| Basic Information | |
|---|---|
| Family ID | F014442 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 263 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MMKFPSTLDEENLLTYEVSDEALETAGGKEISANFTLGSCTGLSECPA |
| Number of Associated Samples | 180 |
| Number of Associated Scaffolds | 263 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 82.69 % |
| % of genes near scaffold ends (potentially truncated) | 29.28 % |
| % of genes from short scaffolds (< 2000 bps) | 79.85 % |
| Associated GOLD sequencing projects | 166 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.034 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (14.068 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.616 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.205 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.89% β-sheet: 0.00% Coil/Unstructured: 92.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 263 Family Scaffolds |
|---|---|---|
| PF08281 | Sigma70_r4_2 | 9.51 |
| PF04392 | ABC_sub_bind | 1.52 |
| PF07045 | DUF1330 | 1.52 |
| PF12697 | Abhydrolase_6 | 1.52 |
| PF11578 | DUF3237 | 1.14 |
| PF02705 | K_trans | 1.14 |
| PF14023 | DUF4239 | 1.14 |
| PF00300 | His_Phos_1 | 1.14 |
| PF02518 | HATPase_c | 0.76 |
| PF13473 | Cupredoxin_1 | 0.76 |
| PF13406 | SLT_2 | 0.76 |
| PF00211 | Guanylate_cyc | 0.38 |
| PF07519 | Tannase | 0.38 |
| PF00589 | Phage_integrase | 0.38 |
| PF00005 | ABC_tran | 0.38 |
| PF05940 | NnrS | 0.38 |
| PF07536 | HWE_HK | 0.38 |
| PF00528 | BPD_transp_1 | 0.38 |
| PF04140 | ICMT | 0.38 |
| PF04828 | GFA | 0.38 |
| PF13505 | OMP_b-brl | 0.38 |
| PF06863 | DUF1254 | 0.38 |
| PF07311 | Dodecin | 0.38 |
| PF13365 | Trypsin_2 | 0.38 |
| PF00536 | SAM_1 | 0.38 |
| PF05050 | Methyltransf_21 | 0.38 |
| PF00697 | PRAI | 0.38 |
| PF13532 | 2OG-FeII_Oxy_2 | 0.38 |
| PF13180 | PDZ_2 | 0.38 |
| PF13545 | HTH_Crp_2 | 0.38 |
| PF03626 | COX4_pro | 0.38 |
| PF01546 | Peptidase_M20 | 0.38 |
| PF00440 | TetR_N | 0.38 |
| PF13472 | Lipase_GDSL_2 | 0.38 |
| PF00127 | Copper-bind | 0.38 |
| PF13548 | DUF4126 | 0.38 |
| PF12071 | DUF3551 | 0.38 |
| PF02627 | CMD | 0.38 |
| PF08238 | Sel1 | 0.38 |
| PF03401 | TctC | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 263 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.52 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.52 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 1.14 |
| COG0135 | Phosphoribosylanthranilate isomerase | Amino acid transport and metabolism [E] | 0.38 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.38 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.38 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.38 |
| COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 0.38 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.38 |
| COG3213 | Nitric oxide response protein NnrS | Signal transduction mechanisms [T] | 0.38 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.38 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.38 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.38 |
| COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 0.38 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.03 % |
| All Organisms | root | All Organisms | 42.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_8819483 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
| 2166559005|cont_contig101499 | Not Available | 568 | Open in IMG/M |
| 2170459013|GO6OHWN01DHRBB | Not Available | 509 | Open in IMG/M |
| 2228664022|INPgaii200_c1091949 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300000156|NODE_c0592903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1548 | Open in IMG/M |
| 3300000550|F24TB_10201674 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1000003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 19651 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10012069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 2385 | Open in IMG/M |
| 3300000689|JGI12538J11921_102180 | Not Available | 559 | Open in IMG/M |
| 3300000955|JGI1027J12803_107393416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2253 | Open in IMG/M |
| 3300000956|JGI10216J12902_118748936 | Not Available | 956 | Open in IMG/M |
| 3300001867|JGI12627J18819_10263348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300004024|Ga0055436_10069901 | Not Available | 986 | Open in IMG/M |
| 3300004479|Ga0062595_100021960 | Not Available | 2439 | Open in IMG/M |
| 3300004479|Ga0062595_100161203 | Not Available | 1324 | Open in IMG/M |
| 3300004479|Ga0062595_101332950 | Not Available | 649 | Open in IMG/M |
| 3300004633|Ga0066395_10724809 | Not Available | 592 | Open in IMG/M |
| 3300004643|Ga0062591_100064868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2174 | Open in IMG/M |
| 3300005093|Ga0062594_100027945 | Not Available | 2527 | Open in IMG/M |
| 3300005093|Ga0062594_100857979 | Not Available | 850 | Open in IMG/M |
| 3300005161|Ga0066807_1003737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1241 | Open in IMG/M |
| 3300005165|Ga0066869_10033830 | Not Available | 837 | Open in IMG/M |
| 3300005218|Ga0068996_10035200 | Not Available | 906 | Open in IMG/M |
| 3300005289|Ga0065704_10217867 | Not Available | 1085 | Open in IMG/M |
| 3300005295|Ga0065707_10724387 | Not Available | 629 | Open in IMG/M |
| 3300005328|Ga0070676_11337485 | Not Available | 548 | Open in IMG/M |
| 3300005329|Ga0070683_100867238 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005331|Ga0070670_100238017 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300005332|Ga0066388_100056686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4099 | Open in IMG/M |
| 3300005332|Ga0066388_100178085 | Not Available | 2732 | Open in IMG/M |
| 3300005332|Ga0066388_100330164 | Not Available | 2171 | Open in IMG/M |
| 3300005332|Ga0066388_100354242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2114 | Open in IMG/M |
| 3300005332|Ga0066388_100732424 | Not Available | 1591 | Open in IMG/M |
| 3300005332|Ga0066388_101572116 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300005332|Ga0066388_101992809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1040 | Open in IMG/M |
| 3300005332|Ga0066388_102416753 | Not Available | 953 | Open in IMG/M |
| 3300005332|Ga0066388_108018450 | Not Available | 528 | Open in IMG/M |
| 3300005344|Ga0070661_100395931 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300005365|Ga0070688_101048027 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005366|Ga0070659_100707543 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 871 | Open in IMG/M |
| 3300005367|Ga0070667_101820328 | Not Available | 573 | Open in IMG/M |
| 3300005434|Ga0070709_11422566 | Not Available | 562 | Open in IMG/M |
| 3300005436|Ga0070713_100077066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2834 | Open in IMG/M |
| 3300005436|Ga0070713_100198631 | Not Available | 1810 | Open in IMG/M |
| 3300005436|Ga0070713_100955399 | Not Available | 826 | Open in IMG/M |
| 3300005436|Ga0070713_101915424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 575 | Open in IMG/M |
| 3300005439|Ga0070711_101544569 | Not Available | 580 | Open in IMG/M |
| 3300005441|Ga0070700_100133669 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300005457|Ga0070662_100515127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 999 | Open in IMG/M |
| 3300005457|Ga0070662_101423985 | Not Available | 597 | Open in IMG/M |
| 3300005457|Ga0070662_101636742 | Not Available | 556 | Open in IMG/M |
| 3300005535|Ga0070684_100694369 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300005536|Ga0070697_101458887 | Not Available | 611 | Open in IMG/M |
| 3300005539|Ga0068853_102060331 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005548|Ga0070665_101576171 | Not Available | 665 | Open in IMG/M |
| 3300005564|Ga0070664_100923746 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300005618|Ga0068864_100443301 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300005618|Ga0068864_100974773 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300005713|Ga0066905_100127150 | Not Available | 1791 | Open in IMG/M |
| 3300005713|Ga0066905_100198508 | Not Available | 1497 | Open in IMG/M |
| 3300005713|Ga0066905_100324549 | Not Available | 1219 | Open in IMG/M |
| 3300005713|Ga0066905_100741853 | Not Available | 846 | Open in IMG/M |
| 3300005713|Ga0066905_100891591 | Not Available | 778 | Open in IMG/M |
| 3300005713|Ga0066905_101054664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 719 | Open in IMG/M |
| 3300005719|Ga0068861_101814847 | Not Available | 605 | Open in IMG/M |
| 3300005764|Ga0066903_102514029 | Not Available | 997 | Open in IMG/M |
| 3300005764|Ga0066903_104140413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300005764|Ga0066903_104355009 | Not Available | 756 | Open in IMG/M |
| 3300005764|Ga0066903_105462926 | Not Available | 670 | Open in IMG/M |
| 3300005764|Ga0066903_105477619 | Not Available | 669 | Open in IMG/M |
| 3300005764|Ga0066903_106248272 | Not Available | 622 | Open in IMG/M |
| 3300005764|Ga0066903_109025800 | Not Available | 505 | Open in IMG/M |
| 3300005841|Ga0068863_100453414 | Not Available | 1259 | Open in IMG/M |
| 3300005937|Ga0081455_10030513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4895 | Open in IMG/M |
| 3300006041|Ga0075023_100384353 | Not Available | 603 | Open in IMG/M |
| 3300006047|Ga0075024_100696659 | Not Available | 557 | Open in IMG/M |
| 3300006049|Ga0075417_10002256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5726 | Open in IMG/M |
| 3300006049|Ga0075417_10011800 | Not Available | 3272 | Open in IMG/M |
| 3300006057|Ga0075026_100129989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1277 | Open in IMG/M |
| 3300006172|Ga0075018_10229178 | Not Available | 892 | Open in IMG/M |
| 3300006172|Ga0075018_10679003 | Not Available | 555 | Open in IMG/M |
| 3300006173|Ga0070716_101418629 | Not Available | 565 | Open in IMG/M |
| 3300006175|Ga0070712_100544116 | Not Available | 978 | Open in IMG/M |
| 3300006175|Ga0070712_100714827 | Not Available | 855 | Open in IMG/M |
| 3300006846|Ga0075430_100995909 | Not Available | 690 | Open in IMG/M |
| 3300006854|Ga0075425_100339393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1730 | Open in IMG/M |
| 3300006854|Ga0075425_100419526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1541 | Open in IMG/M |
| 3300006854|Ga0075425_102629614 | Not Available | 556 | Open in IMG/M |
| 3300006871|Ga0075434_100799173 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300006871|Ga0075434_100975596 | Not Available | 862 | Open in IMG/M |
| 3300006903|Ga0075426_10103192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2047 | Open in IMG/M |
| 3300006903|Ga0075426_10127780 | Not Available | 1828 | Open in IMG/M |
| 3300006904|Ga0075424_101098543 | Not Available | 847 | Open in IMG/M |
| 3300009101|Ga0105247_10989502 | Not Available | 656 | Open in IMG/M |
| 3300009177|Ga0105248_10537318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1319 | Open in IMG/M |
| 3300009177|Ga0105248_10849963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1030 | Open in IMG/M |
| 3300009545|Ga0105237_10275443 | Not Available | 1685 | Open in IMG/M |
| 3300009553|Ga0105249_10879580 | Not Available | 962 | Open in IMG/M |
| 3300009553|Ga0105249_11177334 | Not Available | 837 | Open in IMG/M |
| 3300010043|Ga0126380_10767954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300010043|Ga0126380_11271313 | Not Available | 639 | Open in IMG/M |
| 3300010046|Ga0126384_10246347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1442 | Open in IMG/M |
| 3300010046|Ga0126384_11002340 | Not Available | 760 | Open in IMG/M |
| 3300010046|Ga0126384_12419664 | Not Available | 509 | Open in IMG/M |
| 3300010048|Ga0126373_11760553 | Not Available | 683 | Open in IMG/M |
| 3300010358|Ga0126370_11068610 | Not Available | 742 | Open in IMG/M |
| 3300010358|Ga0126370_12288772 | Not Available | 534 | Open in IMG/M |
| 3300010359|Ga0126376_10366012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1284 | Open in IMG/M |
| 3300010360|Ga0126372_12547275 | Not Available | 563 | Open in IMG/M |
| 3300010361|Ga0126378_10795207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1055 | Open in IMG/M |
| 3300010366|Ga0126379_10091357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2676 | Open in IMG/M |
| 3300010397|Ga0134124_11349137 | Not Available | 737 | Open in IMG/M |
| 3300010398|Ga0126383_10022139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4893 | Open in IMG/M |
| 3300010398|Ga0126383_10125098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2351 | Open in IMG/M |
| 3300010398|Ga0126383_10681684 | Not Available | 1105 | Open in IMG/M |
| 3300010400|Ga0134122_10684241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 961 | Open in IMG/M |
| 3300011000|Ga0138513_100023281 | Not Available | 866 | Open in IMG/M |
| 3300011119|Ga0105246_11903739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 571 | Open in IMG/M |
| 3300012198|Ga0137364_11406414 | Not Available | 516 | Open in IMG/M |
| 3300012501|Ga0157351_1029850 | Not Available | 629 | Open in IMG/M |
| 3300012517|Ga0157354_1019808 | Not Available | 771 | Open in IMG/M |
| 3300012519|Ga0157352_1043217 | Not Available | 645 | Open in IMG/M |
| 3300012957|Ga0164303_10025540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 2349 | Open in IMG/M |
| 3300012960|Ga0164301_10280049 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300012960|Ga0164301_10572230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129 | 829 | Open in IMG/M |
| 3300012961|Ga0164302_10073710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phreatobacteraceae → Phreatobacter | 1792 | Open in IMG/M |
| 3300012971|Ga0126369_10622907 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300012971|Ga0126369_13204404 | Not Available | 536 | Open in IMG/M |
| 3300012971|Ga0126369_13490871 | Not Available | 515 | Open in IMG/M |
| 3300012984|Ga0164309_11190513 | Not Available | 639 | Open in IMG/M |
| 3300012985|Ga0164308_10736530 | Not Available | 853 | Open in IMG/M |
| 3300012985|Ga0164308_11628540 | Not Available | 597 | Open in IMG/M |
| 3300012986|Ga0164304_10101457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1716 | Open in IMG/M |
| 3300012986|Ga0164304_10127061 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae → Pseudobythopirellula → Pseudobythopirellula maris | 1568 | Open in IMG/M |
| 3300012987|Ga0164307_10057962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011 | 2257 | Open in IMG/M |
| 3300012987|Ga0164307_11446498 | Not Available | 580 | Open in IMG/M |
| 3300012989|Ga0164305_11676820 | Not Available | 570 | Open in IMG/M |
| 3300013296|Ga0157374_12436424 | Not Available | 551 | Open in IMG/M |
| 3300013306|Ga0163162_12676754 | Not Available | 574 | Open in IMG/M |
| 3300013308|Ga0157375_12295856 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300014745|Ga0157377_11227886 | Not Available | 582 | Open in IMG/M |
| 3300014968|Ga0157379_10224091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1704 | Open in IMG/M |
| 3300014968|Ga0157379_10342185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011 | 1368 | Open in IMG/M |
| 3300015371|Ga0132258_10304901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3918 | Open in IMG/M |
| 3300015371|Ga0132258_10415259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3346 | Open in IMG/M |
| 3300015371|Ga0132258_10688578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 2573 | Open in IMG/M |
| 3300015371|Ga0132258_10737098 | Not Available | 2482 | Open in IMG/M |
| 3300015371|Ga0132258_10982536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2133 | Open in IMG/M |
| 3300015371|Ga0132258_11126966 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
| 3300015371|Ga0132258_11586012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phreatobacteraceae → Phreatobacter | 1652 | Open in IMG/M |
| 3300015371|Ga0132258_12457628 | Not Available | 1304 | Open in IMG/M |
| 3300015371|Ga0132258_13942101 | Not Available | 1008 | Open in IMG/M |
| 3300015372|Ga0132256_100134248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2461 | Open in IMG/M |
| 3300015372|Ga0132256_100712042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1120 | Open in IMG/M |
| 3300015372|Ga0132256_103666624 | Not Available | 516 | Open in IMG/M |
| 3300015374|Ga0132255_100103538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3872 | Open in IMG/M |
| 3300015374|Ga0132255_103797246 | Not Available | 642 | Open in IMG/M |
| 3300016357|Ga0182032_10000532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 15573 | Open in IMG/M |
| 3300017947|Ga0187785_10360245 | Not Available | 687 | Open in IMG/M |
| 3300017997|Ga0184610_1193138 | Not Available | 679 | Open in IMG/M |
| 3300018029|Ga0187787_10157392 | Not Available | 775 | Open in IMG/M |
| 3300018032|Ga0187788_10190231 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300018058|Ga0187766_11213140 | Not Available | 546 | Open in IMG/M |
| 3300018060|Ga0187765_10052644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2100 | Open in IMG/M |
| 3300018060|Ga0187765_10388948 | Not Available | 859 | Open in IMG/M |
| 3300018067|Ga0184611_1152226 | Not Available | 819 | Open in IMG/M |
| 3300018072|Ga0184635_10080438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1278 | Open in IMG/M |
| 3300018073|Ga0184624_10470007 | Not Available | 550 | Open in IMG/M |
| 3300018081|Ga0184625_10623789 | Not Available | 526 | Open in IMG/M |
| 3300019869|Ga0193705_1077599 | Not Available | 645 | Open in IMG/M |
| 3300020002|Ga0193730_1124615 | Not Available | 703 | Open in IMG/M |
| 3300021078|Ga0210381_10176352 | Not Available | 737 | Open in IMG/M |
| 3300021560|Ga0126371_10004385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 12456 | Open in IMG/M |
| 3300021560|Ga0126371_10391143 | Not Available | 1531 | Open in IMG/M |
| 3300021560|Ga0126371_10729222 | Not Available | 1139 | Open in IMG/M |
| 3300022756|Ga0222622_10956160 | Not Available | 629 | Open in IMG/M |
| 3300025900|Ga0207710_10284508 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300025900|Ga0207710_10527340 | Not Available | 614 | Open in IMG/M |
| 3300025905|Ga0207685_10161851 | Not Available | 1022 | Open in IMG/M |
| 3300025905|Ga0207685_10166017 | Not Available | 1012 | Open in IMG/M |
| 3300025915|Ga0207693_10080676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2547 | Open in IMG/M |
| 3300025915|Ga0207693_10188878 | Not Available | 1622 | Open in IMG/M |
| 3300025916|Ga0207663_10539190 | Not Available | 911 | Open in IMG/M |
| 3300025916|Ga0207663_11032028 | Not Available | 660 | Open in IMG/M |
| 3300025927|Ga0207687_10265721 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300025928|Ga0207700_11298266 | Not Available | 648 | Open in IMG/M |
| 3300025933|Ga0207706_11110079 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300025944|Ga0207661_10537392 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300025961|Ga0207712_11359633 | Not Available | 635 | Open in IMG/M |
| 3300025973|Ga0210145_1012968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300025985|Ga0210117_1023648 | Not Available | 914 | Open in IMG/M |
| 3300025986|Ga0207658_10658972 | Not Available | 944 | Open in IMG/M |
| 3300026035|Ga0207703_10612814 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300026075|Ga0207708_10348726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1214 | Open in IMG/M |
| 3300026121|Ga0207683_10016115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6361 | Open in IMG/M |
| 3300026121|Ga0207683_10217006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 1742 | Open in IMG/M |
| 3300026452|Ga0256821_1006819 | Not Available | 1086 | Open in IMG/M |
| 3300026464|Ga0256814_1049022 | Not Available | 537 | Open in IMG/M |
| 3300026692|Ga0207725_100530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1697 | Open in IMG/M |
| 3300026809|Ga0207820_100667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3919 | Open in IMG/M |
| 3300026819|Ga0207765_100494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5227 | Open in IMG/M |
| 3300026839|Ga0207764_104048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1519 | Open in IMG/M |
| 3300026839|Ga0207764_125836 | Not Available | 512 | Open in IMG/M |
| 3300026858|Ga0207729_102276 | Not Available | 1124 | Open in IMG/M |
| 3300026887|Ga0207805_1000131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10617 | Open in IMG/M |
| 3300026889|Ga0207745_1001011 | All Organisms → cellular organisms → Bacteria | 3927 | Open in IMG/M |
| 3300026941|Ga0207741_1001851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2759 | Open in IMG/M |
| 3300026953|Ga0207835_1000912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3660 | Open in IMG/M |
| 3300026995|Ga0208761_1009156 | Not Available | 825 | Open in IMG/M |
| 3300027011|Ga0207740_1002071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3393 | Open in IMG/M |
| 3300027326|Ga0209731_1015794 | Not Available | 1021 | Open in IMG/M |
| 3300027560|Ga0207981_1008706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1801 | Open in IMG/M |
| 3300027873|Ga0209814_10006480 | All Organisms → cellular organisms → Bacteria | 4507 | Open in IMG/M |
| 3300027873|Ga0209814_10093515 | Not Available | 1273 | Open in IMG/M |
| 3300028784|Ga0307282_10247342 | Not Available | 856 | Open in IMG/M |
| 3300028807|Ga0307305_10034133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2331 | Open in IMG/M |
| 3300028811|Ga0307292_10198650 | Not Available | 823 | Open in IMG/M |
| 3300028814|Ga0307302_10429321 | Not Available | 654 | Open in IMG/M |
| 3300028824|Ga0307310_10044030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1843 | Open in IMG/M |
| 3300030916|Ga0075386_11968801 | Not Available | 1011 | Open in IMG/M |
| 3300031170|Ga0307498_10001356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3617 | Open in IMG/M |
| 3300031170|Ga0307498_10146256 | Not Available | 779 | Open in IMG/M |
| 3300031231|Ga0170824_105510976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2336 | Open in IMG/M |
| 3300031231|Ga0170824_125715959 | Not Available | 1822 | Open in IMG/M |
| 3300031231|Ga0170824_127072872 | Not Available | 1942 | Open in IMG/M |
| 3300031446|Ga0170820_13984618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 876 | Open in IMG/M |
| 3300031469|Ga0170819_15366522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1167 | Open in IMG/M |
| 3300031543|Ga0318516_10565085 | Not Available | 651 | Open in IMG/M |
| 3300031544|Ga0318534_10050618 | Not Available | 2324 | Open in IMG/M |
| 3300031544|Ga0318534_10600976 | Not Available | 625 | Open in IMG/M |
| 3300031545|Ga0318541_10008785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4452 | Open in IMG/M |
| 3300031562|Ga0310886_10135801 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300031573|Ga0310915_10082232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2144 | Open in IMG/M |
| 3300031720|Ga0307469_10017130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3812 | Open in IMG/M |
| 3300031720|Ga0307469_10243638 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300031724|Ga0318500_10640091 | Not Available | 540 | Open in IMG/M |
| 3300031740|Ga0307468_100519992 | Not Available | 949 | Open in IMG/M |
| 3300031740|Ga0307468_101166890 | Not Available | 692 | Open in IMG/M |
| 3300031744|Ga0306918_10717710 | Not Available | 782 | Open in IMG/M |
| 3300031744|Ga0306918_11527075 | Not Available | 510 | Open in IMG/M |
| 3300031768|Ga0318509_10363564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
| 3300031771|Ga0318546_10742532 | Not Available | 691 | Open in IMG/M |
| 3300031781|Ga0318547_10574197 | Not Available | 699 | Open in IMG/M |
| 3300031847|Ga0310907_10560181 | Not Available | 618 | Open in IMG/M |
| 3300031858|Ga0310892_10504270 | Not Available | 806 | Open in IMG/M |
| 3300031879|Ga0306919_10025936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3627 | Open in IMG/M |
| 3300031879|Ga0306919_10606824 | Not Available | 844 | Open in IMG/M |
| 3300031908|Ga0310900_10238078 | Not Available | 1303 | Open in IMG/M |
| 3300031910|Ga0306923_11135600 | Not Available | 839 | Open in IMG/M |
| 3300031954|Ga0306926_10624740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1313 | Open in IMG/M |
| 3300032000|Ga0310903_10050997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1589 | Open in IMG/M |
| 3300032012|Ga0310902_10237541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
| 3300032044|Ga0318558_10509814 | Not Available | 600 | Open in IMG/M |
| 3300032075|Ga0310890_10753178 | Not Available | 767 | Open in IMG/M |
| 3300032174|Ga0307470_11256997 | Not Available | 604 | Open in IMG/M |
| 3300032180|Ga0307471_100127648 | All Organisms → cellular organisms → Bacteria | 2388 | Open in IMG/M |
| 3300032180|Ga0307471_102583072 | Not Available | 643 | Open in IMG/M |
| 3300033289|Ga0310914_11376297 | Not Available | 608 | Open in IMG/M |
| 3300033412|Ga0310810_10194819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2298 | Open in IMG/M |
| 3300034817|Ga0373948_0026045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1151 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 14.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.18% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.04% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.28% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.28% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.90% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.14% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.14% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.14% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.38% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.38% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.38% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.38% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.38% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.38% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.38% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000689 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 76 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025973 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026452 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4 | Environmental | Open in IMG/M |
| 3300026464 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS5 | Environmental | Open in IMG/M |
| 3300026692 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 38 (SPAdes) | Environmental | Open in IMG/M |
| 3300026809 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes) | Environmental | Open in IMG/M |
| 3300026819 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 (SPAdes) | Environmental | Open in IMG/M |
| 3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
| 3300026858 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026887 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes) | Environmental | Open in IMG/M |
| 3300026889 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 57 (SPAdes) | Environmental | Open in IMG/M |
| 3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
| 3300026953 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 8 (SPAdes) | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_02102160 | 2088090015 | Soil | MIKFPSLDEEPLFTYEVSDEVLETAAGKEIAANFTLGSCTGLAECPA |
| cont_0498.00005970 | 2166559005 | Simulated | MMKFPSALDEENLLAYEVSDETLETAGGKEIAANFTLGSCTGLSECPA |
| N57_07219670 | 2170459013 | Grass Soil | MMKFPSALDEENLLAYDVSDETLETAGGKEIATNFTLGSCTGLSECPA |
| INPgaii200_10919491 | 2228664022 | Soil | MMKSFDDESLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPA |
| NODE_05929035 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MMKFPGNLDEENLLVYEVSDEALETVGGKEIAVMFTLGSCTGLSECPA* |
| F24TB_102016743 | 3300000550 | Soil | MIKFPSLDEAPLFTYEVSDEVLETAAGKEIAANFTLGSCTGLAECPA* |
| AF_2010_repII_A01DRAFT_100000327 | 3300000580 | Forest Soil | MTKLSSNFDDEWFLNYEISDESLETAEGKEIAANFTLGSCTGLSECPA* |
| AF_2010_repII_A1DRAFT_100120692 | 3300000597 | Forest Soil | MMKLSSNFDDEWFFNCEVSDEALETAEGKEIAANFTLGSCTGLSECPA* |
| JGI12538J11921_1021802 | 3300000689 | Tropical Forest Soil | QSTLNEEDDLLTLDISDEALETVGGNEVVGNFTLGACTGLSVCPA* |
| JGI1027J12803_1073934161 | 3300000955 | Soil | MMKFPSKVEEEYLLTYEVSDEALEIAGEKEKIVANFTLGSCTGLSECPA* |
| JGI10216J12902_1187489362 | 3300000956 | Soil | MMKFPSTLDDESLLTYEVSDEALETAGGKEIAVNFTLGSCTGLSECPA* |
| JGI12627J18819_102633481 | 3300001867 | Forest Soil | MMXFPSTLDTENLLTYEVPDEALETAGGKEIAVNFTLGSCTGLSECPA* |
| Ga0055436_100699011 | 3300004024 | Natural And Restored Wetlands | MMKFPSTLDEQNLLAYEVPDAALETAAGKEMAANFTLGSCTGLSECPA* |
| Ga0062595_1000219601 | 3300004479 | Soil | MLKLCSNFDDERFLNSEVSDEALETAGGKKIAANFTLGSCTGLSECPA* |
| Ga0062595_1001612032 | 3300004479 | Soil | MMKFPSTLGEENLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPG* |
| Ga0062595_1013329501 | 3300004479 | Soil | MMKFPSTLDEENLFTYEVSDEILETAGAKEKEIAANFTLGSCTGLSECPG* |
| Ga0066395_107248091 | 3300004633 | Tropical Forest Soil | MTMFPSTFDEENLLTYEVSDEALETLGEKEIAAIFTLGSCTGLSECPA* |
| Ga0062591_1000648682 | 3300004643 | Soil | MKFPSTLDEERPLTYEVSDEALETAGANEIAGNYTLASCTGLSVCPA* |
| Ga0062594_1000279454 | 3300005093 | Soil | MIKFPSALDEENLLACEVSDETLETAGGKQIAANFTLGSCTGLSECPA* |
| Ga0062594_1008579792 | 3300005093 | Soil | MMKFPSTLEEEYLLTREVSDEALETAGGKEIAAVFTLGSCTGLSECPA* |
| Ga0066807_10037371 | 3300005161 | Soil | MMKFPSALDEENLLAYEVSDEILETAGGKEITALFTLGSCTGLSECPA* |
| Ga0066869_100338301 | 3300005165 | Soil | MTKFPNTLDEENLRTHEVSDEVLETAGGKGIAAIFTLGSCTGLSECPA* |
| Ga0068996_100352001 | 3300005218 | Natural And Restored Wetlands | MKFLSTLDEENILTYEASDEALETAGGKEIAANFTLGSCTGLSECPA* |
| Ga0065704_102178671 | 3300005289 | Switchgrass Rhizosphere | MMTFPSTIEEENLLMYDVSDEALETAGEKEIVANFTLGSCTGLSECPA* |
| Ga0065707_107243871 | 3300005295 | Switchgrass Rhizosphere | FDDERFLNSEVSDEALETAGGKKIAANFTLGSCTGLSECPA* |
| Ga0070676_113374852 | 3300005328 | Miscanthus Rhizosphere | RRSNMMTFPSTIEEENLLMYDVSDEALETAGEKEIVANFTLGSCTGLSVCPA* |
| Ga0070683_1008672382 | 3300005329 | Corn Rhizosphere | HRRITMMKFPSTLDEENLLTYEVSDEVLETAGAKEKQIAANFTLGSCTGLSECPG* |
| Ga0070670_1002380174 | 3300005331 | Switchgrass Rhizosphere | MTTFPSTFDDESLLTYEVSDEALETAGEKEIVANFTLGSCTGLSVCPA* |
| Ga0066388_1000566861 | 3300005332 | Tropical Forest Soil | MMKFPSKVEEEYLPTYEISDDALETAGGREIGANFTLGSCTGLSECPA* |
| Ga0066388_1001780855 | 3300005332 | Tropical Forest Soil | MMKFPSTLEEENLLTYEVSDEALETAGGKEIAGNYTLASCTGLTVCPS* |
| Ga0066388_1003301642 | 3300005332 | Tropical Forest Soil | MMKFPSTFDDESLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPA* |
| Ga0066388_1003542424 | 3300005332 | Tropical Forest Soil | MMKFPSTLEEENLLTYEVSDEALETAGGKEMTANFTLGSCTGLSECPG* |
| Ga0066388_1007324243 | 3300005332 | Tropical Forest Soil | MMKFPSKAEEEYLSTYEISDDALETAGGREIAANFTLGSCTGLSECPA* |
| Ga0066388_1015189252 | 3300005332 | Tropical Forest Soil | MTDLTDQIEEGLLTYEVSDEALEIVADTTKGNANFTLGACTGLSDCPG* |
| Ga0066388_1015721162 | 3300005332 | Tropical Forest Soil | MMMFPSTLDEENLLTYEASDEALETAGGKEITANFTLGSCTGLS |
| Ga0066388_1019928092 | 3300005332 | Tropical Forest Soil | MTKFPSTLDEENLLTYEVSDEALETAGGNEIAGNYTLAACTGLTVCPS* |
| Ga0066388_1024167531 | 3300005332 | Tropical Forest Soil | DEENLLTYEVSDEALETAGGNEIAGNYTLVACTGLTVCPS* |
| Ga0066388_1080184501 | 3300005332 | Tropical Forest Soil | MMKFPSTLDEENLLTYEVSDEALEIAGGKEMVANFTLGSCTGLSECPG* |
| Ga0070661_1003959312 | 3300005344 | Corn Rhizosphere | MMKFPSTLDEENLFTYEASDEILETAGAKEKEIAANFTLGSCTGLSECPG* |
| Ga0070688_1010480271 | 3300005365 | Switchgrass Rhizosphere | RRITMMKFPSTLDEENLFTYEASDEILETAGAKEKEIAANFTLGSCTGLSECPG* |
| Ga0070659_1007075432 | 3300005366 | Corn Rhizosphere | MVKFPSTLEEEHLLTCEVSDEALETAGGKEIAAIFTLGSCTGLSECPA* |
| Ga0070667_1018203282 | 3300005367 | Switchgrass Rhizosphere | MMKFPSTLEEEYLLTREVSDEALETAGAKEIAATFTLGSCTGLSECPA* |
| Ga0070709_114225661 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKFPSTFNDESLLTYQVSDEALETAGGKEIAVNFTLGSCTGLS |
| Ga0070713_1000770662 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKFPSTLNEENLLTCEVSDEALETAGGKEIAANFTLGSCTGLSECPG* |
| Ga0070713_1001986311 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKFPSALDEENLLACEVSDETLETAGGKQIAANFTLGSCTGLS |
| Ga0070713_1009553991 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTFPSTIEEENLLMYDVSDEALETAGEKEIVANFTLGSCTGLSVCPA* |
| Ga0070713_1019154242 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKFPSTFNDESLLTYQVSDEALETAGGKEIAVNFTLGSCTGLSVCPAINWDC |
| Ga0070711_1015445692 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFPSTLDEENLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPG* |
| Ga0070700_1001336694 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKFPSTLEEEYLLTREVSDEALETAGGKEIAAMFTLGSCTGLSECPA* |
| Ga0070662_1005151271 | 3300005457 | Corn Rhizosphere | MMTFPSTIEEENLLMYDVSDEALETAGEKEIVANFTLGSCTGLS |
| Ga0070662_1014239851 | 3300005457 | Corn Rhizosphere | MLKLCSNFDDERFLNSEVSDEALETAGGKKIAANFTLGSC |
| Ga0070662_1016367422 | 3300005457 | Corn Rhizosphere | MNFPSTLEEEYLLTREVSDEALETAGGKEIAAVFTLGSCTGLSECPA* |
| Ga0070684_1006943691 | 3300005535 | Corn Rhizosphere | MMKFPSTLDEENLLTYEVSDEVLETAGAKEKQIAANFTLGSCTGLSECPG* |
| Ga0070697_1014588872 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKFPSTLDEERPLTYEVSDEALETAGGNEIVGSYTLASCTGLSVCPG* |
| Ga0068853_1020603312 | 3300005539 | Corn Rhizosphere | MMKFPSTLDDENLLTYEVSDEVLETAGAKEKQIAANFTLGSCTGLSECPG* |
| Ga0070665_1015761712 | 3300005548 | Switchgrass Rhizosphere | MKFPSTLEEEYLLTREVSDEALETAGGKEIAAMFTLGSCTGLSECPA* |
| Ga0070664_1009237462 | 3300005564 | Corn Rhizosphere | MTKFPSTLDEENLFTYEVSDEILETAGAKEKEIAENFTLGSCTGLSECPG* |
| Ga0068864_1004433014 | 3300005618 | Switchgrass Rhizosphere | MMKFPSTLEEEYLLTCEVSDEALETAGAKEIAAMFTLGSCTGLSECPA* |
| Ga0068864_1009747731 | 3300005618 | Switchgrass Rhizosphere | RFHHRRITMTKFPSTLDEENLFTYEASDEILETAGAKEKEIAANFTLGSCTGLSECPG* |
| Ga0066905_1001271502 | 3300005713 | Tropical Forest Soil | MMKFPSPFDDESLLAYEVSDEVLETAAGKEIAANFTLGSCTGLAECPA* |
| Ga0066905_1001985081 | 3300005713 | Tropical Forest Soil | MMKFLSTPDEENLLTYEVSDEALETAGGDEIAGNYTLAACTG |
| Ga0066905_1003245492 | 3300005713 | Tropical Forest Soil | MKKLSSNFDDEWFLNYEVSDEALETAEGKEIAAIFTLGSCTGLSEFPA* |
| Ga0066905_1007418531 | 3300005713 | Tropical Forest Soil | MTKLSSNFDDEWFLNYEISDESLETAEGKEIAANFTLGSCT |
| Ga0066905_1008915913 | 3300005713 | Tropical Forest Soil | MMKFPSTLDEENLLTYEVSDEALETAEEKEIPANFTLGSCTGLSECPG* |
| Ga0066905_1010546643 | 3300005713 | Tropical Forest Soil | MMKFPSTFDDESLLTYEVSDKALETAGEKEIAVNFTLGSCTGLSECPA* |
| Ga0068861_1018148471 | 3300005719 | Switchgrass Rhizosphere | MMTFPSTLEEENLLMYDVSDETLETVGEKEIVANFTLGSCTGLSECPA* |
| Ga0066903_1025140292 | 3300005764 | Tropical Forest Soil | MTKLSSNFDDEWFLNCEISDEALETAEGKEIAANFTLGSCTGLSECPA* |
| Ga0066903_1041404132 | 3300005764 | Tropical Forest Soil | MMKLSNNFDDEWFFNCEVSDEALETAEGKEIAANFTLGSCTGLSECPA* |
| Ga0066903_1043550092 | 3300005764 | Tropical Forest Soil | MMKFPSTLGEEDLLTYEVTDEALETAGGKEIAANFTLGSCTGLSECPA* |
| Ga0066903_1054629262 | 3300005764 | Tropical Forest Soil | MMKFPSTFDDESLLTYEVSDKALETAGGKEIAVNFTLGSCTGLSECPA* |
| Ga0066903_1054776192 | 3300005764 | Tropical Forest Soil | MMKFPSTFDDESLLTYEVSDKALETAGGKEIVVNFTLGSCSGLSECPA* |
| Ga0066903_1062482722 | 3300005764 | Tropical Forest Soil | MMKFPSTFDDENLLAREVPDEVLETAGGKEIAAIFTLGSCTGLSECPA* |
| Ga0066903_1090258001 | 3300005764 | Tropical Forest Soil | MMNFPSTLDEESLLLTCEVSDEALETAGGKEMTASFTLGSCTGLSVCPG* |
| Ga0068863_1004534143 | 3300005841 | Switchgrass Rhizosphere | MMKFPNALEEENLLTHEVSDEVLETAAGKEIAAIFTLGSCTGLSECPARP* |
| Ga0081455_100305133 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MMKFPSLDEENLLTYEVSDEVLETAAGKEIAANFTLGSCTGLAECPA* |
| Ga0075023_1003843531 | 3300006041 | Watersheds | MMKFPSTLEEEYLLTCEVSDEALETAGGKEIAVTFTLGSCTGLSECPA* |
| Ga0075024_1006966592 | 3300006047 | Watersheds | MMKFPSAFDDQSLLTYEVSDETLETTGGKEIAANFT |
| Ga0075417_100022562 | 3300006049 | Populus Rhizosphere | MMKFPSTLEEENLLMYDVSDEALETAGGKEIVANFTLGSCTGLSACPA* |
| Ga0075417_100118002 | 3300006049 | Populus Rhizosphere | MIKFPSLDEEPLFTYEVSDEVLETAAGKEIAANFTLGSCTGLAECPA* |
| Ga0075026_1001299891 | 3300006057 | Watersheds | MTKFPNALDEENLLTHEVSDEVLETAGGKGVVAIFTLGSCTGLSECPA* |
| Ga0075018_102291782 | 3300006172 | Watersheds | MIKFPGTFYEENLLTYEVSDEALETAGGTEIAANFTLGSCTGLSECPG* |
| Ga0075018_106790031 | 3300006172 | Watersheds | MMKFPSTLDEENLLTYEVSDEALEIAGGQEIAANFTLGSCTGLSECPG* |
| Ga0070716_1014186291 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ENLLTYEVSDEALETAGGKEISVNFTLGSCTGLSECPA* |
| Ga0070712_1005441162 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKFPSTLEEKYLLTCEVSDEALETAGGKEIAVIFTLGSCTGLSECPA* |
| Ga0070712_1007148271 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VFNRRRSNMMKFPNALEEENFLTHEVSDEVLETAAGKEIAAIFTLGSCTGLSECPARP* |
| Ga0075430_1009959091 | 3300006846 | Populus Rhizosphere | MMKFPNTFDDESLLTYEVSDETLETAAGKEIAANFTLGSCTGLAECPA* |
| Ga0075425_1003393932 | 3300006854 | Populus Rhizosphere | MMKFPSTLDEERPLTYEVSDEALETAGANEIAGNYTLASCTGLSVCPA* |
| Ga0075425_1004195261 | 3300006854 | Populus Rhizosphere | STIEEENLLMYDVSDEALETAGEKEIVANFTLGSCTGLSVCPA* |
| Ga0075425_1026296141 | 3300006854 | Populus Rhizosphere | MRKLSSNFDDEWFLNYEVSDEALETAEGKEIAANFTLGSCTGLSECPA* |
| Ga0075434_1007991732 | 3300006871 | Populus Rhizosphere | MMKFPSTLEEEYLLTCEVSDEALEIAGAKEIAAMFTLGSCTGLSECPA* |
| Ga0075434_1009755961 | 3300006871 | Populus Rhizosphere | MMKFPGSSDDEHLLTYEVSDEVLETAGGKEIAAMFTLGSCTGLSECPA* |
| Ga0075426_101031922 | 3300006903 | Populus Rhizosphere | MKFPSTLDEERRLTYEVSDEALETAGANEIAGNYTLASCTGLSVCPA* |
| Ga0075426_101277803 | 3300006903 | Populus Rhizosphere | MMTFPSTIEEENLLMYDVSDEALETAGEKEIVANFTLGSCTGLSACPA* |
| Ga0075424_1010985432 | 3300006904 | Populus Rhizosphere | MMKFPSTLDDESLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPA* |
| Ga0105247_109895022 | 3300009101 | Switchgrass Rhizosphere | MMKFPNALEEENFLTHEVSDEVLESAAGKEITAIFTLGSCTGLSECPA* |
| Ga0105248_105373183 | 3300009177 | Switchgrass Rhizosphere | MMKFPSTLEEEYLLTREVSDEALETAGGKEIAAMFTLGSCTGLSECP |
| Ga0105248_108499631 | 3300009177 | Switchgrass Rhizosphere | MMKFPSTLDEENLLTYEVSDEVLETAGAKEKEIAANFTLGSCTGLSECPG* |
| Ga0105237_102754433 | 3300009545 | Corn Rhizosphere | MKTFPSTIEEENLLMYDVSDEALETAGEKEIVANFTLGSCTGLSVCPA* |
| Ga0105249_108795801 | 3300009553 | Switchgrass Rhizosphere | MTTFPSTFDDESLLTYEVSDEALETAGEKEIVANFTLGSCTGLSECPA* |
| Ga0105249_111773342 | 3300009553 | Switchgrass Rhizosphere | MKFPSTLEEEYLLTREVSDEALETAGGKEIAAVFTLGSCTGLSECPA* |
| Ga0126380_107679542 | 3300010043 | Tropical Forest Soil | MKKFPSTFDDESLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPA* |
| Ga0126380_112713131 | 3300010043 | Tropical Forest Soil | MMKFLSTPDEENLLTYEVSDEALETAGGDEIAGNYTLAACTGL |
| Ga0126384_102463471 | 3300010046 | Tropical Forest Soil | MKAFPSTLDEENLLNCEVSDETLETAGGKEISANFTLGSCTGLSECPA |
| Ga0126384_110023401 | 3300010046 | Tropical Forest Soil | NMMKFPSKVEEEYLPTYEISDDALETAGGREIAANFTLGSCTGLSECPA* |
| Ga0126384_124196641 | 3300010046 | Tropical Forest Soil | MMKFPSTFDDERVLTHEISDEVLETAGGKEIVANFTLGSCTGLSECPA* |
| Ga0126373_117605531 | 3300010048 | Tropical Forest Soil | MMKFPSTFDDENLLAREISDEVLETAGGKEIAAIFTLGSCTGLSECPA* |
| Ga0126370_105059571 | 3300010358 | Tropical Forest Soil | MTDLTDQIEEGLLTYEVSDEALEIVADTTKGNANFTLGACTGLSECPG* |
| Ga0126370_110686101 | 3300010358 | Tropical Forest Soil | SNFDDEWFLNYEISDESLETAEGKEIAANFTLGSCTGLSECPA* |
| Ga0126370_122887721 | 3300010358 | Tropical Forest Soil | TFDDESLLTYEVSDKALETAGEKEIAVNFTLGSCTGLSECPA* |
| Ga0126376_103660123 | 3300010359 | Tropical Forest Soil | MMKFPSTFDDESLLTYVVSDEALETAGGKEIAANFTLGSCTGLSECPA* |
| Ga0126372_125472751 | 3300010360 | Tropical Forest Soil | MMKFPSTLGEEDLLTYEVTDEALETAGGKEIAALFTLGSCTGLSECPA* |
| Ga0126378_107952072 | 3300010361 | Tropical Forest Soil | MTKLSSNFDDEWFLNYEISDESLETAEVKEIAANFTLGSCTGLSECPA* |
| Ga0126379_100913575 | 3300010366 | Tropical Forest Soil | MMKFPGTLEEKNLLTYEVSDEALETAGGKEMTANFTLGSCTGLSECPG* |
| Ga0134124_113491371 | 3300010397 | Terrestrial Soil | MIKFPSALDEENLLACEVSDETLETAGGKQIAANF |
| Ga0126383_100221394 | 3300010398 | Tropical Forest Soil | MKAFPSTLDEENLLNCEVSDETLETAGGKEISANFTLGSCTGLSECPA* |
| Ga0126383_101250983 | 3300010398 | Tropical Forest Soil | MKFPSKVEEEYLPTYEISDDALETAGGREIGANFTLGSCTGLSECPA* |
| Ga0126383_106816844 | 3300010398 | Tropical Forest Soil | NMMKFPSTFDDESLLTYEVSDKALETAGEKEIAVNFTLGSCTGLSECPA* |
| Ga0134122_106842411 | 3300010400 | Terrestrial Soil | MMTFPSTLEEENLLMYDVSDEALETAGEKEIVANFTLGSCTGLSECPA* |
| Ga0138513_1000232812 | 3300011000 | Soil | SNMMKFLSTLDQESLLTYEVSDEALETAAGKDRAANFTLGSCTGLAECPA* |
| Ga0105246_119037392 | 3300011119 | Miscanthus Rhizosphere | MKKLSSNFDDEWLLNYEVSDEALETAGEKEIVANF |
| Ga0137364_114064141 | 3300012198 | Vadose Zone Soil | MMKFPSTSNEESLLTHEVSDEALETAAGNEIAANFTLGSCTGLSECPG* |
| Ga0157351_10298501 | 3300012501 | Unplanted Soil | FPSTVDEENLLTYEVSDEALETAGGKKMAAHFTLGSCTGLSVCPG* |
| Ga0157354_10198081 | 3300012517 | Unplanted Soil | MMKFPSTLEEEYLLTREVSDEALETAGGKEIAAMFTLGSRTGLSECPA* |
| Ga0157352_10432172 | 3300012519 | Unplanted Soil | MMKFPSTLEEEYLLTREVSEEALETAGGKEIAAMFTLGSCTGLSECPA* |
| Ga0164303_100255404 | 3300012957 | Soil | PSTLDQENPLAYEVSDEALETAGGNEIVGSYTLASCTGLSVCPG* |
| Ga0164301_102800492 | 3300012960 | Soil | MMTFPSTFDDESLLTYEVSDEALETAGEKEIVANFTLGSCTGLSECPA* |
| Ga0164301_105722303 | 3300012960 | Soil | MMKFPSTLDEENLLTYEVSDEALETAGGKEIAANFTLGS |
| Ga0164302_100737103 | 3300012961 | Soil | MMKFPSTLDQENPLAYEVSDEALETAGGNEIVGSYTLASCTGLSVCPG* |
| Ga0126369_106229071 | 3300012971 | Tropical Forest Soil | MKFPSTLGEEDLLTYEVTDEALETAGGKEIAANFTLGSCTGLSECPA* |
| Ga0126369_132044042 | 3300012971 | Tropical Forest Soil | FDDEWFLNYEISDESLETAEGKEIAANFTLGSCTGLSECPA* |
| Ga0126369_134908712 | 3300012971 | Tropical Forest Soil | MKKLSNNFDDEWFLNYEVSDEALETAEGKEIAANFTLGSCTGLSECPA* |
| Ga0164309_111905131 | 3300012984 | Soil | MMKFPSTLDQENPLAYEVSDEALETAGGNEIVGSYTLASCTGLSV |
| Ga0164308_107365302 | 3300012985 | Soil | MLKLCSNFDDERFLNSEVSDEALETAGGKEIAANFTLGSCTGLSECPA* |
| Ga0164308_116285401 | 3300012985 | Soil | KFPSTLEQEYLLTCEVSDEALEIAGAKEIAAMFTLGSCTGLSECPG* |
| Ga0164304_101014573 | 3300012986 | Soil | MMTFPSTLEEENLLMYDLSDEALETAGEKEIVANFTLGSCTGLSECPA* |
| Ga0164304_101270614 | 3300012986 | Soil | MLKLCSNFDDERFLNSEVSDEALETAGGKEISVNFTLGSCTGLSECPA* |
| Ga0164307_100579622 | 3300012987 | Soil | MMTFPSTIEEENLLMYDLSDEALETAGEKEIVANFTLGSCTGLSECPA* |
| Ga0164307_114464981 | 3300012987 | Soil | MMKFPSTLDEENLLTYEVSDEALETAGGKEIAANFTLGSCTGLS |
| Ga0164305_116768201 | 3300012989 | Soil | MMKFPGSFDDEHLLTYEVSDEALETAGGKEIVVNFTLGSCTGLSECPA* |
| Ga0157374_124364242 | 3300013296 | Miscanthus Rhizosphere | VFNRRRSNMMKFPNALEEENFLTHEVSDEVLETAAGKEIAAIFTLGSCTGLSECPA* |
| Ga0163162_126767541 | 3300013306 | Switchgrass Rhizosphere | MTKFPSTLDEENLFTYEVSDEILETAGAKEKEIAANFTLGSCTGLSECPG* |
| Ga0157375_122958561 | 3300013308 | Miscanthus Rhizosphere | NLLTYEVSDEVLETAGAKEKEIAANFTLGSCTGLSECPG* |
| Ga0157377_112278862 | 3300014745 | Miscanthus Rhizosphere | MMTFPSTIEEENLLMYDVTDEALETAGEKEIVANFTLGSCTGLSVCPA* |
| Ga0157379_102240911 | 3300014968 | Switchgrass Rhizosphere | MMKFPSTLEEEYLLTREVSDEALETAGAKEIAAMFTLGSCTGLSECPA* |
| Ga0157379_103421853 | 3300014968 | Switchgrass Rhizosphere | RTVLNHGRSNMMKFPSTLEEEYLLTCEVSDEALETAGAKEIAAMFTLGSCTGLSECPA* |
| Ga0132258_103049013 | 3300015371 | Arabidopsis Rhizosphere | MMKFPSTFDDESLLTYEVSDEALETAGEKEIAANFTLGSCTGLSECPA* |
| Ga0132258_104152594 | 3300015371 | Arabidopsis Rhizosphere | MMKFPSTLDEERPLTYEVSDEALETAGANAIAGNYTLGSCTGLSVCPA* |
| Ga0132258_106885784 | 3300015371 | Arabidopsis Rhizosphere | MMNFPSTLDEENLLLLACEVSDEALETAGGKEMTASFTLGSCTGLSVCPG* |
| Ga0132258_107370983 | 3300015371 | Arabidopsis Rhizosphere | MKKLSSNFDDEWFLNYEVSDEALETAEGIEIAANFTLGSCTGLSECPA* |
| Ga0132258_109825361 | 3300015371 | Arabidopsis Rhizosphere | MMKFPSTLDEENLLTYEASDEALETAGGKEIAANFTLGSC |
| Ga0132258_111269661 | 3300015371 | Arabidopsis Rhizosphere | MMKFPSTLEEEHLLTCEVSDEALETAGGKEIAVIFTLGSCTGLSECPA* |
| Ga0132258_115860123 | 3300015371 | Arabidopsis Rhizosphere | MMKFPSTLDEENPHTYEVSDEALETAGGKEIAGNYTLASCTGLSVCPG* |
| Ga0132258_124576281 | 3300015371 | Arabidopsis Rhizosphere | MMKFPGKVEEKHLLTYEISDEALEIAGEKEKVAANFTLGSCTGLSECPA* |
| Ga0132258_139421011 | 3300015371 | Arabidopsis Rhizosphere | MMKFPSTLDEENLLTYEVSDEALETVGGKEISANFTLGSCTGLSECPG* |
| Ga0132256_1001342482 | 3300015372 | Arabidopsis Rhizosphere | MMKFPNALEEENFLTHEVSDEVLETAAGKEIAAIFTLGSCTGLSECPA* |
| Ga0132256_1007120421 | 3300015372 | Arabidopsis Rhizosphere | MMKFPSTLDEENLLSYEVSDEILETAGAKEKEIAANFTLGSCTGLSECPG* |
| Ga0132256_1036666241 | 3300015372 | Arabidopsis Rhizosphere | TLEEENLLMYDVSGEALETAGEKEIVANFTLGSCTGLSECPA* |
| Ga0132255_1001035387 | 3300015374 | Arabidopsis Rhizosphere | MKKLSSNFDDEWFLNYEVSDEALETAEGKEIAANFTLGSCTGLSECPA* |
| Ga0132255_1037972461 | 3300015374 | Arabidopsis Rhizosphere | MMTFPSTLEEENLLMYDVSDEALETAGEKEIVANFTLGSCTGLSVCPA* |
| Ga0182032_1000053210 | 3300016357 | Soil | MTKLSSNFDDEWFLDHEISDESLESAGGKEIAANFTLGSCRGLSECPA |
| Ga0187785_103602452 | 3300017947 | Tropical Peatland | MMKFPSILDEENLLTFEVSDEALETAGGKDIAASFTLGSCTGLSECPG |
| Ga0184610_11931383 | 3300017997 | Groundwater Sediment | MMKFLNTLDEENLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPG |
| Ga0187787_101573921 | 3300018029 | Tropical Peatland | MMSALSTLDDENLPTFEISDEALETAGGNEIAGNYTLGTCSGLSVCPA |
| Ga0187788_101902312 | 3300018032 | Tropical Peatland | MTKFPSTLNEEDLLTYEVSDEALETAGGNEIIGNYTLAACTGLSVCPG |
| Ga0187766_112131401 | 3300018058 | Tropical Peatland | MMNFPSTLDEESPLLICEVSDEALETAAGKEMTASFTLGSCTGLSVCPG |
| Ga0187765_100526446 | 3300018060 | Tropical Peatland | MMNFPNTLDEENLLLTCEVSDEALETAGGKEMTASFTLGSCTGLSVCPG |
| Ga0187765_103889481 | 3300018060 | Tropical Peatland | MMKFPSTLDEENLLTYEVSDEALEAAEGNKIAGSYTLASCTGLSVCPG |
| Ga0184611_11522261 | 3300018067 | Groundwater Sediment | MMKFPSTLEEEYLLTYEVSDEALETAGGKEIVVVNFTLGSCTGLSECPA |
| Ga0184635_100804381 | 3300018072 | Groundwater Sediment | MMKFLSTLDQESLLTYEVSDEALETAAGKDIAANFTLGSCTGLSECPG |
| Ga0184624_104700071 | 3300018073 | Groundwater Sediment | MMKFPSTFDDESLLTYEVSDEALETAAGKDIAANFTLGSCTGLSECPG |
| Ga0184625_106237891 | 3300018081 | Groundwater Sediment | MMKFLSTLDQESLLIYEISDEALETAAGKDIAANFTLGSCTGLSEC |
| Ga0193705_10775992 | 3300019869 | Soil | MMKFLSTSNEESLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPG |
| Ga0193730_11246151 | 3300020002 | Soil | CTDFNHRRSNMMKFPSALDEENLLAYEVSDEILETAGGKEITALFTLGSCTGLSECPA |
| Ga0210381_101763522 | 3300021078 | Groundwater Sediment | MMKFLSTSNEESLLTYEVSDEALETAAGNEIAANFTLGSCTGLSECPA |
| Ga0126371_100043854 | 3300021560 | Tropical Forest Soil | MMKFPSTLEEENLLTYEVSDEALETAGGKEMTANFTLGSCTGLSECPG |
| Ga0126371_103911433 | 3300021560 | Tropical Forest Soil | MTMFPSTFDEENLLTYEVSDEALETLGEKEIAAIFTLGSCTGLSECPA |
| Ga0126371_107292221 | 3300021560 | Tropical Forest Soil | MMKFPSTFDDESLLTYEVSDKALETAGGKEIVVNFTLGSCSGLSECPGLIDLD |
| Ga0222622_109561601 | 3300022756 | Groundwater Sediment | MMKFPSTSNEESLLTHEVSDEALETAAGKEIAANFTLGSCTGLSE |
| Ga0207710_102845082 | 3300025900 | Switchgrass Rhizosphere | MMKFPSTLEEEYLLTREVSDEALETAGGKEIAAVFTLGSCTGLSECPA |
| Ga0207710_105273401 | 3300025900 | Switchgrass Rhizosphere | MTTFPSTFDDESLLTYEVSDEALETAGEKEIVANFTLGSCTGLSVCPA |
| Ga0207685_101618514 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKFPSTFNDESLLTYQVSDEALETAGGKEIAVNFTLGSCTGLSECPA |
| Ga0207685_101660171 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKFPSALDEENLLACEVSDETLETAGGKQIAANFTLGSCTGLSECPG |
| Ga0207693_100806763 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTFPSTLEEENLLMYDVSDEALETAGEKEIVANFTLGSCTGLSVCPA |
| Ga0207693_101888784 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKFPSTLEEKYLLTCEVSDEALETAGGKEIAVIFTLGSCTGLSECPA |
| Ga0207663_105391901 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MMKFPSTLEEEYLLTCEVSDEALETAGGKEIAVIFTLGSCTGLSECP |
| Ga0207663_110320281 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SSTYGFNDRRSNMMKFPSTLDEENLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPG |
| Ga0207687_102657213 | 3300025927 | Miscanthus Rhizosphere | MMKFPSTLDEENLLTYEVSDEVLETAGAKEKQIAANFTLGSCTGLSECPG |
| Ga0207700_112982662 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RRSNMMTFPSTIEEENLLMYDVSDEALETAGEKEIVANFTLGSCTGLSVCPA |
| Ga0207706_111100791 | 3300025933 | Corn Rhizosphere | MLKLCSNFDDERFLNSEVSDEALETAGGKKIAANFTLGSCT |
| Ga0207661_105373921 | 3300025944 | Corn Rhizosphere | MTKFPSTLDEENLFTYEVSDEILETAGAKEKEIAANFTLGSCTGLSECPG |
| Ga0207712_113596332 | 3300025961 | Switchgrass Rhizosphere | MKFPSTLEEEYLLTREVSDEALETAGGKEIAAVFTLGSCTGLSECPA |
| Ga0210145_10129682 | 3300025973 | Natural And Restored Wetlands | MMKFPSTLDEQNLLAYEVPDAALETAAGKEMAANFTLGSCTGLSECPA |
| Ga0210117_10236481 | 3300025985 | Natural And Restored Wetlands | MKFLSTLDEENILTYEASDEALETAGGKEIAANFTLGSCTGLSECPA |
| Ga0207658_106589722 | 3300025986 | Switchgrass Rhizosphere | MKFPSTLEEEYLLTREVSDEALETAGAKEIAATFTLGSCTGLSECPA |
| Ga0207703_106128142 | 3300026035 | Switchgrass Rhizosphere | MMKFPSSLEEDYLLTCEVSDETLETAGGKEIAAMFTLGSCTGLSECPA |
| Ga0207708_103487261 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | EEEYLLTCEVSDEALETAGAKEIAAMFTLGSCTGLSECPA |
| Ga0207683_100161159 | 3300026121 | Miscanthus Rhizosphere | MVKFPSTLEEEHLLTCEVSDEALETAGGKEIAAIFTLGSCTGLSECPA |
| Ga0207683_102170062 | 3300026121 | Miscanthus Rhizosphere | MTTFPSTFDDESLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPA |
| Ga0256821_10068192 | 3300026452 | Sediment | MMKFTTTLDEQNFLAHEVPDEALETAAGKEMAANFTLGSCTGLSECPA |
| Ga0256814_10490221 | 3300026464 | Sediment | PRIVFNHRRRNMMKFLSTLDEENILTYEASDEALETAGGKEIAANFTLGSCTGLSECPA |
| Ga0207725_1005302 | 3300026692 | Tropical Forest Soil | MMKFQSTLNEEDDLLTLDISDEALETVGGNEVVGNFTLGACTGLSVCPA |
| Ga0207820_1006672 | 3300026809 | Tropical Forest Soil | MKSPSAFDEDDLFTYEVSDEALETAGGHELAGNYTLGSCTGLSVCPG |
| Ga0207765_1004943 | 3300026819 | Tropical Forest Soil | MKSPSAFDEDDLFTYEVSDEALETAGGHELAGNYTLGSCTGLSVCPS |
| Ga0207764_1040481 | 3300026839 | Tropical Forest Soil | KHMMKFQSTLNEEDDLLTLDISDEALETVGGNEVVGNFTLGACTGLSVCPA |
| Ga0207764_1258362 | 3300026839 | Tropical Forest Soil | MMKIQSTLNEEDDFLTFEISDEALETAGGNEVVGNFTLGACTGLSVCPA |
| Ga0207729_1019882 | 3300026858 | Tropical Forest Soil | MVLNHRRSNFMKSPSAFDEDDLFTYEVSDEALETAGGHELAGNYTLGSCTGLSVCPG |
| Ga0207729_1022761 | 3300026858 | Tropical Forest Soil | MMNFQSTLNEEDDLLTLDISDEALETVGGNEVVGNFTLGACTGLSVCPA |
| Ga0207805_100013112 | 3300026887 | Tropical Forest Soil | MMKFQSTLNEEDDLLTLETSDEALETAGGNEVVGNFTLGACTGLSVCPA |
| Ga0207745_10010115 | 3300026889 | Tropical Forest Soil | MKILSTFDEDNLFTYLSDEALETAGGHELAGNYTLGSCTGLSVCPG |
| Ga0207741_10018511 | 3300026941 | Tropical Forest Soil | MMKFQSTLNEEDDLLTFEISDEALETAGGNEVVGNFTLGACTGLSVCPA |
| Ga0207835_10009124 | 3300026953 | Tropical Forest Soil | MMKIQSTLNEEDDLLTLDISDEALETVGGNEVVGNFTLGACTGLSVCPA |
| Ga0208761_10091563 | 3300026995 | Soil | TDFNHRRSNMMKFPSALDEENLLAYEVSDEILETAGGKEITALFTLGSCTGLSECPA |
| Ga0207740_10020714 | 3300027011 | Tropical Forest Soil | MKSLSAFDEDDLFTYEVSDEALETAGGHELEGNYTLGSCTGLSVCPS |
| Ga0209731_10157941 | 3300027326 | Forest Soil | MMKFPSTLDEETLLTYEVSDEALETAGGNEIAGNYTLASCTGLSVCPA |
| Ga0207981_10087065 | 3300027560 | Soil | MIKFPSALDEENLLAYEVSDETLETAGGKEIAANFTLGSCTGLSECPA |
| Ga0209814_100064803 | 3300027873 | Populus Rhizosphere | MMKFPSTLEEENLLMYDVSDEALETAGGKEIVANFTLGSCTGLSACPA |
| Ga0209814_100935152 | 3300027873 | Populus Rhizosphere | MMKFPSTLDDESLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPA |
| Ga0307282_102473423 | 3300028784 | Soil | MMKFPSTSNEESLLTHEVSDEALETAAGNEIAANFTLGSCTGLSECPA |
| Ga0307305_100341334 | 3300028807 | Soil | MMKFPSTSNEESLLTHEVSDEALETAAGKEIAANFTLGSCTGLSECPA |
| Ga0307292_101986501 | 3300028811 | Soil | NMMKFLSTSNEESLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPG |
| Ga0307302_104293211 | 3300028814 | Soil | MMKFPSTFDDESLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPA |
| Ga0307310_100440304 | 3300028824 | Soil | MMKFPSTSNEESLLTHEVSDEALETAGGKEIAANFTLGSCTGLSECPG |
| Ga0075386_119688012 | 3300030916 | Soil | MMKFPSALDEKNLLAYEVSDETLETAGGKEIATNFTLGSCTGLSECPA |
| Ga0307498_100013565 | 3300031170 | Soil | MMKFFSTSNEESLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPG |
| Ga0307498_101462563 | 3300031170 | Soil | FPSTLEEEYLLTREVSDEALETAGGKEIAAMFTLGSCTGLSECPA |
| Ga0170824_1055109762 | 3300031231 | Forest Soil | MKKFLSTSNEENLLTYEVSDEALETAGGKEIAANFTLGSCTGLSECPA |
| Ga0170824_1257159591 | 3300031231 | Forest Soil | MKFPSALDEKNLLAYEVSDETLETAGGKEIAANFTLGSCTGLSECPA |
| Ga0170824_1270728723 | 3300031231 | Forest Soil | MMTFPSTLEEENLLMYDVSDEALETAGEKEIVANFTLGSCTGLSECPA |
| Ga0170820_139846181 | 3300031446 | Forest Soil | MMKFPRTFDDESLLTYEVSDETLETAGGKQIAANFTLGSCTGL |
| Ga0170819_153665223 | 3300031469 | Forest Soil | MMKFPSALDEENLLTYEVSDEILETAGGRVVAGNFTLGDCTGLSVCPA |
| Ga0318516_105650851 | 3300031543 | Soil | HVHFPSHRRSNMTKLSSNFDDEWFLNYEISDESLETAGGKEIAANFTLGSCTGLSECPA |
| Ga0318534_100506181 | 3300031544 | Soil | MTKLSSNFDDEWFLNYEISDESLETAGGKEIAANFTLG |
| Ga0318534_106009762 | 3300031544 | Soil | FPSHWRSNMTKLSSNFDDEWFLNYEISDESLETAGGKEIAANFTLGSCTGLSECPA |
| Ga0318541_100087858 | 3300031545 | Soil | MTKLSSNFDDEWFLNYEISDESLETAGGKEIAANFTLGSCTGLSECPA |
| Ga0310886_101358011 | 3300031562 | Soil | MMKFPSTLEEEYLLTREVSDEALETAGGKEIAAMFTLGS |
| Ga0310915_100822321 | 3300031573 | Soil | MMKFQSTLNEEDDLLTLEISDEALETAGGNEVVGNFTLGACTGLSVCP |
| Ga0307469_100171304 | 3300031720 | Hardwood Forest Soil | MKFPSTLDQENPLTYEVSDEALETAGGNEIVGSYTLASCTGLSVCPG |
| Ga0307469_102436382 | 3300031720 | Hardwood Forest Soil | MLKLCSTFDDESLLTYEVSDVALETAGEKEIVANFTLGSCTGLSECPA |
| Ga0318500_106400912 | 3300031724 | Soil | MMKFQSTSNEEDDLLTLEISDEALETAGGNEVVGNFTLGACTGLSVCPA |
| Ga0307468_1005199921 | 3300031740 | Hardwood Forest Soil | MMKFPSTLDQENPLTYEVSDEALETAGGNEIVGSYTLASCTGLSVCPG |
| Ga0307468_1011668902 | 3300031740 | Hardwood Forest Soil | MLKLCSTFDDESLLTYEVSDEALETAGEKEIVANFTLGSCTGLSVCPA |
| Ga0306918_107177102 | 3300031744 | Soil | PSTFDDESLLAREVSDEVLETAGGKEIAAIFTLGSCTGLSECPA |
| Ga0306918_115270752 | 3300031744 | Soil | MMKFPSTLGEEDLLTYEVSDEVLETAGGKEIAANFTLGSCTGLSECPA |
| Ga0318509_103635641 | 3300031768 | Soil | MMKFQSTLNEEDDLLTLEISDEALETAGGNEVVGNFTLGACTG |
| Ga0318546_107425321 | 3300031771 | Soil | QETHMMKFQSTSNEEDDLLTLEISDEALETAGGNEVVGNFTLGACTGLSVCPA |
| Ga0318547_105741971 | 3300031781 | Soil | MMKFQSTLNEEDDLLTLEISDEALETAGGNAVVGNFTLGACTGLSVCPA |
| Ga0310907_105601813 | 3300031847 | Soil | ALDEENLLAYEVSDEILETAGGKEITALFTLGSCTGLSECPA |
| Ga0310892_105042701 | 3300031858 | Soil | MMKFPGSSDDEHLLTYEVSDEVLETAGGKEIAAMFTLGSCTGLSECPA |
| Ga0306919_100259363 | 3300031879 | Soil | MMKFQSTLNEEDDLLTLEISDEALETAGGNEVVGNFTLGACTGLSVCPA |
| Ga0306919_106068241 | 3300031879 | Soil | MMKFPSTFDDESLLAREVSDEVLETAGGKEIAAIFTLGSCTGLSECPA |
| Ga0310900_102380781 | 3300031908 | Soil | MMTFPSTFDDESLLTYEVSDEALETAGEKEIVANFTLGSCTGLSVCPA |
| Ga0306923_111356001 | 3300031910 | Soil | MMKFPSTFDDESLLAREVSDEVLETAGGKEIAAIFTLGSCTGLSEC |
| Ga0306926_106247403 | 3300031954 | Soil | VPTQETHMMKFQSTLNEEDDLLTLEISDEALETAGGNEVVGNFTLGACTGLSVCPA |
| Ga0310903_100509974 | 3300032000 | Soil | MMKFPSALDEENLLAYEVSDEILETAGGKEITALFTLGSCTGLSECPA |
| Ga0310902_102375411 | 3300032012 | Soil | MMTFPSTFDDESLLTYEVSDEALETAGEKEIVANFTLGSCTG |
| Ga0318558_105098142 | 3300032044 | Soil | SMTKLSSNFDDEWFLNYEISDESLETAGGKEIAANFTLGSCTGLSECPA |
| Ga0310890_107531782 | 3300032075 | Soil | HHRRSNMMKFPSTLEEEYLLTCEVSDEALETAGAKEIAAMFTLGSCTGLSECPA |
| Ga0307470_112569972 | 3300032174 | Hardwood Forest Soil | MLKLCSNFDDERFLNSEVSDEALETAGGKKIAANFTLGS |
| Ga0307471_1001276482 | 3300032180 | Hardwood Forest Soil | MMKFPSTLDEENLLTYEVSDEALETAGGKEISANFTLGSCTGLSECPA |
| Ga0307471_1025830721 | 3300032180 | Hardwood Forest Soil | IDFNQRRSNMKKFLSTSDEENLLTYEVSDEALETAGGNEIAGNYTLAACTGLSVCPG |
| Ga0310914_113762972 | 3300033289 | Soil | MRKFQSTLNEEDDLLTLEISDEALETAGGNEVVGNFTLGACTGLSVCPA |
| Ga0310810_101948193 | 3300033412 | Soil | MMKFPSTLDQENPLAYEVSDEALETAGGNEIVGSYTLASCTGLSVCPG |
| Ga0373948_0026045_31_177 | 3300034817 | Rhizosphere Soil | MMKFPSTLDEENLLTYEVSDEALETAGEKEIVANFTLGSCTGLSECPA |
| ⦗Top⦘ |