| Basic Information | |
|---|---|
| Family ID | F014495 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 262 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAEREKEQSK |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 262 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 80.92 % |
| % of genes near scaffold ends (potentially truncated) | 20.61 % |
| % of genes from short scaffolds (< 2000 bps) | 63.36 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (42.366 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (25.191 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.962 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.160 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.92% β-sheet: 0.00% Coil/Unstructured: 78.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 262 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 6.11 |
| PF05869 | Dam | 5.73 |
| PF00436 | SSB | 3.44 |
| PF13560 | HTH_31 | 2.67 |
| PF00476 | DNA_pol_A | 2.67 |
| PF00182 | Glyco_hydro_19 | 2.29 |
| PF16510 | P22_portal | 1.53 |
| PF08299 | Bac_DnaA_C | 1.53 |
| PF01510 | Amidase_2 | 1.53 |
| PF14090 | HTH_39 | 1.15 |
| PF03237 | Terminase_6N | 1.15 |
| PF10073 | DUF2312 | 1.15 |
| PF10991 | DUF2815 | 0.76 |
| PF11651 | P22_CoatProtein | 0.76 |
| PF05772 | NinB | 0.76 |
| PF13392 | HNH_3 | 0.76 |
| PF01844 | HNH | 0.38 |
| PF02739 | 5_3_exonuc_N | 0.38 |
| PF05065 | Phage_capsid | 0.38 |
| PF09588 | YqaJ | 0.38 |
| PF12708 | Pectate_lyase_3 | 0.38 |
| PF01507 | PAPS_reduct | 0.38 |
| PF16793 | RepB_primase | 0.38 |
| PF05257 | CHAP | 0.38 |
| PF11650 | P22_Tail-4 | 0.38 |
| PF04404 | ERF | 0.38 |
| PF13264 | DUF4055 | 0.38 |
| PF00239 | Resolvase | 0.38 |
| PF13554 | DUF4128 | 0.38 |
| PF14354 | Lar_restr_allev | 0.38 |
| PF14279 | HNH_5 | 0.38 |
| PF02767 | DNA_pol3_beta_2 | 0.38 |
| PF06356 | DUF1064 | 0.38 |
| PF05226 | CHASE2 | 0.38 |
| PF13203 | DUF2201_N | 0.38 |
| PF10926 | DUF2800 | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 262 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 3.44 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 3.44 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 2.67 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 2.29 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 2.29 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 1.53 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.38 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.38 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.38 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.38 |
| COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.38 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.37 % |
| Unclassified | root | N/A | 28.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10023517 | All Organisms → Viruses → Predicted Viral | 3497 | Open in IMG/M |
| 3300001605|Draft_10312799 | Not Available | 864 | Open in IMG/M |
| 3300002161|JGI24766J26685_10079922 | Not Available | 706 | Open in IMG/M |
| 3300002161|JGI24766J26685_10091018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300002835|B570J40625_100002215 | Not Available | 36105 | Open in IMG/M |
| 3300002835|B570J40625_100006132 | All Organisms → cellular organisms → Bacteria | 22349 | Open in IMG/M |
| 3300002835|B570J40625_100182358 | All Organisms → cellular organisms → Bacteria | 2315 | Open in IMG/M |
| 3300002835|B570J40625_101347554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300002835|B570J40625_101544616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300002856|draft_11310462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300002856|draft_11401370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
| 3300002856|draft_11522116 | All Organisms → cellular organisms → Bacteria | 16594 | Open in IMG/M |
| 3300003277|JGI25908J49247_10149113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300003429|JGI25914J50564_10003315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5439 | Open in IMG/M |
| 3300003429|JGI25914J50564_10014222 | Not Available | 2476 | Open in IMG/M |
| 3300003429|JGI25914J50564_10153882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300004054|Ga0063232_10128807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300004126|Ga0066179_10134319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 660 | Open in IMG/M |
| 3300004126|Ga0066179_10180707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300004481|Ga0069718_15639899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300004481|Ga0069718_16030358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300004769|Ga0007748_11544003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4 | 872 | Open in IMG/M |
| 3300005517|Ga0070374_10089666 | All Organisms → Viruses → Predicted Viral | 1602 | Open in IMG/M |
| 3300005517|Ga0070374_10210110 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300005517|Ga0070374_10426510 | Not Available | 665 | Open in IMG/M |
| 3300005517|Ga0070374_10615859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300005581|Ga0049081_10001783 | Not Available | 8116 | Open in IMG/M |
| 3300005581|Ga0049081_10008050 | Not Available | 3986 | Open in IMG/M |
| 3300005581|Ga0049081_10029280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2091 | Open in IMG/M |
| 3300005581|Ga0049081_10066439 | All Organisms → Viruses → Predicted Viral | 1357 | Open in IMG/M |
| 3300005581|Ga0049081_10118642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus larvae | 979 | Open in IMG/M |
| 3300005581|Ga0049081_10212164 | Not Available | 691 | Open in IMG/M |
| 3300005581|Ga0049081_10243732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300005581|Ga0049081_10316137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300005805|Ga0079957_1013951 | Not Available | 5896 | Open in IMG/M |
| 3300006121|Ga0007824_1041894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
| 3300006641|Ga0075471_10143813 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
| 3300006802|Ga0070749_10248658 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300006802|Ga0070749_10414780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300006802|Ga0070749_10763673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300006805|Ga0075464_10080395 | All Organisms → Viruses → Predicted Viral | 1850 | Open in IMG/M |
| 3300006805|Ga0075464_10217075 | Not Available | 1138 | Open in IMG/M |
| 3300006920|Ga0070748_1229559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas japonica | 672 | Open in IMG/M |
| 3300006920|Ga0070748_1344092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300007538|Ga0099851_1004976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5582 | Open in IMG/M |
| 3300007538|Ga0099851_1011388 | Not Available | 3640 | Open in IMG/M |
| 3300007545|Ga0102873_1000079 | Not Available | 36256 | Open in IMG/M |
| 3300007549|Ga0102879_1261400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium sufflavum | 516 | Open in IMG/M |
| 3300007559|Ga0102828_1081168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
| 3300007622|Ga0102863_1160376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300007708|Ga0102859_1088588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
| 3300007973|Ga0105746_1083593 | Not Available | 1035 | Open in IMG/M |
| 3300007974|Ga0105747_1003910 | Not Available | 3764 | Open in IMG/M |
| 3300007974|Ga0105747_1061328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1125 | Open in IMG/M |
| 3300008113|Ga0114346_1152420 | Not Available | 984 | Open in IMG/M |
| 3300008114|Ga0114347_1000989 | Not Available | 23423 | Open in IMG/M |
| 3300008116|Ga0114350_1032635 | Not Available | 2046 | Open in IMG/M |
| 3300008120|Ga0114355_1078046 | Not Available | 1377 | Open in IMG/M |
| 3300008120|Ga0114355_1154271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1396 | Open in IMG/M |
| 3300008266|Ga0114363_1005119 | All Organisms → Viruses | 8408 | Open in IMG/M |
| 3300008266|Ga0114363_1241634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus larvae | 515 | Open in IMG/M |
| 3300008267|Ga0114364_1000785 | Not Available | 36670 | Open in IMG/M |
| 3300008448|Ga0114876_1053077 | All Organisms → Viruses → Predicted Viral | 1817 | Open in IMG/M |
| 3300008450|Ga0114880_1000188 | Not Available | 37184 | Open in IMG/M |
| 3300008450|Ga0114880_1214274 | Not Available | 633 | Open in IMG/M |
| 3300008964|Ga0102889_1048776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
| 3300009050|Ga0102909_1043436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1133 | Open in IMG/M |
| 3300009051|Ga0102864_1092011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas japonica | 826 | Open in IMG/M |
| 3300009081|Ga0105098_10213720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300009081|Ga0105098_10423430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300009081|Ga0105098_10698741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300009082|Ga0105099_10791208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300009082|Ga0105099_10813848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300009131|Ga0115027_11725384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300009152|Ga0114980_10001456 | Not Available | 16950 | Open in IMG/M |
| 3300009152|Ga0114980_10025617 | Not Available | 3660 | Open in IMG/M |
| 3300009152|Ga0114980_10035549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3067 | Open in IMG/M |
| 3300009155|Ga0114968_10471346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300009159|Ga0114978_10081544 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 2164 | Open in IMG/M |
| 3300009161|Ga0114966_10288608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
| 3300009163|Ga0114970_10107206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1723 | Open in IMG/M |
| 3300009165|Ga0105102_10309715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
| 3300009180|Ga0114979_10299858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus larvae | 955 | Open in IMG/M |
| 3300009183|Ga0114974_10024670 | Not Available | 4209 | Open in IMG/M |
| 3300009183|Ga0114974_10034710 | All Organisms → cellular organisms → Bacteria | 3461 | Open in IMG/M |
| 3300009183|Ga0114974_10061955 | Not Available | 2476 | Open in IMG/M |
| 3300009183|Ga0114974_10431307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
| 3300009194|Ga0114983_1017723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1925 | Open in IMG/M |
| 3300010970|Ga0137575_10032293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300011115|Ga0151514_10014 | Not Available | 76673 | Open in IMG/M |
| 3300011334|Ga0153697_1061 | Not Available | 34735 | Open in IMG/M |
| 3300011334|Ga0153697_1200 | Not Available | 20381 | Open in IMG/M |
| 3300011334|Ga0153697_1375 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 14125 | Open in IMG/M |
| 3300011334|Ga0153697_1549 | Not Available | 10888 | Open in IMG/M |
| 3300011336|Ga0153703_1527 | Not Available | 12536 | Open in IMG/M |
| 3300011339|Ga0153700_10302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26549 | Open in IMG/M |
| 3300012017|Ga0153801_1035682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300012347|Ga0157142_1015799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1186 | Open in IMG/M |
| 3300012352|Ga0157138_1010771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1501 | Open in IMG/M |
| 3300012665|Ga0157210_1000797 | Not Available | 11291 | Open in IMG/M |
| 3300012667|Ga0157208_10053978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300013004|Ga0164293_10017422 | Not Available | 6010 | Open in IMG/M |
| 3300013004|Ga0164293_10051147 | Not Available | 3327 | Open in IMG/M |
| 3300013372|Ga0177922_10003217 | All Organisms → Viruses → Predicted Viral | 1327 | Open in IMG/M |
| 3300013372|Ga0177922_10185564 | Not Available | 3507 | Open in IMG/M |
| 3300013372|Ga0177922_11186400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300014811|Ga0119960_1081327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300015050|Ga0181338_1034069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
| 3300015050|Ga0181338_1060434 | Not Available | 545 | Open in IMG/M |
| 3300017716|Ga0181350_1012029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2463 | Open in IMG/M |
| 3300017716|Ga0181350_1020247 | All Organisms → Viruses → Predicted Viral | 1866 | Open in IMG/M |
| 3300017722|Ga0181347_1013274 | All Organisms → Viruses → Predicted Viral | 2657 | Open in IMG/M |
| 3300017722|Ga0181347_1033740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1588 | Open in IMG/M |
| 3300017736|Ga0181365_1056356 | Not Available | 977 | Open in IMG/M |
| 3300017747|Ga0181352_1109547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300017754|Ga0181344_1021178 | Not Available | 2017 | Open in IMG/M |
| 3300017761|Ga0181356_1009247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3804 | Open in IMG/M |
| 3300017761|Ga0181356_1011650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3345 | Open in IMG/M |
| 3300017761|Ga0181356_1035187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1779 | Open in IMG/M |
| 3300017761|Ga0181356_1051466 | Not Available | 1419 | Open in IMG/M |
| 3300017761|Ga0181356_1128257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300017761|Ga0181356_1155821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300017761|Ga0181356_1167464 | Not Available | 671 | Open in IMG/M |
| 3300017774|Ga0181358_1028660 | All Organisms → Viruses → Predicted Viral | 2185 | Open in IMG/M |
| 3300017777|Ga0181357_1025994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2319 | Open in IMG/M |
| 3300017777|Ga0181357_1038343 | All Organisms → Viruses → Predicted Viral | 1884 | Open in IMG/M |
| 3300017777|Ga0181357_1044630 | All Organisms → Viruses → Predicted Viral | 1740 | Open in IMG/M |
| 3300017777|Ga0181357_1073184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1317 | Open in IMG/M |
| 3300017780|Ga0181346_1017597 | All Organisms → Viruses → Predicted Viral | 3015 | Open in IMG/M |
| 3300017780|Ga0181346_1194529 | Not Available | 735 | Open in IMG/M |
| 3300017784|Ga0181348_1257463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 601 | Open in IMG/M |
| 3300017784|Ga0181348_1309237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus larvae | 527 | Open in IMG/M |
| 3300017785|Ga0181355_1169902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus larvae | 872 | Open in IMG/M |
| 3300017785|Ga0181355_1254959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300017785|Ga0181355_1345213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300019784|Ga0181359_1005816 | Not Available | 4063 | Open in IMG/M |
| 3300019784|Ga0181359_1011416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3191 | Open in IMG/M |
| 3300019784|Ga0181359_1021474 | Not Available | 2446 | Open in IMG/M |
| 3300019784|Ga0181359_1068087 | All Organisms → Viruses → Predicted Viral | 1352 | Open in IMG/M |
| 3300019784|Ga0181359_1080079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1225 | Open in IMG/M |
| 3300019784|Ga0181359_1092232 | All Organisms → Viruses → Predicted Viral | 1121 | Open in IMG/M |
| 3300019784|Ga0181359_1127971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus larvae | 899 | Open in IMG/M |
| 3300020151|Ga0211736_10586323 | Not Available | 35202 | Open in IMG/M |
| 3300020160|Ga0211733_10246417 | All Organisms → Viruses → Predicted Viral | 2470 | Open in IMG/M |
| 3300020160|Ga0211733_10515337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2498 | Open in IMG/M |
| 3300020162|Ga0211735_11529437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium sufflavum | 949 | Open in IMG/M |
| 3300020205|Ga0211731_11739078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1016 | Open in IMG/M |
| 3300020554|Ga0208599_1000371 | Not Available | 10860 | Open in IMG/M |
| 3300021141|Ga0214163_1112310 | Not Available | 620 | Open in IMG/M |
| 3300021141|Ga0214163_1116129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300021961|Ga0222714_10555745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300021962|Ga0222713_10000249 | Not Available | 60217 | Open in IMG/M |
| 3300021962|Ga0222713_10687038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300022190|Ga0181354_1016141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2306 | Open in IMG/M |
| 3300022190|Ga0181354_1045437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1459 | Open in IMG/M |
| 3300022190|Ga0181354_1090700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1002 | Open in IMG/M |
| 3300022200|Ga0196901_1031907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium sufflavum | 2050 | Open in IMG/M |
| 3300022200|Ga0196901_1193783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas japonica | 656 | Open in IMG/M |
| 3300022407|Ga0181351_1010895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3688 | Open in IMG/M |
| 3300022407|Ga0181351_1011172 | All Organisms → Viruses → Predicted Viral | 3649 | Open in IMG/M |
| 3300022407|Ga0181351_1022020 | Not Available | 2698 | Open in IMG/M |
| 3300022407|Ga0181351_1081610 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
| 3300024343|Ga0244777_10000359 | Not Available | 36260 | Open in IMG/M |
| 3300024343|Ga0244777_10539756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas japonica | 712 | Open in IMG/M |
| 3300024346|Ga0244775_10446543 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300024346|Ga0244775_10576500 | Not Available | 915 | Open in IMG/M |
| 3300024346|Ga0244775_11197770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300025075|Ga0209615_101121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1961 | Open in IMG/M |
| 3300025172|Ga0209105_114775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300025647|Ga0208160_1090305 | Not Available | 808 | Open in IMG/M |
| 3300027215|Ga0208166_1011978 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
| 3300027250|Ga0208310_1018618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1134 | Open in IMG/M |
| 3300027365|Ga0209300_1015465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1855 | Open in IMG/M |
| 3300027642|Ga0209135_1257631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300027659|Ga0208975_1001368 | All Organisms → Viruses | 10356 | Open in IMG/M |
| 3300027659|Ga0208975_1024824 | Not Available | 1944 | Open in IMG/M |
| 3300027659|Ga0208975_1093281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
| 3300027679|Ga0209769_1008464 | Not Available | 3788 | Open in IMG/M |
| 3300027679|Ga0209769_1024303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2126 | Open in IMG/M |
| 3300027693|Ga0209704_1037934 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
| 3300027693|Ga0209704_1259700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300027707|Ga0209443_1001871 | Not Available | 12779 | Open in IMG/M |
| 3300027707|Ga0209443_1118137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus larvae | 990 | Open in IMG/M |
| 3300027721|Ga0209492_1226207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → unclassified Synechococcaceae → Synechococcaceae cyanobacterium SM1_2_3 | 638 | Open in IMG/M |
| 3300027726|Ga0209285_10042034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1342 | Open in IMG/M |
| 3300027733|Ga0209297_1000243 | Not Available | 37168 | Open in IMG/M |
| 3300027736|Ga0209190_1136106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1082 | Open in IMG/M |
| 3300027754|Ga0209596_1018228 | Not Available | 4299 | Open in IMG/M |
| 3300027754|Ga0209596_1213762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300027756|Ga0209444_10145295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus larvae | 914 | Open in IMG/M |
| 3300027759|Ga0209296_1002479 | Not Available | 13249 | Open in IMG/M |
| 3300027759|Ga0209296_1031470 | Not Available | 2917 | Open in IMG/M |
| 3300027770|Ga0209086_10289467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300027782|Ga0209500_10015058 | Not Available | 4633 | Open in IMG/M |
| 3300027782|Ga0209500_10043637 | All Organisms → Viruses → Predicted Viral | 2441 | Open in IMG/M |
| 3300027785|Ga0209246_10013787 | Not Available | 3011 | Open in IMG/M |
| 3300027785|Ga0209246_10048891 | All Organisms → Viruses → Predicted Viral | 1629 | Open in IMG/M |
| 3300027792|Ga0209287_10172174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas japonica | 823 | Open in IMG/M |
| 3300027805|Ga0209229_10148994 | Not Available | 1054 | Open in IMG/M |
| 3300027892|Ga0209550_10155831 | Not Available | 1620 | Open in IMG/M |
| 3300027892|Ga0209550_10211479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1314 | Open in IMG/M |
| 3300027892|Ga0209550_10222869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1268 | Open in IMG/M |
| 3300027892|Ga0209550_10608731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300027900|Ga0209253_10624392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus larvae | 787 | Open in IMG/M |
| 3300027956|Ga0209820_1057411 | All Organisms → Viruses → Predicted Viral | 1034 | Open in IMG/M |
| 3300027956|Ga0209820_1117610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300027963|Ga0209400_1255958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300028025|Ga0247723_1004378 | Not Available | 6711 | Open in IMG/M |
| 3300028025|Ga0247723_1009423 | Not Available | 3910 | Open in IMG/M |
| 3300028025|Ga0247723_1013180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3074 | Open in IMG/M |
| 3300028025|Ga0247723_1104159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas japonica | 712 | Open in IMG/M |
| 3300028025|Ga0247723_1120312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300028066|Ga0255200_1037375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
| 3300031539|Ga0307380_10100273 | All Organisms → Viruses → Predicted Viral | 2987 | Open in IMG/M |
| 3300031539|Ga0307380_10366217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1311 | Open in IMG/M |
| 3300031673|Ga0307377_10779457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300031746|Ga0315293_11098580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300031758|Ga0315907_10026763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5258 | Open in IMG/M |
| 3300031758|Ga0315907_10155484 | Not Available | 1934 | Open in IMG/M |
| 3300031784|Ga0315899_10077043 | Not Available | 3451 | Open in IMG/M |
| 3300031857|Ga0315909_10005021 | All Organisms → Viruses | 15350 | Open in IMG/M |
| 3300031857|Ga0315909_10438158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
| 3300031951|Ga0315904_10043045 | Not Available | 5115 | Open in IMG/M |
| 3300031951|Ga0315904_10134639 | All Organisms → Viruses → Predicted Viral | 2531 | Open in IMG/M |
| 3300031951|Ga0315904_10395770 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300031951|Ga0315904_11348603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300031952|Ga0315294_11036733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300031963|Ga0315901_10480785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 973 | Open in IMG/M |
| 3300032050|Ga0315906_10321396 | Not Available | 1383 | Open in IMG/M |
| 3300032050|Ga0315906_10358507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1287 | Open in IMG/M |
| 3300032053|Ga0315284_10446619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1583 | Open in IMG/M |
| 3300032092|Ga0315905_10004791 | Not Available | 13840 | Open in IMG/M |
| 3300032092|Ga0315905_10009236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9989 | Open in IMG/M |
| 3300032092|Ga0315905_10017293 | Not Available | 7299 | Open in IMG/M |
| 3300032116|Ga0315903_10418969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
| 3300032116|Ga0315903_10684788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus larvae | 770 | Open in IMG/M |
| 3300032118|Ga0315277_11078570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300033980|Ga0334981_0343153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300033993|Ga0334994_0027971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3678 | Open in IMG/M |
| 3300033995|Ga0335003_0006390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6023 | Open in IMG/M |
| 3300033996|Ga0334979_0000312 | Not Available | 37885 | Open in IMG/M |
| 3300033996|Ga0334979_0371519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300034012|Ga0334986_0003038 | Not Available | 13481 | Open in IMG/M |
| 3300034012|Ga0334986_0123613 | All Organisms → Viruses → Predicted Viral | 1522 | Open in IMG/M |
| 3300034050|Ga0335023_0000221 | Not Available | 34756 | Open in IMG/M |
| 3300034060|Ga0334983_0065598 | All Organisms → Viruses → Predicted Viral | 2360 | Open in IMG/M |
| 3300034060|Ga0334983_0538479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas japonica | 647 | Open in IMG/M |
| 3300034061|Ga0334987_0013273 | Not Available | 7580 | Open in IMG/M |
| 3300034061|Ga0334987_0036955 | All Organisms → Viruses → Predicted Viral | 4198 | Open in IMG/M |
| 3300034061|Ga0334987_0405319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
| 3300034062|Ga0334995_0061770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2996 | Open in IMG/M |
| 3300034093|Ga0335012_0165492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1194 | Open in IMG/M |
| 3300034101|Ga0335027_0001413 | Not Available | 20729 | Open in IMG/M |
| 3300034104|Ga0335031_0034692 | All Organisms → Viruses → Predicted Viral | 3671 | Open in IMG/M |
| 3300034106|Ga0335036_0282421 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300034106|Ga0335036_0367867 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300034116|Ga0335068_0052306 | All Organisms → Viruses → Predicted Viral | 2389 | Open in IMG/M |
| 3300034121|Ga0335058_0020787 | Not Available | 3906 | Open in IMG/M |
| 3300034121|Ga0335058_0614393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300034200|Ga0335065_0338218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
| 3300034272|Ga0335049_0666536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300034356|Ga0335048_0124266 | All Organisms → Viruses → Predicted Viral | 1515 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 25.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.31% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.49% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.34% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.96% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.58% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.05% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.05% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.91% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.53% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.15% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.15% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.15% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.15% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.15% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.15% |
| Hydrocarbon Resource Environments | Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments | 1.15% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.76% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.76% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.38% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.38% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.38% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.38% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.38% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.38% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.38% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300002856 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Tailing Pond Surface TP_surface | Engineered | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006121 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
| 3300011339 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012347 | Freshwater microbial communities from Fish Creek, Ontario, Canada - S48 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025172 | Freshwater sediment bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - Sed-PBS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027215 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027250 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028066 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_1002351710 | 3300000882 | Freshwater And Marine | MIKPQQAAPMGRKHRVSSDSAWPLRGADGRTFAERRATHEKEQSK* |
| Draft_103127992 | 3300001605 | Hydrocarbon Resource Environments | MIKAQQAAPLGKNHRVSSENVWPLRGLDGKTFAERRAEQEKGK* |
| JGI24766J26685_100799222 | 3300002161 | Freshwater And Sediment | MIKFEAPKGKHYRVSSNSAFPLRGVDGKTFAERRAMREKEQGK* |
| JGI24766J26685_100910181 | 3300002161 | Freshwater And Sediment | MIKPAQAAPMGKKHRVSSDSAWPLRGADGKTFAERRKEQEQSK* |
| B570J40625_1000022158 | 3300002835 | Freshwater | MIKTPQAAPLGRKYRVSSESAWPLRGLDGKTFAERRKEREQGK* |
| B570J40625_1000061326 | 3300002835 | Freshwater | MIKAKQAAPMGKTYRVSSDSAWPLRGLDGKTYAERRAEQEKAQSK* |
| B570J40625_1001823583 | 3300002835 | Freshwater | MIKTPQQAAPTGRKYRVSSESAWPLKALDGKTWAERRKEREQGK* |
| B570J40625_1013475542 | 3300002835 | Freshwater | MIKTQQAAPMGRKHRISSDSAWPLRGLDGKTFAERRAEREKEQSK* |
| B570J40625_1015446163 | 3300002835 | Freshwater | MIKPQQAAPMGRNHRVSSDSAWPLRGPDGKTFAERRAEREKEQSK* |
| draft_113104622 | 3300002856 | Hydrocarbon Resource Environments | MIKPAQAAPLGKTYRVSSESAWPLRGLDGKTFAERRAMREKEQGK* |
| draft_114013703 | 3300002856 | Hydrocarbon Resource Environments | MIKTQQAAPLGRKHRVSSDSAWPLRGLDGKTFAERRADREREQGK* |
| draft_1152211632 | 3300002856 | Hydrocarbon Resource Environments | MIVAQQAAPLGKAHRVSSDSAWPLRGVDGKTFAERRSEQKKATSK* |
| JGI25908J49247_101491133 | 3300003277 | Freshwater Lake | MIKPQQAAPLGRKYRVSSESAWPLRGLDGKTFAERRKEREQGK* |
| JGI25914J50564_100033156 | 3300003429 | Freshwater Lake | MIKIPQAAPLNRNHRVSSDSAWPLRGPDGKTFAERRKEQEQRKC* |
| JGI25914J50564_100142223 | 3300003429 | Freshwater Lake | MIKTPQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKEKEQGK* |
| JGI25914J50564_101538822 | 3300003429 | Freshwater Lake | MSKIPQAAPLGRKYRVSSESAWPLRGPDGKTFAERRKEKEQRK* |
| Ga0063232_101288073 | 3300004054 | Freshwater Lake | MIKTPQAAPLNRNYRVSSESVWPLRGLDGKTFAERRKEQEQRK* |
| Ga0066179_101343192 | 3300004126 | Freshwater Lake | MFKTPQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKEKDQGK* |
| Ga0066179_101807072 | 3300004126 | Freshwater Lake | MNKIPPQAAPLKRGHRVSSDSAWPLRGLDGKTWAERRKEKDQRK* |
| Ga0069718_156398991 | 3300004481 | Sediment | MIKPAQAAPIGKPYRVSSESAWPLRGADGKTFAERRKEQEKKQ* |
| Ga0069718_160303581 | 3300004481 | Sediment | MIKPAQAAPMGKTHRVSSDSAWPLRGADGKTFAERRKEQEKKQ* |
| Ga0007748_115440032 | 3300004769 | Freshwater Lake | MINPAQAAPMGIKHRVSSDSAWPLRGLDGKTWAERRAEREKEQRK* |
| Ga0070374_100896665 | 3300005517 | Freshwater Lake | MINPQQAAPIGRKHRVSSDSAWPLRGLDGKTWAERKAQEKRK* |
| Ga0070374_102101103 | 3300005517 | Freshwater Lake | MSKIPQQAPLGRNYRVSSESVWPLRSSIDGKTFAERRKEQEQRK* |
| Ga0070374_104265101 | 3300005517 | Freshwater Lake | MIKTPQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRK |
| Ga0070374_106158592 | 3300005517 | Freshwater Lake | MIKIPQAAPLNRNHRVSSDSAWPLRGLDGKTFAERRKEKEQRK* |
| Ga0049081_1000178315 | 3300005581 | Freshwater Lentic | MIKTPQAAPLGRNYRVSSESAFPLRDINGKTWAERRKEKEQGK* |
| Ga0049081_100080501 | 3300005581 | Freshwater Lentic | MFKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAEREKEQGK* |
| Ga0049081_100292804 | 3300005581 | Freshwater Lentic | MIKTPQAAPLGRKYRVSSESAWPLRGLDGKTFAERRKEQEQRK* |
| Ga0049081_100664394 | 3300005581 | Freshwater Lentic | MIKPAQAAPMGKKHRVSSDNAWPLRGVDGKTFAERRKEQEKELSQ* |
| Ga0049081_101186421 | 3300005581 | Freshwater Lentic | MSKIPQAAPLGRKYRVSSDSAWPLRGLDGKTFAERRKEQEQRK* |
| Ga0049081_102121642 | 3300005581 | Freshwater Lentic | MIKTPQQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKEKEQGK* |
| Ga0049081_102437323 | 3300005581 | Freshwater Lentic | MSKIPQAAPLGRKYRVSSDSAWPLRGMDGKTFAERRKEQEQRK* |
| Ga0049081_103161371 | 3300005581 | Freshwater Lentic | MFKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRKEREQAKCQDQ* |
| Ga0079957_101395114 | 3300005805 | Lake | MIKPQQAAPMGRKHRISSDSAWPLRGLDGKTFAERRAMREKEQSK* |
| Ga0007824_10418943 | 3300006121 | Freshwater | GVAGRGGGMTPQIAPIGRTYRISSDSAWPLRNSKGQTFAEAKAERENKEKSK* |
| Ga0075471_101438133 | 3300006641 | Aqueous | MIKTPQQAAPMGRKHRISSDSAWPLRGLDGKTFAERRAEREKEQSK* |
| Ga0070749_102486583 | 3300006802 | Aqueous | MIKTPQAAPLRKPYRISSENAWPLRGPDGKTFAERRAEREKEQSK* |
| Ga0070749_104147802 | 3300006802 | Aqueous | MIKPQQAAPMGRNYRVSSDDAWPLRGPDGKTFAERRAEREKDQSK* |
| Ga0070749_107636732 | 3300006802 | Aqueous | MIKPAQAAPMGKTHRVSSDSAWPLRGADGKTFAERRKEQEQSK* |
| Ga0075464_100803952 | 3300006805 | Aqueous | MIKTPQAAPLGRKYRVSSENAWPLRGLDGKTFAERRKEREQGK* |
| Ga0075464_102170755 | 3300006805 | Aqueous | MIKTPQQAAPLGRNYRVSSESAFPLRDINGKTWAERRKEKEQGK* |
| Ga0070748_12295592 | 3300006920 | Aqueous | MIKPQQAAPMGKSHRVSSDSAWPLRGADGKTFAERRKEQEQSK* |
| Ga0070748_13440923 | 3300006920 | Aqueous | RIYGGAAMIKPAQAAPMGKTHRVSSDSAWPLRGADGKTFAERRKEQEQKQ* |
| Ga0099851_10049765 | 3300007538 | Aqueous | MKMLQAAPKNQPRRVSSDSAWPLRGVDGLTFAERKAKEQEKKHD* |
| Ga0099851_10113884 | 3300007538 | Aqueous | MIKAQQAAPLGKTYRVSSENAWPLRGLDGKTFAERRAEQEKESNK* |
| Ga0102873_100007928 | 3300007545 | Estuarine | MIKTQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAMREKEQAKCLDQ* |
| Ga0102879_12614002 | 3300007549 | Estuarine | MIKAKQAAPLGKTYRVSSDSAWPLRGLDGKTFAERRKEREQNK* |
| Ga0102828_10811682 | 3300007559 | Estuarine | MIKTPQAAPLGRKYRVSSESAWPLRGLDGKTFAERRKEKEQSK* |
| Ga0102863_11603761 | 3300007622 | Estuarine | QAAPMGKTHRGSSDSAWPLRGADGKTFAERRKEQEQSK* |
| Ga0102859_10885883 | 3300007708 | Estuarine | MISPAQAAPLRMRHRVSSDDAWPLRGIDGKTFAERFAKKKKDQRK* |
| Ga0105746_10835935 | 3300007973 | Estuary Water | KTPQAAPLGKPYRISSENAWPLRGLDGKTFAERRAEREKEQGK* |
| Ga0105747_10039103 | 3300007974 | Estuary Water | MVMIKAQQAAPMGRKHRISSDSAWPLRGLDGKTFAERRAEREKEQSK* |
| Ga0105747_10613283 | 3300007974 | Estuary Water | MIKPQQAAPMGRTHRVSSDSAWPLRAADGRTFAERRAEREKEQAKWQGQ* |
| Ga0114346_11524203 | 3300008113 | Freshwater, Plankton | MNIAKQAAPMGKTYRVSSDSAWPLRGLDGKTFAERRKEQDNGPSKS* |
| Ga0114347_100098932 | 3300008114 | Freshwater, Plankton | MIKAQQAAPMGKPYRVSSDSAWPLRGLDGKTFAERRAEREKGQSK* |
| Ga0114350_10326351 | 3300008116 | Freshwater, Plankton | MIKPAQAAPMGKKHRVSSESAWPLRGVDGLTFAERKAKEQGQGK* |
| Ga0114355_10780466 | 3300008120 | Freshwater, Plankton | PPRHLRILIMIKPAQAAPLGKKHRVSSDSAWPLRGVDGLTFAERKAKEQGQGK* |
| Ga0114355_11542714 | 3300008120 | Freshwater, Plankton | MIKPAQAAPLGKKHRVSSDSAWPLRGVDGKTFAERRKEQEEANGKS* |
| Ga0114363_100511912 | 3300008266 | Freshwater, Plankton | MFKPQQAAPMGRKHRVSSDSAWPLRSSIDGKTFAERRAEREKEQSK* |
| Ga0114363_12416342 | 3300008266 | Freshwater, Plankton | QAAPMGRNHRVSSDNAWPLRGLDGKTFAERRAEREKELSK* |
| Ga0114364_100078510 | 3300008267 | Freshwater, Plankton | MIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERKRDEKEQSK* |
| Ga0114876_10530774 | 3300008448 | Freshwater Lake | MIKPQQAAPMGRSHRVSSDSAWPLRGLDGKTFAERRAEREKEQSK* |
| Ga0114880_10001888 | 3300008450 | Freshwater Lake | MINPAQAAPVGMKNRVSSDSAWPLRGLDGKTWAERRAEREKEQRK* |
| Ga0114880_12142741 | 3300008450 | Freshwater Lake | MIKPAQAAPLGKKHRVSSDSAWPLRGVDGLTFAERKAK |
| Ga0102889_10487761 | 3300008964 | Estuarine | TDNYNRTVKDRHMIKTQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAMREKEQAKCLDQ* |
| Ga0102909_10434361 | 3300009050 | Estuarine | PMGRKHRVSSDSAWPLRGLDGKTFAERRAMREKEQAKCLDQ* |
| Ga0102864_10920113 | 3300009051 | Estuarine | MIKPQQAAPMGRTHRVSSDSAWPLRAADGRTFAERRAEREKEQSK* |
| Ga0105098_102137201 | 3300009081 | Freshwater Sediment | MIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAMREKEQSK* |
| Ga0105098_104234301 | 3300009081 | Freshwater Sediment | PMGRNHRVSSDSAWPLRGLDGKTFAERKAQVPSKCQDQ* |
| Ga0105098_106987413 | 3300009081 | Freshwater Sediment | MIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAMREREQGK* |
| Ga0105099_107912081 | 3300009082 | Freshwater Sediment | MIKAQQAAPMGRKHRISSDSAWPLRGLDGKTFAERRAEREKEQSK* |
| Ga0105099_108138483 | 3300009082 | Freshwater Sediment | MIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAEREKEQSK* |
| Ga0115027_117253843 | 3300009131 | Wetland | MINAQQAAPMGKNHRVSSDSAWPLRGADGKTFAERRKEQEQKQ* |
| Ga0114980_100014567 | 3300009152 | Freshwater Lake | MIKIPQQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKEKEQGK* |
| Ga0114980_100256173 | 3300009152 | Freshwater Lake | MIKVAQIAPMGRKYRISSDSASVWPLRGLDGKTWAERRAEQEKESNK* |
| Ga0114980_100355492 | 3300009152 | Freshwater Lake | MIKTPQAAPIGRKYRVSSESAWPLRDLNGKTWAERRKEREQGK* |
| Ga0114968_104713462 | 3300009155 | Freshwater Lake | MIKTPQAAPIGRKYRVSSESAWPLRDLNGKTWAERRKEKEQGK* |
| Ga0114978_100815442 | 3300009159 | Freshwater Lake | MIKTPQAAPLGRKYRVSSDIAWPLRDLNGKTWAERRKEKEQGK* |
| Ga0114966_102886084 | 3300009161 | Freshwater Lake | MIKTPQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKEKDQGK* |
| Ga0114970_101072065 | 3300009163 | Freshwater Lake | MSMIKPQQAAPLGRKYRVSSDSAWPLRDLNGKTWAERRKEKEQGK* |
| Ga0105102_103097153 | 3300009165 | Freshwater Sediment | MIKPQQAAPMGRKYRVSSDSAWPLRGLDGKTFAERRAMREKEQSK* |
| Ga0114979_102998582 | 3300009180 | Freshwater Lake | MIKTPQQAAPLGRKYRVSSDSAWPLRDLNGKTWAERRKEREQGK* |
| Ga0114974_100246707 | 3300009183 | Freshwater Lake | MIKTPQAAPLGRKYRVSSESAWPLRGLDGRTWAERRKEREQGK* |
| Ga0114974_100347105 | 3300009183 | Freshwater Lake | MIKIPQAAPLNRNYRVSSDSAWPLRGLDGKTWAERRKEKEQRKC* |
| Ga0114974_100619556 | 3300009183 | Freshwater Lake | MIKTQQAAPMGRKHRISSDSAWPLRGLDGKTFAERRAMREKEQSK* |
| Ga0114974_104313073 | 3300009183 | Freshwater Lake | MIKIPQAAPLNRNHRVSSDSAWPLRGLDGKTFAERRKEQEQRKC* |
| Ga0114983_10177232 | 3300009194 | Deep Subsurface | MIKPQQAAPMGRNHRVSSDSAWPLRGLDGKTFAERRAEREKEQSK* |
| Ga0137575_100322933 | 3300010970 | Pond Fresh Water | MIKPAQAAPMGKTHRVSSDSAWPLRGSDGLTFAERKAKEQEQGK* |
| Ga0151514_1001441 | 3300011115 | Freshwater | MIKTPQAAPLGRKYRVSSENAWPLRGLDGKTFAERHKEKEQNK* |
| Ga0153697_10618 | 3300011334 | Freshwater | MIKPQQAAPMGRKHRVSSDSAWPLRGADGKTFAERRATHEKEQAKCQDQ* |
| Ga0153697_120011 | 3300011334 | Freshwater | MIKAAQAAPLGKTYRVSSENAWPLRGLDGKTFAERRAEREKESNK* |
| Ga0153697_13759 | 3300011334 | Freshwater | MKVLHDAPKGQPRRVSSDSAWPLRGADGLTWAERKAKEREKGQ* |
| Ga0153697_15499 | 3300011334 | Freshwater | MIMIKTPQAAPLGRKYRISSENAWPLRGLDGKTFAERRKEKEQGK* |
| Ga0153703_152718 | 3300011336 | Freshwater | MIKAQQAAPMGKTHRVSSDSAWPLRGADGKTFAERRKEREQSK* |
| Ga0153700_1030216 | 3300011339 | Freshwater | MIKIPAQAAPLKRGHRVSSDSAWPLRGLDGKTFAERRKEQEQRK* |
| Ga0153801_10356825 | 3300012017 | Freshwater | AFDMIKTPQAAPLGRKYRVSSESAWPLRGLDGKTFAERRKEKEQSK* |
| Ga0157142_10157991 | 3300012347 | Freshwater | WQMIKPAQAAPMGKNHRVSSDSAWPLRGADGKTFAERRKEREQSK* |
| Ga0157138_10107713 | 3300012352 | Freshwater | MIKPAQAAPMGKSHRVSSDSAWPLRGADGKTFAERRKEQEQSK* |
| Ga0157210_10007975 | 3300012665 | Freshwater | MIKIPQAAPLNRNHRVSSDSAWPLRGLDGKTWAERRKEKEQRK* |
| Ga0157208_100539781 | 3300012667 | Freshwater | APLGKKHRVSSDSAWPLRGVDGLTFAERKAKEQGQGK* |
| Ga0164293_100174229 | 3300013004 | Freshwater | MIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAMREKEQSKCLDQ* |
| Ga0164293_1005114710 | 3300013004 | Freshwater | MIKPAQAAPLGKPYRVSSDSAFPLRNSEGLTFAEA |
| Ga0177922_100032176 | 3300013372 | Freshwater | MINPKQAAPLGRKYRVSSESAWPLRGLDGKTFAERRKEKEQSK* |
| Ga0177922_101855648 | 3300013372 | Freshwater | MIKPAQAAPLGKTYRVSSENAWPLRGLDGKTFAERRAEREKEQSK* |
| Ga0177922_111864003 | 3300013372 | Freshwater | MIKIPQAAPLKRNHRVSSDSAWPLRGLDGKTFAERR |
| Ga0119960_10813272 | 3300014811 | Aquatic | MIKTPQQAAPMGRKYRVSSEGAWPLRDINGKTWAERRKEKEQGK* |
| Ga0181338_10340692 | 3300015050 | Freshwater Lake | MIKPQQAAPMGRKHRVSSDNAWPLRDLNGKTWAERRVEREKEQSK* |
| Ga0181338_10604342 | 3300015050 | Freshwater Lake | MIKTQQAAPMGRKHRVSSDSAWPLRSSIDGKTFAERRAMREKEQSK* |
| Ga0181350_10120293 | 3300017716 | Freshwater Lake | MINPAQAAPMGIKHRVSSDSAWPLRGLDGKTWAERRAEREKEQGK |
| Ga0181350_10202474 | 3300017716 | Freshwater Lake | MIKPQQAAPMGRKHRVSSDSAWPLRDLNGKTWAERRVEREKEQSK |
| Ga0181347_10132749 | 3300017722 | Freshwater Lake | MIKTPQAAPLGRKYRVSSESAWPLRSSIDGKTFAERRAMREKEQSK |
| Ga0181347_10337401 | 3300017722 | Freshwater Lake | GQSLWKACNQRRRWWHMINPAQAAPMGIKHRVSSDSAWPLRGADGKTFAERRKEMEQSK |
| Ga0181365_10563561 | 3300017736 | Freshwater Lake | QMINPAQAAPMGMKHRVSSDSASVWPLRGLDGKTWAERRAEREKEQRK |
| Ga0181352_11095473 | 3300017747 | Freshwater Lake | MIKTPQQAAPMGRKHRISSDSAWPLRGLDGKTFAERRAEREKEQAKCLDQ |
| Ga0181344_10211784 | 3300017754 | Freshwater Lake | MIRPQAAPLGRKGRVSSESAWPLRGVDGKTFAERRNEREKSK |
| Ga0181356_10092473 | 3300017761 | Freshwater Lake | MSKIPQQAAPLGRNYRVSSDSAWPLRGLDGKTFAERRKEQEQRK |
| Ga0181356_10116502 | 3300017761 | Freshwater Lake | MLKTPPRQAAPLGRNYRVSSESAFPLRDLNGKTWAERRKEKEQGK |
| Ga0181356_10351876 | 3300017761 | Freshwater Lake | MINPAQAAPMGIKHRVSSDSAWPLRGLDGKTWAERRA |
| Ga0181356_10514662 | 3300017761 | Freshwater Lake | MINPAQAAPMGIKHRVSSDSASVWPLRGLDGKTWAERRAEREKEQRK |
| Ga0181356_11282571 | 3300017761 | Freshwater Lake | LMIKTPQAAPLGRKYRVSSESAWPLRGLDGKTFAERRKEREQGK |
| Ga0181356_11558212 | 3300017761 | Freshwater Lake | MIKTPQQAAPLGRTYRVSSENAWPLRDLNGKTWAERRKEREQGK |
| Ga0181356_11674644 | 3300017761 | Freshwater Lake | MIKTPQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKE |
| Ga0181358_10286606 | 3300017774 | Freshwater Lake | MGRKHRVSSDSAWPLRDLNGKTWAERRVEREKEQSK |
| Ga0181357_10259944 | 3300017777 | Freshwater Lake | MIKTPQAAPLGRTYRVSSESAFPLRDLNGKTWAERRKEKEQGK |
| Ga0181357_10383435 | 3300017777 | Freshwater Lake | MINPKQAAPLGRKYRVSSESAWPLRGLDGKTFAERRKEREQGK |
| Ga0181357_10446304 | 3300017777 | Freshwater Lake | MFKTPQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKEKEQGK |
| Ga0181357_10731846 | 3300017777 | Freshwater Lake | QAAPMGIKHRVSSDSAWPLRGLDGKTWAERRAEREKEQRK |
| Ga0181346_10175973 | 3300017780 | Freshwater Lake | MIKTPQAAPLGRKHRVSSDSAWPLRALDGRTWAERRKEREQGK |
| Ga0181346_11945292 | 3300017780 | Freshwater Lake | MKGKIMIKPQQAAPMGRKHRVSSDNAWPLRDLNGKTWAERRVEREKEQSK |
| Ga0181348_12574631 | 3300017784 | Freshwater Lake | MIKTQQAAPMGRKHRVSSDSAWPLRDLNGKTWAERRKEKEQGK |
| Ga0181348_13092371 | 3300017784 | Freshwater Lake | KLMLKTPPRQAAPLGRNYRVSSESAFPLRDINGKTWAERRKEKEQGK |
| Ga0181355_11699024 | 3300017785 | Freshwater Lake | WNCKMIKTPQQAAPMGRKYRVSSESAWPLRDLNGKTWAERRKEKEQGK |
| Ga0181355_12549591 | 3300017785 | Freshwater Lake | LWKACNQRQRWWHMINPAQAAPMGIKHRVSSDSAWPLRGADGKTFAERRKEMEQSK |
| Ga0181355_13452132 | 3300017785 | Freshwater Lake | MIKPQQAAPLGRTYRVSSESVWPLRSSIDGKTFAERRKEREQGK |
| Ga0181359_10058166 | 3300019784 | Freshwater Lake | MINPAQAAPMGIKHRVSSDSAWPLRGLDGKTWAERRAEREKEQRK |
| Ga0181359_10114168 | 3300019784 | Freshwater Lake | MIKTPQAAPLGRTYRVSSESVWPLRSSIDGKTFAERRKEREQGK |
| Ga0181359_10214747 | 3300019784 | Freshwater Lake | MIKIPQQAAPLGRNYRVSSESAFPLRDINGKTWAERRKEKEQGK |
| Ga0181359_10680872 | 3300019784 | Freshwater Lake | MIKTQQAAPMGRKHRISSDSAWPLRGLDGKTFAERRAMREKEQSK |
| Ga0181359_10800792 | 3300019784 | Freshwater Lake | MINPQQAAPIGRKHRVSSDSAWPLRGLDGKTWAERKAQEKRK |
| Ga0181359_10922322 | 3300019784 | Freshwater Lake | MIKTPQAAPLGRKYRVSSESAWPLRGLDGKTFAERRKEREQGK |
| Ga0181359_11279713 | 3300019784 | Freshwater Lake | MIKTPQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKEKEQGK |
| Ga0211736_1058632335 | 3300020151 | Freshwater | MFKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAEREKEQSK |
| Ga0211733_102464174 | 3300020160 | Freshwater | MIKTPAQAAPLGRKYRVSSESAWPLRDLNGKTWAERRKEKEQGK |
| Ga0211733_105153377 | 3300020160 | Freshwater | MIKPAQAAPLGKKHRVSSDSAWPLRGVDGKTFAERRKEQEDANGKS |
| Ga0211735_115294374 | 3300020162 | Freshwater | MIKVAQIAPMGRKYRVSSEGAWPLRGLDGKTWAERRAEREKESNK |
| Ga0211731_117390782 | 3300020205 | Freshwater | MTKIAQIAPMGRKYRVSSEGAWPLRGLDGKTFAERRAEREKESNK |
| Ga0208599_100037127 | 3300020554 | Freshwater | MIKAKQAAPMGKTYRVSSDSAWPLRGLDGKTYAERRAEQEKAQSK |
| Ga0214163_11123103 | 3300021141 | Freshwater | MIKAAQAAPLGKTYRVSSENAWPLRGLDGKTFAERRAEREKEQSK |
| Ga0214163_11161291 | 3300021141 | Freshwater | MIKPQQAAPMGRNHRVSSDSAWPLRGPDGKTFAERRAEREKEQSK |
| Ga0222714_105557452 | 3300021961 | Estuarine Water | MIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAMREKEQSK |
| Ga0222713_1000024950 | 3300021962 | Estuarine Water | MVTPIQAAPMGKTYRVSSESAWPLRGLDGKTFAERRKEKDNGPSKS |
| Ga0222713_106870383 | 3300021962 | Estuarine Water | NYNRTVKEKKMIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAMREKEQSK |
| Ga0181354_10161412 | 3300022190 | Freshwater Lake | MINPAQAAPVGMKHRVSSDSAWPLRGLDGKTWAERRAEREKEQRK |
| Ga0181354_10454375 | 3300022190 | Freshwater Lake | MIKPQQAAPMGRKHRVSSDNAWPLRDLNGKTWAERRVEREKEQSK |
| Ga0181354_10907003 | 3300022190 | Freshwater Lake | MFKTPQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKEKDQGK |
| Ga0196901_10319072 | 3300022200 | Aqueous | MIKAQQAAPLGKTYRVSSENAWPLRGLDGKTFAERRAEQEKESNK |
| Ga0196901_11937831 | 3300022200 | Aqueous | MIKPQQAAPMGKSHRVSSDSAWPLRGADGKTFAERRKEQEQGK |
| Ga0181351_10108956 | 3300022407 | Freshwater Lake | MIKTPQAAPLNRNYRVSSESVWPLRGLDGKTFAERRKEQEQRK |
| Ga0181351_10111727 | 3300022407 | Freshwater Lake | MKGKIMIKPQQAAPMGRKHRVSSDSAWPLRDLNGKTWAERRVEREKEQSK |
| Ga0181351_10220208 | 3300022407 | Freshwater Lake | MINPAQAAPMGMKHRVSSDSASVWPLRGLDGKTWAERRAEREKEQRK |
| Ga0181351_10816101 | 3300022407 | Freshwater Lake | MLKIPPRQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKE |
| Ga0244777_1000035937 | 3300024343 | Estuarine | MIKTQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAMREKEQAKCLDQ |
| Ga0244777_105397562 | 3300024343 | Estuarine | MIKAKQAAPLGKTYRVSSDSAWPLRGLDGKTFAERRKEREQNK |
| Ga0244775_104465431 | 3300024346 | Estuarine | PLNRNHRVSSDSAWPLRGLDGKTFAERRKEKEQRK |
| Ga0244775_105765003 | 3300024346 | Estuarine | MFKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRKEREQAKCQDQ |
| Ga0244775_111977701 | 3300024346 | Estuarine | MIKTPQAAPLGRKYRVSSESAWPLRGLDGKTFAERRKEKEQSK |
| Ga0209615_1011212 | 3300025075 | Freshwater | MIKTPQQAAPLGRKYRVSSDSAWPLRGLDGKTFAERHKEKEQGK |
| Ga0209105_1147752 | 3300025172 | Freshwater Sediment | MIKTPQQAAPLGRKYRVSSDSAWPLRSSIDGKTFAERRAMREKEQSK |
| Ga0208160_10903052 | 3300025647 | Aqueous | MKMLQAAPKNQPRRVSSDSAWPLRGVDGLTFAERKAKEQEQEKGND |
| Ga0208166_10119784 | 3300027215 | Estuarine | MIKTQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAMREKEQAKC |
| Ga0208310_10186186 | 3300027250 | Estuarine | PMGRKHRVSSDSAWPLRGLDGKTFAERRAMREKEQAKCLDQ |
| Ga0209300_10154652 | 3300027365 | Deep Subsurface | MIKPQQAAPMGRNHRVSSDSAWPLRGLDGKTFAERRAEREKEQSK |
| Ga0209135_12576312 | 3300027642 | Freshwater Lake | MINPAQAAPMGIKHRVSSDSAWPLRGADGKTFAERRKEMEQSK |
| Ga0208975_10013681 | 3300027659 | Freshwater Lentic | MFKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRKEREQAKCQD |
| Ga0208975_10248244 | 3300027659 | Freshwater Lentic | MIKTPQAAPLGRKYRVSSESAWPLRGLDGKTFAERRKEQEQRK |
| Ga0208975_10932811 | 3300027659 | Freshwater Lentic | MIKPAQAAPMGKKHRVSSDNAWPLRGVDGKTFAERRKEQEKELSQ |
| Ga0209769_10084646 | 3300027679 | Freshwater Lake | MIKIPQAAPLNRNHRVSSDSAWPLRGPDGKTFAERRKEQEQRKC |
| Ga0209769_10243035 | 3300027679 | Freshwater Lake | MSKIPQAAPLGRKYRVSSESAWPLRGPDGKTFAERRKEKEQRK |
| Ga0209704_10379345 | 3300027693 | Freshwater Sediment | MIKPQQAAPMGRKYRVSSDSAWPLRGLDGKTFAERRAEREKEQNK |
| Ga0209704_12597002 | 3300027693 | Freshwater Sediment | GRKHRVSSDSAWPLRGLDGKTFAERRAEREKEQNK |
| Ga0209443_10018711 | 3300027707 | Freshwater Lake | MIKTPQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKEK |
| Ga0209443_11181371 | 3300027707 | Freshwater Lake | TKLMIKTPQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKEKEQGK |
| Ga0209492_12262071 | 3300027721 | Freshwater Sediment | FPYRNARVVMIKPAQAAPLGKKHRVSSDSAWPLRGVDGKTFAERRKEQEQSK |
| Ga0209285_100420341 | 3300027726 | Freshwater Sediment | RPAHPFYRIDGGAAMIKPAQAAPMGKTHRVSSDSAWPLRGADGLTFAERKAKEREQSK |
| Ga0209297_100024312 | 3300027733 | Freshwater Lake | MIKVAQIAPMGRKYRISSDSASVWPLRGLDGKTWAERRAEQEKESNK |
| Ga0209190_11361065 | 3300027736 | Freshwater Lake | MIKPQQAAPLGRKYRVSSDSAWPLRDLNGKTWAERRKEKEQGK |
| Ga0209596_10182281 | 3300027754 | Freshwater Lake | MIKTPQAAPIGRKYRVSSESAWPLRDLNGKTWAERRKEKEQGK |
| Ga0209596_12137623 | 3300027754 | Freshwater Lake | MIKTPQAAPIGRKYRVSSESAWPLRDLNGKTWAERRKEREQGK |
| Ga0209444_101452952 | 3300027756 | Freshwater Lake | MIKIPQQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKEKEQGK |
| Ga0209296_100247913 | 3300027759 | Freshwater Lake | MNQIIKTPQAAPMGRKYRVSSESAWPLRDLNGKTWAERRKEKEQGK |
| Ga0209296_10314705 | 3300027759 | Freshwater Lake | MIKIPQAAPLNRNYRVSSDSAWPLRGLDGKTWAERRKEKEQRKC |
| Ga0209086_102894672 | 3300027770 | Freshwater Lake | MIKTPQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKEKDQGK |
| Ga0209500_100150584 | 3300027782 | Freshwater Lake | MIKTPQAAPLGRNYRVSSESAFPLRDINGKTWAERRKEKEQGK |
| Ga0209500_100436374 | 3300027782 | Freshwater Lake | MIKTPQAAPLGRKYRVSSDIAWPLRDLNGKTWAERRKEKEQGK |
| Ga0209246_100137877 | 3300027785 | Freshwater Lake | MIMIKTPQAAPLGRKYRVSSESAWPLRDLNGKTWAERRKEKDQGK |
| Ga0209246_100488915 | 3300027785 | Freshwater Lake | MIKTQQAAPMGRKHRVSSDSAWPLRSSIDGKTFAERRAMREKEQSK |
| Ga0209287_101721743 | 3300027792 | Freshwater Sediment | MIKPAQAAPMGKSHRVSSDSAWPLRGADGLTFAER |
| Ga0209229_101489942 | 3300027805 | Freshwater And Sediment | MIKFEAPKGKHYRVSSNSAFPLRGVDGKTFAERRAMREKEQGK |
| Ga0209550_101558317 | 3300027892 | Freshwater Lake | NQRRRWWHMINPAQAAPMGIKHRVSSDSAWPLRGLDGKTWAERRAEREKEQRK |
| Ga0209550_102114791 | 3300027892 | Freshwater Lake | NQRRRWWHMINPAQAAPMGIKHRVSSDSAWPLRGADGKTFAERRKEMEQSK |
| Ga0209550_102228692 | 3300027892 | Freshwater Lake | MNKIPPQAAPLKRGHRVSSDSAWPLRGLDGKTWAERRKEKDQRK |
| Ga0209550_106087312 | 3300027892 | Freshwater Lake | MIKIPQAAPLNRNHRVSSDSAWPLRGLDGKTFAERRKEKEQRK |
| Ga0209253_106243922 | 3300027900 | Freshwater Lake Sediment | MRDKHMIKTPQQAAPMGRKHRISSDSAWPLRGLDGKTFAERRAEREKEQSK |
| Ga0209820_10574111 | 3300027956 | Freshwater Sediment | MIKPQQAAPMGRKHRVSSDSAWPLRDINGKTWAERRKEKEQGK |
| Ga0209820_11176101 | 3300027956 | Freshwater Sediment | MLRLDVARACCLCFPYRNARVVMIKPAQAAPLGKKHRVSSDSAWPLRGVDGKTFAERRKEQEQSK |
| Ga0209400_12559581 | 3300027963 | Freshwater Lake | RKMIKTPQAAPIGRKYRVSSESAWPLRDLNGKTWAERRKEKEQGK |
| Ga0247723_10043784 | 3300028025 | Deep Subsurface Sediment | MIKAQQAAPMGRKHRISSDSAWPLRGLDGKTFAERRAEREKEQSK |
| Ga0247723_10094231 | 3300028025 | Deep Subsurface Sediment | HRKARVVMIKPAQAAPMGKKHRVSSDSAWPLRGADGKTFAERRKEQEKGK |
| Ga0247723_10131806 | 3300028025 | Deep Subsurface Sediment | MIKPQQAAPMGKKYRISSDSASVWPLRGADGKTFAERRKEQEQSK |
| Ga0247723_11041593 | 3300028025 | Deep Subsurface Sediment | MIKPAQAAPMGKSHRVSSDSAWPLRGADGKTFAEAKRRREQEQSK |
| Ga0247723_11203121 | 3300028025 | Deep Subsurface Sediment | LWKACSQHRRYWQMIKPAQAAPMGKKHRVSSDSAWPLRGVDGLTFAERRAKEQEQSK |
| Ga0255200_10373751 | 3300028066 | Freshwater | ARMVMIKTPQAAPLGKPYRISSENAWPLRGLDGKTFAERRAEREKEQGK |
| Ga0307380_101002739 | 3300031539 | Soil | MIKPQQAAPMGRKHRISSDSAWPLRSSIDGKTFAERRKEQEQEQEQSK |
| Ga0307380_103662173 | 3300031539 | Soil | MIKPQQAAPMGRKYRVSSDSAWPLRDLYGKTWAEAKRRREQEQEQSK |
| Ga0307377_107794572 | 3300031673 | Soil | MIKAAQAAPLGKTYRVSSENAWPLRGLDGKTFAERRAEREKESNK |
| Ga0315293_110985801 | 3300031746 | Sediment | MIKTPQAAPLGRKHRVSSDSAWPLRGLDGKTFAERRKEKEQGK |
| Ga0315907_1002676310 | 3300031758 | Freshwater | MIKPAQAAPLGKKHRVSSDSAWPLRGVDGKTFAERRKEQEEANGKS |
| Ga0315907_101554841 | 3300031758 | Freshwater | PLGKKHRVSSDSAWPLRGVDGLTFAERKAKEQGQGK |
| Ga0315899_100770439 | 3300031784 | Freshwater | MIKTQQAAPMGRKHRISSDSAWPLRGLDGKTFAERRAEREKEQSK |
| Ga0315909_1000502114 | 3300031857 | Freshwater | MFKPQQAAPMGRKHRVSSDSAWPLRSSIDGKTFAERRAEREKEQSK |
| Ga0315909_104381582 | 3300031857 | Freshwater | MIKTPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAEREKEQAKCQGQ |
| Ga0315904_100430457 | 3300031951 | Freshwater | MIKPAQAAPLGKKHRVSSDSAWPLRGVDGLTFAERKAKEQGQGK |
| Ga0315904_101346393 | 3300031951 | Freshwater | MIKPQQAAPMGRNHRVSSDNAWPLRGLDGKTFAERRAEREKELSK |
| Ga0315904_103957706 | 3300031951 | Freshwater | MIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERKRDEKEQSK |
| Ga0315904_113486032 | 3300031951 | Freshwater | MIKPQQAAPMGRNHRVSSDDAWPLRGLDGKTFAERRAEREKEQSK |
| Ga0315294_110367332 | 3300031952 | Sediment | MIKTPQAAPLGRKHRVSSESAWPLRGLDGKTFAERRKEKEQGK |
| Ga0315901_104807851 | 3300031963 | Freshwater | QAAPLGKKHRVSSDSAWPLRGVDGLTFAERKAKEQGQGK |
| Ga0315906_103213961 | 3300032050 | Freshwater | PRHLRILIMIKPAQAAPLGKKHRVSSDSAWPLRGVDGKTFAERRKEQEEANGKS |
| Ga0315906_103585071 | 3300032050 | Freshwater | MIKPAQAAPMGKKHRVSSESAWPLRGVDGLTFAERKAKEQGQGK |
| Ga0315284_104466194 | 3300032053 | Sediment | MIKIPQAAPLNRKYRVSSDSAWPLRGLDGKTFAERRKEKEQRK |
| Ga0315905_100047916 | 3300032092 | Freshwater | MKGEIMIRPQQAAPMGRKHRVSSDSTWPLRSSIDGKTFAERRAMREKEQSK |
| Ga0315905_100092362 | 3300032092 | Freshwater | MNIAKQAAPMGKTYRVSSDSAWPLRGLDGKTFAERRKEQDNGPSKS |
| Ga0315905_100172933 | 3300032092 | Freshwater | MINPQQAAPLGLKHRVSSESAWPLRGVDGKTFAERFAQRKRDESKWQGQ |
| Ga0315903_104189694 | 3300032116 | Freshwater | MVMIKIPPQAAPMGRNHRVSSDSAWPLRGPDGKTLAERRAEREKEQSK |
| Ga0315903_106847882 | 3300032116 | Freshwater | MIKPQQAAPMGRKYRVSSDSAWPLRGLDGKTFAERRAEREKVKIK |
| Ga0315277_110785701 | 3300032118 | Sediment | QAAPLGRTYRVSSESVWPLRGLDGKTFAERRKEREQGK |
| Ga0334981_0343153_498_647 | 3300033980 | Freshwater | MIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAEREKEQSKCLDQ |
| Ga0334994_0027971_2311_2445 | 3300033993 | Freshwater | MIKTPQQAAPTGRKYRVSSESAWPLKALDGKTWAERRKEREQGK |
| Ga0335003_0006390_2609_2746 | 3300033995 | Freshwater | MSKIPQAAPLGRKYRVSSDSAWPLRGLDGKTFAERRKEQEQGPRK |
| Ga0334979_0000312_31964_32113 | 3300033996 | Freshwater | MIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAMREKEQSKCLDQ |
| Ga0334979_0371519_2_136 | 3300033996 | Freshwater | MIKTPQQAAPLGRKYRVSSESAWPLRGLDGKTFAERHKEKEQGK |
| Ga0334986_0003038_4786_4935 | 3300034012 | Freshwater | MIKPQQAAPMGRNHRVSSDSAWPLRGLDGKTFAERRAEREKEQSKCLDQ |
| Ga0334986_0123613_1030_1179 | 3300034012 | Freshwater | MIKTQQAAPMGRKHRISSDSAWPLRGLDGKTFAERRAMREKEQSKCLDQ |
| Ga0335023_0000221_29271_29402 | 3300034050 | Freshwater | MIKPQQAAPMGKKHRVSSDSAWPLRGADGKTFAERRKEQEQSK |
| Ga0334983_0065598_84_218 | 3300034060 | Freshwater | MIKPQQAAPMGKKHRVSSDSAWPLRGVDGLTFAERRAKEQEQSK |
| Ga0334983_0538479_3_107 | 3300034060 | Freshwater | MIKPAQAAPMGKSHRVSSDSAWPLRGADGKTFAER |
| Ga0334987_0013273_1013_1135 | 3300034061 | Freshwater | MGRKHRVSSDSAWPLRGLDGKTFAERRAEREKEQSKCLDQ |
| Ga0334987_0036955_1345_1479 | 3300034061 | Freshwater | MIKTPQQAAPLGRKHRVSSDSAWPLRDLNGKTWAERRKEKEQGK |
| Ga0334987_0405319_156_290 | 3300034061 | Freshwater | MIKTPQQAAPLGRKYRVSSESAWPLRGLDGKTWAQRRKEKEQGK |
| Ga0334995_0061770_1339_1470 | 3300034062 | Freshwater | MIKPQQAAPIGRKYRVSSESAWPLRDLNGKTWAERRKEREQGK |
| Ga0335012_0165492_53_187 | 3300034093 | Freshwater | MNKIPPQAAPLKRNHRVSSDSAWPLRGLDGKTFAERRKEQEQRK |
| Ga0335027_0001413_14330_14479 | 3300034101 | Freshwater | MIKPQQAAPMGRKHRVSSDSAWPLRGPDGKTFAERRAEREKEQSKCLDQ |
| Ga0335031_0034692_1484_1624 | 3300034104 | Freshwater | MIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERKAQEQRKCQDQ |
| Ga0335036_0282421_585_734 | 3300034106 | Freshwater | MIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAEREKEQSKCQGQ |
| Ga0335036_0367867_362_499 | 3300034106 | Freshwater | MIKPAQAAPLGKTYRVSSENAWPLRGLDGKTFAERRAEREKESNK |
| Ga0335068_0052306_1460_1609 | 3300034116 | Freshwater | MIKPQQAAPMGRKYRVSSDSAWPLRGIDGKTFAERRKEQEQEQSKCQDQ |
| Ga0335058_0020787_3220_3357 | 3300034121 | Freshwater | MIKPAQAAPLGKTYRVSSESAWPLRGLDGKTFAERRAEREKESNK |
| Ga0335058_0614393_1_114 | 3300034121 | Freshwater | APLNRNHRVSSDSAWPLRGPDGKTFAERRKEQEQRKC |
| Ga0335065_0338218_552_722 | 3300034200 | Freshwater | MTQGKKTMIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAEREKEQGKCLDQ |
| Ga0335049_0666536_458_634 | 3300034272 | Freshwater | EADNYNRTVKDRHMIKPQQAAPMGRKHRVSSDSAWPLRGLDGKTFAERRAEREKEQSK |
| Ga0335048_0124266_1191_1331 | 3300034356 | Freshwater | MIKPQQAAPMGRNHRVSSDSAWPLRSSIDGKTFAERRAEREKEQSK |
| ⦗Top⦘ |