 | 3300005713 | Tropical Forest Soil | MERDPARMTLLAADLEEFVRDHCPHGGMSGDATEPTPNGDRLTVACACGGVFER* |
Ga0066903_1008294683 | 3300005764 | Tropical Forest Soil | MTLLADLEVFVQDHRPHGQMTGDATEPAWNGYRLTVACACGVVFERWVT |
Ga0066903_1016033303 | 3300005764 | Tropical Forest Soil | VTVLADLEEFIHDHSPHGHLTAAATEPAWNGYLLSVACPCGVVF* |
Ga0066903_1027551852 | 3300005764 | Tropical Forest Soil | VTPLSADLEEFFQDHRPHGPHTSDATEPAWNGYLLTVACPCGVVFERWVTPE |
Ga0066903_1029323221 | 3300005764 | Tropical Forest Soil | MTLLADLEEFVREHRPHGWMTGDATEPAANGYRLTVKCS* |
Ga0066903_1061992262 | 3300005764 | Tropical Forest Soil | MTLLPELNEFVRDHRPHGQMIGDATVPAWNGYLLTVA |
Ga0066903_1070504121 | 3300005764 | Tropical Forest Soil | MSILHDLETFVLSHRQHGTMTADATEPAWNGYLLAVACLCGVVFGQWVTPRGC* |
Ga0068863_1010467471 | 3300005841 | Switchgrass Rhizosphere | VLAVLQDFVPPTTHGPLAADATEPAWNGYLLTVACACGVVFER* |
Ga0066656_108264772 | 3300006034 | Soil | HLVNPVNLLAELDEFIHDHRAHGPLTCDATEPAWNGYLLTVACPCGLSSPR* |
Ga0075417_100803072 | 3300006049 | Populus Rhizosphere | VTPLRDLADFIADHRSHGSMTADATEPAWNGYLLTMTCLCGVVFERWIAQWMPS* |
Ga0075417_102094351 | 3300006049 | Populus Rhizosphere | MNLLADLEDFVRNHRPHGSLTCDATERLEGYLLTVACPCGVVFE |
Ga0075028_1009329063 | 3300006050 | Watersheds | VSLLADPEDFVHDHRPHGPLTGDATEPAWNGYLLTVTCL |
Ga0075427_100086732 | 3300006194 | Populus Rhizosphere | VNSVSLLSDLEEFIHDHRLYGALTGDATEPAWNGYLLTVACSCGVIF* |
Ga0075427_100469312 | 3300006194 | Populus Rhizosphere | VTFLADLEDFLHFHRPHGSLTANATEPAWNGYLLTVACPC |
Ga0075422_103052581 | 3300006196 | Populus Rhizosphere | VNLSDLDEFLDDHGPHGPLIADATEPAWNGYLLTVACRYGVVGRRRPIFLV |
Ga0066665_107628823 | 3300006796 | Soil | VNPVNLLADLQDFVRDHRAHGPLTADATEPAWNGYLLTEVCPCGVVFERWV |
Ga0066659_101158791 | 3300006797 | Soil | DLEDFVSDHRLHGPLTADATEPAWNGYLLTVTCPCEGHI* |
Ga0066659_101737571 | 3300006797 | Soil | MSLLTALEEFVSDHRPHGSMTADATEPAWNGYLLTVVCPCGVVFERWVTRQDA |
Ga0066659_102040011 | 3300006797 | Soil | MRERVTLLRELRSFAHDHRPHGTLTANATEPAWNGYLLKVACPCGVVFERWV |
Ga0066660_114020473 | 3300006800 | Soil | VNPVNLLADLQDFVHDHRAHGPLTADATEPVWNGYVLTVACACGVVFERWVTPE |
Ga0075428_1001510124 | 3300006844 | Populus Rhizosphere | MTLLTDLEEFVREHHPHGALTGDATEPTANGCRLTVSCACGVVSERWVAPQERGR* |
Ga0075428_1005113831 | 3300006844 | Populus Rhizosphere | MTLLADLEVFVHDHQPHGSMTADATKPASNGYRLTVACVCGVV |
Ga0075428_1009638842 | 3300006844 | Populus Rhizosphere | VTVNLLADLEDFVHNHRPHGRLTAYATEPAWNGYL |
Ga0075428_1018830692 | 3300006844 | Populus Rhizosphere | HRPLTADATEPGGNGYLLTVACACGVVFGRWITPKMLTLTL* |
Ga0075428_1022506891 | 3300006844 | Populus Rhizosphere | VTFIADLEEFVHDHLPHGQLTGDATEPAWNGYLLTVACPCGVV |
Ga0075421_1003211081 | 3300006845 | Populus Rhizosphere | VSLLSDLEEFIHDHRLYGALTGDATEPAWNGYLLTVACSCGVIF* |
Ga0075421_1011040112 | 3300006845 | Populus Rhizosphere | MTTTRLTDLADFVDSQRPHGPLTADATEPAWNGYLLTVACPCGVVF* |
Ga0075421_1019523792 | 3300006845 | Populus Rhizosphere | MLLADLADFVTRHRPCGRLTGDATEPAPDGYMLSVGAT |
Ga0075421_1019539511 | 3300006845 | Populus Rhizosphere | MTLLADLEAFVHDHRSHGGLAGDATEPASNGYRLTVACACGVVFER |
Ga0075430_1000262821 | 3300006846 | Populus Rhizosphere | VSLLSDLEEFIHDHRLYGALTGDATEPAWNGYLLTVA |
Ga0075431_1021850911 | 3300006847 | Populus Rhizosphere | VPVALLPDLTEFIQNHRPHGSLTADATEPAWNGCRLTVACPCGVKFERWVTPRMPN* |
Ga0075433_106869891 | 3300006852 | Populus Rhizosphere | VARLTLTELRDFHDSHCLHGTLTADATEPTWNGYLLTVACSCGMTFE |
Ga0075433_109464382 | 3300006852 | Populus Rhizosphere | VVWLTDLTDFLYAHRPHSPLTADTTEPAWNGYQLTVACPCGVVFERW |
Ga0075433_116231282 | 3300006852 | Populus Rhizosphere | MTLLTDLEEFVQEHRPHGGMTGDATQTAWNGYLLTVAVRRGVER |
Ga0075425_1029952932 | 3300006854 | Populus Rhizosphere | MTLLADLEAFVHDHRPHGGVTGDATQPAWNGYRLTVAGACGVVFER* |
Ga0075434_1010949872 | 3300006871 | Populus Rhizosphere | MCLLADLEDFVHDHRAHGPLTADATPPAWNGYLLTVACPCGVVFERW |
Ga0075434_1018473871 | 3300006871 | Populus Rhizosphere | VNLFADLQEFVSDHRPHGTLTVDATAPAWNGYLLMVACSC |
Ga0075429_1006098591 | 3300006880 | Populus Rhizosphere | MILIADLEDFVHDHRSHGSMIADATPPAWNGYLLTVACPCGVVFE |
Ga0075429_1019399672 | 3300006880 | Populus Rhizosphere | VPVLTDLTDFIHDHRSHGPLTADATEPAWNGYLLTVACSCGVVFERWVT |
Ga0075424_1004751703 | 3300006904 | Populus Rhizosphere | MCLLADLEDFVHDHRAHGPLTADATPPAWNGYLLTVACPCGVVFERWV |
Ga0075424_1009597301 | 3300006904 | Populus Rhizosphere | MNLLADLEDFVRNHRPHGSLTCDATERLEGYLLTVACPCGVVF |
Ga0075424_1020826021 | 3300006904 | Populus Rhizosphere | VNLSDLHEFLDNHGPHGPLTADTTEPAWSGYLLTVACPC |
Ga0075436_1008759261 | 3300006914 | Populus Rhizosphere | VILLVDLEDFLLDHRPHGALTGDATEPAWNGYLLTVACSCGVVFERW |
Ga0079219_103210381 | 3300006954 | Agricultural Soil | VTVNLLADLEDFVNDHRPHGPLTADASTPEWNGYLLTVACSCG |
Ga0075419_106452972 | 3300006969 | Populus Rhizosphere | VNSVSLLSDLEEFIHDHRLYGALTGDATEPAWNGYLLTVACSCGVIFERWVTP* |
Ga0075419_106955733 | 3300006969 | Populus Rhizosphere | VNSVPLDDLREFVDDHRRHGPMTADATASAWNGYRLTVACPCGVVFER |
Ga0075419_108118512 | 3300006969 | Populus Rhizosphere | MTLLTDLEEFIREHHPHGALTGDATEPTANGCRLTVSCACGVVFERWVAPQERGR* |
Ga0099791_106624331 | 3300007255 | Vadose Zone Soil | VILFVDLKDFVHDHSRHGRLTADATESAWNGYLLTVACPCGVVFG |
Ga0066710_1025611592 | 3300009012 | Grasslands Soil | VNPVNLLAELNEFIHDHCPHGPLTGDATEPASNGYLLPA |
Ga0066710_1029382692 | 3300009012 | Grasslands Soil | MTLLADLEEFFLAHRPHGTLTGDAAERAWNGYMLTVACRVA |
Ga0066710_1031163411 | 3300009012 | Grasslands Soil | MTLLSDLEDFVHDHRPHGSLTGDATEPAWNGYLLTVA |
Ga0066710_1036825112 | 3300009012 | Grasslands Soil | MSLLTDLEEFVRDHWSHGTLTGDATEPAWNGYLLAVSWCSRGG |
Ga0099829_100646394 | 3300009038 | Vadose Zone Soil | DLTDFLYSHHPHGLPTADATTPAWNGYLVTVACPCGVTCERWVTPEQGRC* |
Ga0099829_113916732 | 3300009038 | Vadose Zone Soil | PMTLLADIEEFVRDHRWHGPLTGDATESAWNGYLLTVTCPWGVVFER* |
Ga0099830_107597161 | 3300009088 | Vadose Zone Soil | MALLADLEDFVHDHRPHGTLTSDATEPAWNGYLSS |
Ga0099830_114181761 | 3300009088 | Vadose Zone Soil | VTFRADLEEFVHDHRQHGPLTGDATEPAWNGYLLTVACPCGV |
Ga0099828_102647541 | 3300009089 | Vadose Zone Soil | VTLLTHLEEFVRDHRLHGPLTGDATEPVLNGYLLTVACLCGV |
Ga0099828_118762861 | 3300009089 | Vadose Zone Soil | VTLLIDLEEFVAAHRPHGTLTGNATEPACNGYLLTVACP |
Ga0099827_100001981 | 3300009090 | Vadose Zone Soil | VNLLADLEEFVHDHRPHGTLTGDATEPAWNGYLLTVACPCGVVFERWVT |
Ga0099827_100397891 | 3300009090 | Vadose Zone Soil | VTFLTDLEEFVHDHRPHGTLTGDATEPAWNGYLLTVACPCGVVFERWVT |
Ga0111539_114168151 | 3300009094 | Populus Rhizosphere | MTLLADLEAFVHNHHWHGGLTGDATEPTSNGYRLTVACA |
Ga0075418_101581252 | 3300009100 | Populus Rhizosphere | MTLLADLEQFASDHSTHRPLTADATEPGGNGYLLTVACACGVVFGRWITPKMLTLTL* |
Ga0075418_116074063 | 3300009100 | Populus Rhizosphere | LLTDLGDFVQNHRPPGPLTADATEPAWNGYRLTVACSCGVVF |
Ga0075418_123565741 | 3300009100 | Populus Rhizosphere | VTPLRDLADFIADHRPHGSMTADATEPAWNGYLLTVACAYGVVFERWITQVD |
Ga0066709_1031745142 | 3300009137 | Grasslands Soil | MSLLTDLEEFISDHRPHGSMTADATEPAWKGYLLTVSCPCRVVFERWMTQSEAAVG* |
Ga0066709_1032607091 | 3300009137 | Grasslands Soil | MTILADLEEFVCHHRLRGTLTSDATEPAGNGYPLTVACS |
Ga0114129_110527961 | 3300009147 | Populus Rhizosphere | VDLLLDLGGFVHDHHPHGPLTADATEPAWNGYLLTVAC |
Ga0114129_123489491 | 3300009147 | Populus Rhizosphere | VPVLTDLTGFIHDHRSHGPLTADATEPAWNGDLLTVA |
Ga0075423_106813301 | 3300009162 | Populus Rhizosphere | LERAPTHDGDLLAELEAFVRDHRPHGGMTGDATAPAWNGYLLTVACPCGV |
Ga0075423_121154821 | 3300009162 | Populus Rhizosphere | VNPVTLLADLEDFIHDHRPHGPLTADATEPAWNGYLLMVACPCGVVFERWVTPED |
Ga0075423_127183731 | 3300009162 | Populus Rhizosphere | MTLLADLEEFVCDHRRHGQMTGDATAPAWNSYLLTVTCLCSVIFERLVTLEDAELDL |
Ga0075423_132241691 | 3300009162 | Populus Rhizosphere | MTLLADLEAFVHYHRPHGGMTGDATEPAWNGYRLTVACACGVVF |
Ga0105249_115835991 | 3300009553 | Switchgrass Rhizosphere | MNRVSLPTDVEEFVHDHRPHCSLTADATTAWNGYLLTV |
Ga0126374_117706942 | 3300009792 | Tropical Forest Soil | MSLLADLEEFVRNHRPHGQMTGDTTEPAWNGYLLTVGCACGV |
Ga0126380_102853411 | 3300010043 | Tropical Forest Soil | MLHEQHVTLLADLEAFVHDHRLHGGMTCEATAPAWNGYLLTVACPCGVVFER* |
Ga0126380_114080001 | 3300010043 | Tropical Forest Soil | MTVLADLEEFVRDHRQHGQMTGDATEPEWNGYRLTVACACGVVFE |
Ga0126384_108637563 | 3300010046 | Tropical Forest Soil | MSLFPELEVFVLDHRPHGTLTSNATQPAWNGYRLTVACPCGV |
Ga0134088_101368652 | 3300010304 | Grasslands Soil | LADLEDFVHDHRPHGPLTADAMEPAWDGYLLAVAGPCGVVF* |
Ga0134088_103421691 | 3300010304 | Grasslands Soil | FVHDHRPHGTLTGDATEPAWNGYLLTVACLCGVVFGRWVTPED* |
Ga0134111_103412832 | 3300010329 | Grasslands Soil | VNPVNLLADLQDFVHDHRRHGSLTGDATEPAWNGYLVTGACPCGVVFERWVTPEYHVT |
Ga0134111_104189742 | 3300010329 | Grasslands Soil | VTLLADLEEFVHDHRTHGPLTGDATEPAWNGYLLTVTCPCGVVFERWITP |
Ga0134071_101086243 | 3300010336 | Grasslands Soil | GCGRDRRTHLVNPVTLPAELDEFIHDHRAHGPLTCDATEPAWNGYLLTVACPCGLSSPR* |
Ga0134071_101659171 | 3300010336 | Grasslands Soil | MTLFTDLAEFHTGHHPHGPLTADATESAWNGYLVTVACPCGVVFR |
Ga0134071_102731251 | 3300010336 | Grasslands Soil | VNPVNLLAELNEFIHDHCPHGPLTGDATEPAWTGYLLPVACSCGVVFRRW |
Ga0126376_104825293 | 3300010359 | Tropical Forest Soil | VTFLADLEEFINDHSPHGHLTADATLPAWNGYLLTVA |
Ga0126376_110818731 | 3300010359 | Tropical Forest Soil | MTLLTDLEEFVRDHRPHGGMSGDATEPASNGRLTVGCACGVMFERW |
Ga0126376_113265852 | 3300010359 | Tropical Forest Soil | MERDPARMTLLAADLEEFVRDHCPHGGMSGDATEPTPNGYRLTVACACGGVFER* |
Ga0126376_127638542 | 3300010359 | Tropical Forest Soil | MTLLADLEEFVRDHRPHGGMTDDATQPVWNGYRLTVACACGVVFERWVT |
Ga0126377_115227503 | 3300010362 | Tropical Forest Soil | MSILHDLETFVLNHRQHGTMTADATEPAWNGYLLTVACP* |
Ga0126377_124438881 | 3300010362 | Tropical Forest Soil | MSLLFGDLDEFVHDHRRHGSLTSDATQPAWNGYRLTVACPCGVVFERWGTPEE |
Ga0126377_129964591 | 3300010362 | Tropical Forest Soil | MTLLADLEEFVREHRPHGGLTGDATEPTANGHRLTVACACCVVFERWVTPEE |
Ga0126379_109617542 | 3300010366 | Tropical Forest Soil | MTLLAHLEQFVRDHRPHGGMTGDATQPASNGYLLT* |
Ga0126383_117316851 | 3300010398 | Tropical Forest Soil | MSILHDLETFALNHRRHGTMTADATEPSWNGYLLTVACPCGVVF |
Ga0137392_100247573 | 3300011269 | Vadose Zone Soil | MTLLADIEEFVRDHRWHGPLTGDATESAWNGYLLTVTCPWGVVFER* |
Ga0137389_102304771 | 3300012096 | Vadose Zone Soil | LADIEEFVRDHRWHGPLTGDATESAWNGYLLTVTCPWGVVFER* |
Ga0137388_114066713 | 3300012189 | Vadose Zone Soil | MTLLADIEEFVRDHRWHGPLTGDATESAWNGYLLTVTC |
Ga0137388_118045963 | 3300012189 | Vadose Zone Soil | MSLLTDLEDFVHDHRPHGPLTADATTPAWNGYLLWWRA |
Ga0137388_118725092 | 3300012189 | Vadose Zone Soil | MTLLVDIEEFVRDHRWHGPLTGDATESAWNGYLLTVACSCGVVFERWVTLGDA |
Ga0137383_108813141 | 3300012199 | Vadose Zone Soil | MTLLADLEEFVSDHRPHGALSADVTKPAWNGCLLQVACS |
Ga0137382_102231741 | 3300012200 | Vadose Zone Soil | MNVLAEFEEFVGDHHLHGAMTADATEPAWNGYLLTVACCCGVV* |
Ga0137365_109782561 | 3300012201 | Vadose Zone Soil | VTLWLTDLAEFAQDHRPHGPLTADNTAPVWNGYLLTVACPCGVVF |
Ga0137374_103424551 | 3300012204 | Vadose Zone Soil | MTLLADIEEFVRDHRWHGPLTGDATESAWNGYLLTV |
Ga0137374_112024971 | 3300012204 | Vadose Zone Soil | VTLLPDLEDFVHDHRSHGPLTGDATEPAWNGYLITVACPCGVVFGR |
Ga0137380_111828901 | 3300012206 | Vadose Zone Soil | VNPVNLLADLQDFVHDHRRHGSLTGDATEPAWNGY |
Ga0137381_109043981 | 3300012207 | Vadose Zone Soil | VTLLTDLEEFVADHRPHGTLTGDATEPAWNGYLLTVTCLCGVVFERWV |
Ga0137378_106045421 | 3300012210 | Vadose Zone Soil | MPLLADRADFVHDHRPHGSLTADATKPAWNGNLLTVACPCGV |
Ga0137378_116614491 | 3300012210 | Vadose Zone Soil | VTLWLTDLAEFAQDHRPHGPLTADNTAPVWNGYLLTVACPCGVV |
Ga0137377_108715563 | 3300012211 | Vadose Zone Soil | VNPVNLLADLQDFVHDHRAHGPLTADATPPAWNGYRLTVACP |
Ga0137369_101498492 | 3300012355 | Vadose Zone Soil | MTLLADLEEFFPEHRPHGVIAANATEPAWNGSLLTVACPCVLVISRKSGILDG* |
Ga0137369_105632922 | 3300012355 | Vadose Zone Soil | MSLLADLEEFVTDDRPHSTLTADATDPTCNGYLLTVTCPCGVVFGRWVTPDEALVNLAVL |
Ga0137369_107429041 | 3300012355 | Vadose Zone Soil | PMTLLADLEEFVADHRPHGPLTGDATEPAWNGYPLTVACPCGVVF* |
Ga0137360_103206581 | 3300012361 | Vadose Zone Soil | MTLLAELEAFFRDRRQHGGQTANATQPAWNGYLLTGACPCGVTFE |
Ga0137361_101370491 | 3300012362 | Vadose Zone Soil | VILLADLEEFVHDHRPHGPLTGDATEPAWNGYRLTVACPCGVV |
Ga0137361_107635793 | 3300012362 | Vadose Zone Soil | VNPVNLLADLEDFVHDHRPHGPMTGDATEPAWNGYLLTVACSCGVVFERWVT |
Ga0137358_104056062 | 3300012582 | Vadose Zone Soil | VTPLADLEEFIGDHRPHGPLVGDATEPVWNGYRLSVACPCGVVFERWV |
Ga0137396_104445173 | 3300012918 | Vadose Zone Soil | VPADLGEFLHAHRPHGSLTADAMEPAWNGYRLTVACKCGVVFE |
Ga0137396_107247431 | 3300012918 | Vadose Zone Soil | MALLDDLEDFVHDHRPHGPLTADATEPAWNGYLRTVACPCGGSV* |
Ga0137359_106779971 | 3300012923 | Vadose Zone Soil | LLSDLEGFLHSHRTHAALTADATPPAWNGYLLTVACPCGVVFGR* |
Ga0137359_107527551 | 3300012923 | Vadose Zone Soil | LNDLADFVHNHRPHGPLTADATEPAWNGHRLTVACPCGVVFERWVT |
Ga0137359_117023271 | 3300012923 | Vadose Zone Soil | VNLLADLQGFVSDHRPHGPMTADATEPTWNGYLLRVKCPYGVV |
Ga0137419_102406362 | 3300012925 | Vadose Zone Soil | STQVVTVLADREAFLHAHRPHGPLTADATEPAWNGYRLTVACKCGVVFERWVTPLGC* |
Ga0137419_103100081 | 3300012925 | Vadose Zone Soil | LADREDFFHDHRAHGPLTGDATEPAWNGYLLTVACPCSVTI* |
Ga0137419_106730081 | 3300012925 | Vadose Zone Soil | EDFFHDHRAHVTLTGDATEPAWNGNLLTAACPCSVTI* |
Ga0137404_101231803 | 3300012929 | Vadose Zone Soil | MTLLTDLEDFVHDHYPHGPMTADATEPAWNGYLLRVACP* |
Ga0137407_107338721 | 3300012930 | Vadose Zone Soil | DFVRDHQPHGNLTGDATEPAWNGYLLTVACPCSVTI* |
Ga0137410_103653282 | 3300012944 | Vadose Zone Soil | LADLEDFFHDHRAHGPLTGDATEPAWNGYLLTVACPCSVTI* |
Ga0126375_101153161 | 3300012948 | Tropical Forest Soil | LLADLEAFVRDHRPHGGMTGDATAPAWNGYVLRVTRPCGVVFER* |
Ga0126375_101861601 | 3300012948 | Tropical Forest Soil | MTLLAADLEEFVRDHCPHGGMSGDATEPTPNGDRLTVACACGGVFER* |
Ga0126375_101871531 | 3300012948 | Tropical Forest Soil | VSLLTDLQEFVHNHRPYDGMTADATEPEPNGYRLTVACACGVVFER |
Ga0126375_113986231 | 3300012948 | Tropical Forest Soil | MTLLADLEAFVRDHRPHGGMTGDATAPAWNGYVLRVTRPCGVVFER* |
Ga0126369_133299121 | 3300012971 | Tropical Forest Soil | MTLQADLEAFVHDHRAHGTLTGDATQPEWNGYRLTVACACGVVF |
Ga0134077_100212371 | 3300012972 | Grasslands Soil | VSLFADLADFIHDHRPHGALTGDATEPAWNGYLLTVTCPCGVVFERRVTPVDAEL |
Ga0134076_100572655 | 3300012976 | Grasslands Soil | MTLLADLEEFVADHRPHGPMTGYATEPAWNGYLLAVACPCGVVFGRL |
Ga0134075_105913041 | 3300014154 | Grasslands Soil | MTFFADLEDFVHDHRPHGALTGDATEPAWNGYRLTVS |
Ga0157380_128731572 | 3300014326 | Switchgrass Rhizosphere | VNLSDLDEFLDDHGPHGPLIADATEPAWNGYLLTVACRY |
Ga0134085_100555313 | 3300015359 | Grasslands Soil | MALLPDLSDFLHDHRPHGPLTADATEPAWKGYLLTVACPCG |
Ga0132258_116234382 | 3300015371 | Arabidopsis Rhizosphere | VTALADLEEFVADHHPHRTLIGDATEPAENGYLLTVACPCGVMFGCWVTPLD* |
Ga0132258_122342731 | 3300015371 | Arabidopsis Rhizosphere | MSRSRPPLGIPLLAELEEFEQEHRPHGPLTADATEPACNGYLLTVTCPCGV |
Ga0132255_1031792061 | 3300015374 | Arabidopsis Rhizosphere | MSLLADLEDFNHDHRPHGTPTADATEREWNGYLLTVTCPCGVVFERVTPEDVDAVQRG |
Ga0134112_102962763 | 3300017656 | Grasslands Soil | VSLLADLEEYVHDHRAHGALTGDATEPAWNGYLLT |
Ga0184621_100595493 | 3300018054 | Groundwater Sediment | VNLLTDLEEFVEDHRPHGPLTGDATEPAWNGYLLTVACPCGVVFERWVTPEE |
Ga0184623_1000301112 | 3300018056 | Groundwater Sediment | VTLLADLEEFVADHRAHRPLTGDASEPAWNGYLLSVACPVCRWCSSGG |
Ga0184612_103549902 | 3300018078 | Groundwater Sediment | MTLLADLEEFVADHRPHGTLTGDATAPAWNGYRLTVTCPCGVVFEAPPPSRSR |
Ga0184639_100394094 | 3300018082 | Groundwater Sediment | MRLLPDLDEFVADHRPHGALTGDATESAWNGDLLIVAC |
Ga0066655_101115641 | 3300018431 | Grasslands Soil | LEDFVHDHRPHGPLTADAMEPAWDGYLLAVAGPCGVVF |
Ga0066655_103844912 | 3300018431 | Grasslands Soil | MSLLTALEEFVSDHRPHGSMTADATEPAWNGYLLTVVCPCGVVF |
Ga0066655_106819561 | 3300018431 | Grasslands Soil | VISRMTLLAEIEAFVGDHRPHGTLTGDATEPVWNGYLITAACPCSITFERWVPP |
Ga0066662_101261224 | 3300018468 | Grasslands Soil | GNQPVTILTDLEEFGCNHRHHGPLTADATEPAWNGYLTTVAGASRI |
Ga0137408_12947503 | 3300019789 | Vadose Zone Soil | MTLLTDLEDFVHDHYPHGPMTADATEPAWNGYLLRVACP |
Ga0207684_100603431 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VTPRILADLEDFIHDHRPHGSLTADATEPAWNGYLLTAACPCGVVFIRWVTPE |
Ga0207684_101573803 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLLADLEEFISDHCPHGPLTADATEPAWNGYLLTVACPCGVTFER |
Ga0207684_103192492 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLLAELEGFVGDHRPHGMLTCDATEPAWNGYLLTVACPCGVTFERPFLGPRGRLR |
Ga0207684_105665094 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHMNLLTELEEFAHDHCPHGPLTADATEPAWNGYLLTAACPPCGV |
Ga0207684_113301592 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LLIDLAEFVTDHRPPGPLTADATEPMWNGYLLTVACPCGVVFG |
Ga0207646_100405896 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLLAELEAFVGDHRPHGPLTADATEPAWNGYLLAVACPCGVTFER |
Ga0207648_107354801 | 3300026089 | Miscanthus Rhizosphere | MPILADLEDFLRDHRPHGRLTADATEPAWNGYLLTAACSCGVVFER |
Ga0209237_10688012 | 3300026297 | Grasslands Soil | VTILTDLEEFGCNHRHHGPLTADATEPAWNGYLTTVAGASRI |
Ga0209237_12899051 | 3300026297 | Grasslands Soil | VNLLADLEEFVHDHRPHGTLTADATDPTCNGYLLTVTCPCGVVFGRWVTPDE |
Ga0209469_10975583 | 3300026307 | Soil | MSLLTDLEEFISDHRPHGSMTADATEPAWKGYLLTVTCPCGVAFERWMTQSEAAVG |
Ga0209761_10895395 | 3300026313 | Grasslands Soil | LTLLADLEDFVRSHRPHGAMIGDATAPAWNVYRLTIICPCSVVF |
Ga0209154_10401773 | 3300026317 | Soil | VNPVNLLADREDFVHDHPLHGPLTADATEPAWNGYL |
Ga0257169_10191053 | 3300026469 | Soil | MTLLADIEEFVRDHRWHGPLTGDATESAWNGYLLTVTCPCGVVFER |
Ga0209378_10735832 | 3300026528 | Soil | MSLLTDLEEFISDHRPHGSMTADATEPAWKGYLLTVSCPCRVAFERWMTQSEAAVG |
Ga0209058_10757641 | 3300026536 | Soil | GRDRRTHLVNPVNLLAELNEFIHDHCPHGPLTGDATEPASNGYLLTVACPCGVVLER |
Ga0209058_13577092 | 3300026536 | Soil | MVFEVSLLADLEDFVHDHRPHGPLTADAMEPAWDGYLLAVAGPCGVVF |
Ga0209056_100155347 | 3300026538 | Soil | MSLLTDLEEFISDHRPHGSMTADATEPAWKGYLLTVSCPCRVVFERWMTQSEAAVG |
Ga0209861_10686791 | 3300027332 | Groundwater Sand | VTLLADREGFVHDHRPHGTLTGDATEPVWNGYLLTV |
Ga0209180_100097566 | 3300027846 | Vadose Zone Soil | MTLLADIEEFVRDHRWHGPLTGDATESAWNGYLLTVTCPWGVVFER |
Ga0209180_102929412 | 3300027846 | Vadose Zone Soil | VTFRADLEEFVHDHRQHGPLTGDATEPAWNGYLLTVACPCGVVFERWV |
Ga0209701_103815282 | 3300027862 | Vadose Zone Soil | MSLLADLEDFVHDHRPHGTLTSDATEPAWNGYLSS |
Ga0209814_101012011 | 3300027873 | Populus Rhizosphere | VNLSDLDEFLDDHGPHGPLIADATEPAWNGYLLTVACRYGVVGRR |
Ga0209465_103641923 | 3300027874 | Tropical Forest Soil | MERDPTHRTLLANLEQFVRDHRPHGGMTGDATEPASNGYRLTVACTCGVVFERW |
Ga0209465_105179941 | 3300027874 | Tropical Forest Soil | MTLLADLEAFVQDHRPHGRMTSDATRPAWHGYRLTVA |
Ga0209590_1000055222 | 3300027882 | Vadose Zone Soil | LVCGRYRPVNLLADLEEFVHDHRPHGTLTGDATEPAWNGYLLTVACPCGVVFE |
Ga0207428_111366161 | 3300027907 | Populus Rhizosphere | MMYSDGARTRSHDLLADLEEFVRDHRLHGGMTGHATEPASNGYRLTVASACGVVFERWVT |
Ga0207428_112661382 | 3300027907 | Populus Rhizosphere | VNLSDLDEFLDDHGPHGPLIADATEPAWNGYLLTVACRYGVVGRRRPI |
Ga0209382_102807643 | 3300027909 | Populus Rhizosphere | VSLLSDLEEFIHDHRLYGALTGDATEPAWNGYLLTVACSCGVIF |
Ga0209382_107131992 | 3300027909 | Populus Rhizosphere | LADLGEFVADHCPHGTLTADATDPAWNDYLLTVACSRGVV |
Ga0209382_113916192 | 3300027909 | Populus Rhizosphere | MTTTRLTDLADFVDSQRPHGPLTADATEPAWNGYLLTVACPCGVVF |
Ga0209853_10179303 | 3300027961 | Groundwater Sand | VTLLADREGFVHDHRPHGTLTGDATEPVWNGYLLTVECLCGVVFERW |
(restricted) Ga0255310_101478663 | 3300031197 | Sandy Soil | ISLLTDLEDFVGSHRPHGPLTADATEPPWNGYLLTVAGVCGVVLSAG |
Ga0307497_100626732 | 3300031226 | Soil | VNLLGDIADFIADHCPHGALTADATEPAWNGYLLTVACPCGWYLSGG |
Ga0318542_102113241 | 3300031668 | Soil | VTVLADLYEFVCNHRPHGSLTADATEPAWNGYLLTVACACGVVFQR |
Ga0318574_106249782 | 3300031680 | Soil | VPVLGNLEVFVHDHRPHGPLASDATEPAWNGYLLTVNCPCG |
Ga0307469_100650523 | 3300031720 | Hardwood Forest Soil | MTLLSDLEEFVADHRPHGTMAGDATAPAVDCPCGVVFERWITTQEADLDLMRLALRN |
Ga0307469_101158022 | 3300031720 | Hardwood Forest Soil | MSLLFKDLTDFLHSPPHGLLTADATEPARNGYLLTVALWGDV |
Ga0307468_1006403702 | 3300031740 | Hardwood Forest Soil | VTFIADLEEFVHDHLPHGQLTGDATEPAWNGYMLTVACPCGVCLSVG |
Ga0307468_1015725042 | 3300031740 | Hardwood Forest Soil | VNLFADLEEFVHDHGPHGTLTGGATTPAWNGYRLTVACPCGVVF |
Ga0318494_108183481 | 3300031751 | Soil | VTVLADLYEFVSNHHPHGLLTADATEPAWNGYLVRVACPCGVVF |
Ga0307473_100307284 | 3300031820 | Hardwood Forest Soil | VNSVSLLADLEEFVTNHRPHGSMTGDATEPAWNGYLLTVACPCGVVFERWVT |
Ga0318536_105227431 | 3300031893 | Soil | MTLLADLEQFASDHRAHGPLTANATEPAGNGYLPTVVCSC |
Ga0310916_105752713 | 3300031942 | Soil | VPVLGNLEVFVHDHRPHGPLASDATEPAWNGYLLTVNCPCGVVFRSWITLAEAD |
Ga0306922_109202732 | 3300032001 | Soil | VPVLGNLEVFVHDHRPHGPLASDATEPAWNGYLLTVNCPCGVVF |
Ga0310902_108173092 | 3300032012 | Soil | VTLLADLEDFLHFHRPHGPLTPDATEPARNGYLLTVTCAC |
Ga0318532_103761822 | 3300032051 | Soil | MSRFLADLEDFVRTMMARHGTMTGDATEPALNGDLLTVACSCG |
Ga0318506_103245461 | 3300032052 | Soil | VTVLADLYGFVCNHRPHGSLTADATEPAWNGYLLTVNCPCGVVF |
Ga0310889_102285523 | 3300032179 | Soil | MLLADLADFVTRHRPCGRLTGDATEPAPEGYMLSVG |
Ga0307471_1003925951 | 3300032180 | Hardwood Forest Soil | VSVLPELREFIENHRPHGALTADASEPASNGYRLTVSCGCGVVFERWIT |
Ga0307471_1007773231 | 3300032180 | Hardwood Forest Soil | VNLLADLQDFVRDHRAHGPLTAEATEPAWNGYLLTV |
Ga0307471_1011149971 | 3300032180 | Hardwood Forest Soil | MNLLADLEDFVRDHRSHGTLTADATEPAWNGYMLTVACSCGVV |
Ga0307471_1011730911 | 3300032180 | Hardwood Forest Soil | VILLADLEEFIPDHRPHGPLTADATEPAWNGYMLTVACPCGWCLGGG |
Ga0307472_1005424501 | 3300032205 | Hardwood Forest Soil | VNSVSLLADLEEFVTNHRPQGRLTADATEPAWNGYLLTVACSCGVVF |
Ga0307472_1007416592 | 3300032205 | Hardwood Forest Soil | MLADLEEFVIEHRPHSPLTADATTPAWNGYLLTVACPCGVVFARWM |
Ga0307472_1015422392 | 3300032205 | Hardwood Forest Soil | VNLSDLDEFLDDHGPHGPLIADATEPAWNGYLLTVACRYGVVGR |
Ga0307472_1017086681 | 3300032205 | Hardwood Forest Soil | VKSSNVFADLEEFVHDNRPHGPLTADATESAWNGYLLTV |
⦗Top⦘ |