| Basic Information | |
|---|---|
| Family ID | F014248 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 264 |
| Average Sequence Length | 46 residues |
| Representative Sequence | RQERTAEAVLELVLATGERLRIGTGVDTATLRTVLDALRA |
| Number of Associated Samples | 227 |
| Number of Associated Scaffolds | 264 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 11.83 % |
| % of genes near scaffold ends (potentially truncated) | 83.71 % |
| % of genes from short scaffolds (< 2000 bps) | 86.36 % |
| Associated GOLD sequencing projects | 217 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.076 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (7.197 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.758 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.530 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.65% β-sheet: 11.76% Coil/Unstructured: 70.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 264 Family Scaffolds |
|---|---|---|
| PF05717 | TnpB_IS66 | 75.00 |
| PF13007 | LZ_Tnp_IS66 | 8.71 |
| PF13817 | DDE_Tnp_IS66_C | 3.03 |
| PF13005 | zf-IS66 | 0.76 |
| PF00196 | GerE | 0.76 |
| PF08299 | Bac_DnaA_C | 0.38 |
| PF01738 | DLH | 0.38 |
| PF00700 | Flagellin_C | 0.38 |
| PF14236 | DUF4338 | 0.38 |
| PF08388 | GIIM | 0.38 |
| PF01168 | Ala_racemase_N | 0.38 |
| PF00665 | rve | 0.38 |
| PF13565 | HTH_32 | 0.38 |
| PF12543 | DUF3738 | 0.38 |
| PF13408 | Zn_ribbon_recom | 0.38 |
| PF01575 | MaoC_dehydratas | 0.38 |
| PF02687 | FtsX | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 264 Family Scaffolds |
|---|---|---|---|
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 75.00 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.38 |
| COG1344 | Flagellin and related hook-associated protein FlgL | Cell motility [N] | 0.38 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.38 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.38 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.38 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.08 % |
| Unclassified | root | N/A | 29.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FIHLEPW02PSFHK | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300001181|JGI12663J13571_103008 | Not Available | 600 | Open in IMG/M |
| 3300001593|JGI12635J15846_10091211 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
| 3300002347|JGIcombinedJ26865_1061085 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300004114|Ga0062593_102035711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 639 | Open in IMG/M |
| 3300004152|Ga0062386_101027707 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300004153|Ga0063455_100267092 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300004629|Ga0008092_11022941 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300004633|Ga0066395_10575800 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300004643|Ga0062591_100569040 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300004643|Ga0062591_102830845 | Not Available | 514 | Open in IMG/M |
| 3300005171|Ga0066677_10503199 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300005332|Ga0066388_100516026 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1829 | Open in IMG/M |
| 3300005340|Ga0070689_101385512 | Not Available | 635 | Open in IMG/M |
| 3300005366|Ga0070659_102099692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium 501b | 508 | Open in IMG/M |
| 3300005436|Ga0070713_101700282 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005436|Ga0070713_101783465 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005437|Ga0070710_11381554 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005440|Ga0070705_101935533 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005441|Ga0070700_100676336 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300005451|Ga0066681_10995025 | Not Available | 500 | Open in IMG/M |
| 3300005467|Ga0070706_101746585 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005530|Ga0070679_101363591 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005535|Ga0070684_101681157 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005547|Ga0070693_101493862 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005552|Ga0066701_10508178 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005566|Ga0066693_10348629 | Not Available | 596 | Open in IMG/M |
| 3300005575|Ga0066702_10140102 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1423 | Open in IMG/M |
| 3300005578|Ga0068854_101116742 | Not Available | 703 | Open in IMG/M |
| 3300005614|Ga0068856_101400274 | Not Available | 714 | Open in IMG/M |
| 3300005764|Ga0066903_101395804 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1315 | Open in IMG/M |
| 3300005764|Ga0066903_104429305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300005843|Ga0068860_101224661 | Not Available | 771 | Open in IMG/M |
| 3300005896|Ga0075282_1010590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1102 | Open in IMG/M |
| 3300005944|Ga0066788_10051642 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300006028|Ga0070717_10099171 | All Organisms → cellular organisms → Bacteria | 2471 | Open in IMG/M |
| 3300006028|Ga0070717_10218890 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300006031|Ga0066651_10231830 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300006034|Ga0066656_11042645 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006162|Ga0075030_101238132 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006755|Ga0079222_10281985 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1070 | Open in IMG/M |
| 3300006755|Ga0079222_11706718 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300006791|Ga0066653_10285526 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300006796|Ga0066665_10627019 | Not Available | 860 | Open in IMG/M |
| 3300006853|Ga0075420_101285320 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300006871|Ga0075434_102290599 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006881|Ga0068865_102152316 | Not Available | 507 | Open in IMG/M |
| 3300006893|Ga0073928_11102254 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006893|Ga0073928_11115122 | Not Available | 534 | Open in IMG/M |
| 3300006954|Ga0079219_11399690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 625 | Open in IMG/M |
| 3300007004|Ga0079218_10039775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2822 | Open in IMG/M |
| 3300009012|Ga0066710_102941513 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300009088|Ga0099830_10081197 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 2377 | Open in IMG/M |
| 3300009089|Ga0099828_11857133 | Not Available | 529 | Open in IMG/M |
| 3300009090|Ga0099827_10073399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2649 | Open in IMG/M |
| 3300009091|Ga0102851_11198870 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300009093|Ga0105240_10670051 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300009156|Ga0111538_10182371 | All Organisms → cellular organisms → Bacteria | 2665 | Open in IMG/M |
| 3300009174|Ga0105241_10260475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1474 | Open in IMG/M |
| 3300009177|Ga0105248_10034048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5694 | Open in IMG/M |
| 3300009177|Ga0105248_10921818 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300009520|Ga0116214_1092351 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300009522|Ga0116218_1549065 | Not Available | 514 | Open in IMG/M |
| 3300009545|Ga0105237_10369761 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1439 | Open in IMG/M |
| 3300009553|Ga0105249_11020018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
| 3300009637|Ga0116118_1177726 | Not Available | 676 | Open in IMG/M |
| 3300009645|Ga0116106_1162764 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300009700|Ga0116217_11033936 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010038|Ga0126315_10307486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
| 3300010046|Ga0126384_10352542 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300010048|Ga0126373_11077808 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300010048|Ga0126373_12589875 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300010048|Ga0126373_13076227 | Not Available | 520 | Open in IMG/M |
| 3300010341|Ga0074045_10049082 | All Organisms → cellular organisms → Bacteria | 3066 | Open in IMG/M |
| 3300010358|Ga0126370_11747072 | Not Available | 600 | Open in IMG/M |
| 3300010361|Ga0126378_11529191 | Not Available | 757 | Open in IMG/M |
| 3300010361|Ga0126378_12424071 | Not Available | 599 | Open in IMG/M |
| 3300010362|Ga0126377_11988608 | Not Available | 657 | Open in IMG/M |
| 3300010366|Ga0126379_12094479 | Not Available | 668 | Open in IMG/M |
| 3300010376|Ga0126381_100344397 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300010376|Ga0126381_100554780 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300010376|Ga0126381_102291121 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300010376|Ga0126381_104465354 | Not Available | 540 | Open in IMG/M |
| 3300010379|Ga0136449_100184952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3999 | Open in IMG/M |
| 3300010379|Ga0136449_100273634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3110 | Open in IMG/M |
| 3300010379|Ga0136449_101534753 | Not Available | 1017 | Open in IMG/M |
| 3300010391|Ga0136847_10243968 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → Pirellula staleyi | 1879 | Open in IMG/M |
| 3300010401|Ga0134121_12462370 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010403|Ga0134123_13151142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 530 | Open in IMG/M |
| 3300010937|Ga0137776_1758688 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300011119|Ga0105246_11663822 | Not Available | 605 | Open in IMG/M |
| 3300011269|Ga0137392_11544294 | Not Available | 523 | Open in IMG/M |
| 3300011420|Ga0137314_1126266 | Not Available | 629 | Open in IMG/M |
| 3300011436|Ga0137458_1269337 | Not Available | 519 | Open in IMG/M |
| 3300012043|Ga0136631_10142873 | Not Available | 923 | Open in IMG/M |
| 3300012045|Ga0136623_10257877 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300012189|Ga0137388_11253839 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012200|Ga0137382_10060945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2387 | Open in IMG/M |
| 3300012203|Ga0137399_11643556 | Not Available | 531 | Open in IMG/M |
| 3300012212|Ga0150985_110440257 | Not Available | 595 | Open in IMG/M |
| 3300012353|Ga0137367_10779986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 664 | Open in IMG/M |
| 3300012683|Ga0137398_10832470 | Not Available | 645 | Open in IMG/M |
| 3300012922|Ga0137394_11404375 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300012944|Ga0137410_10391693 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300012957|Ga0164303_11190393 | Not Available | 557 | Open in IMG/M |
| 3300012971|Ga0126369_11020744 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300012971|Ga0126369_13276660 | Not Available | 530 | Open in IMG/M |
| 3300012989|Ga0164305_12182835 | Not Available | 509 | Open in IMG/M |
| 3300013307|Ga0157372_12311714 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300013308|Ga0157375_11241773 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300013308|Ga0157375_13374183 | Not Available | 532 | Open in IMG/M |
| 3300014166|Ga0134079_10189521 | Not Available | 855 | Open in IMG/M |
| 3300014167|Ga0181528_10222670 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300014199|Ga0181535_10611347 | Not Available | 624 | Open in IMG/M |
| 3300014326|Ga0157380_10520105 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1160 | Open in IMG/M |
| 3300014487|Ga0182000_10159207 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300014876|Ga0180064_1064450 | Not Available | 748 | Open in IMG/M |
| 3300014968|Ga0157379_11333765 | Not Available | 694 | Open in IMG/M |
| 3300014969|Ga0157376_12511804 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300015262|Ga0182007_10125217 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300015371|Ga0132258_10145312 | All Organisms → cellular organisms → Bacteria | 5680 | Open in IMG/M |
| 3300015371|Ga0132258_12072047 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1430 | Open in IMG/M |
| 3300015373|Ga0132257_101049806 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300015373|Ga0132257_102597034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 659 | Open in IMG/M |
| 3300015373|Ga0132257_103913105 | Not Available | 542 | Open in IMG/M |
| 3300015374|Ga0132255_101642979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 974 | Open in IMG/M |
| 3300016270|Ga0182036_11210884 | Not Available | 628 | Open in IMG/M |
| 3300016319|Ga0182033_11472660 | Not Available | 614 | Open in IMG/M |
| 3300016357|Ga0182032_10752709 | Not Available | 821 | Open in IMG/M |
| 3300017926|Ga0187807_1017040 | All Organisms → cellular organisms → Bacteria | 2239 | Open in IMG/M |
| 3300017931|Ga0187877_1057334 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300017942|Ga0187808_10133037 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300017946|Ga0187879_10008553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6645 | Open in IMG/M |
| 3300017947|Ga0187785_10546916 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300017955|Ga0187817_10234585 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300017988|Ga0181520_10351687 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300017995|Ga0187816_10351508 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300018025|Ga0187885_10485261 | Not Available | 551 | Open in IMG/M |
| 3300018026|Ga0187857_10340917 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300018027|Ga0184605_10081105 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1414 | Open in IMG/M |
| 3300018037|Ga0187883_10059878 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
| 3300018046|Ga0187851_10155256 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1383 | Open in IMG/M |
| 3300018057|Ga0187858_10765122 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300018058|Ga0187766_10842237 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300018059|Ga0184615_10497364 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300018090|Ga0187770_11035569 | Not Available | 661 | Open in IMG/M |
| 3300018090|Ga0187770_11337390 | Not Available | 581 | Open in IMG/M |
| 3300018431|Ga0066655_10718457 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300018465|Ga0190269_10322895 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300018468|Ga0066662_12558976 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300019361|Ga0173482_10030174 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1630 | Open in IMG/M |
| 3300019377|Ga0190264_10320326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300020004|Ga0193755_1037335 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1600 | Open in IMG/M |
| 3300020202|Ga0196964_10491297 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300020215|Ga0196963_10155915 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 977 | Open in IMG/M |
| 3300020215|Ga0196963_10436382 | Not Available | 589 | Open in IMG/M |
| 3300020582|Ga0210395_10078521 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 2431 | Open in IMG/M |
| 3300021384|Ga0213876_10157933 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300021401|Ga0210393_11127734 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 633 | Open in IMG/M |
| 3300021404|Ga0210389_10542678 | Not Available | 915 | Open in IMG/M |
| 3300021433|Ga0210391_11096259 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300021478|Ga0210402_11728728 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021560|Ga0126371_13932244 | Not Available | 500 | Open in IMG/M |
| 3300022557|Ga0212123_10869923 | Not Available | 534 | Open in IMG/M |
| 3300025898|Ga0207692_10367996 | Not Available | 890 | Open in IMG/M |
| 3300025908|Ga0207643_11030988 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300025916|Ga0207663_10062608 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 2365 | Open in IMG/M |
| 3300025919|Ga0207657_10806234 | Not Available | 726 | Open in IMG/M |
| 3300025922|Ga0207646_10867247 | Not Available | 802 | Open in IMG/M |
| 3300025924|Ga0207694_10978684 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300025939|Ga0207665_10106196 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1967 | Open in IMG/M |
| 3300025940|Ga0207691_10144413 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
| 3300025945|Ga0207679_11629677 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300025949|Ga0207667_11292397 | Not Available | 706 | Open in IMG/M |
| 3300025960|Ga0207651_11480730 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300025981|Ga0207640_10298695 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300026078|Ga0207702_10069938 | All Organisms → cellular organisms → Bacteria | 3018 | Open in IMG/M |
| 3300026088|Ga0207641_10929894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia ubonensis | 864 | Open in IMG/M |
| 3300026089|Ga0207648_12218572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 510 | Open in IMG/M |
| 3300026317|Ga0209154_1276593 | Not Available | 561 | Open in IMG/M |
| 3300026325|Ga0209152_10054189 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1415 | Open in IMG/M |
| 3300026847|Ga0207802_1015215 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300026941|Ga0207741_1019837 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300027035|Ga0207776_1014202 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300027330|Ga0207777_1007677 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 2378 | Open in IMG/M |
| 3300027516|Ga0207761_1094699 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300027521|Ga0209524_1007557 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 2118 | Open in IMG/M |
| 3300027546|Ga0208984_1087471 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300027604|Ga0208324_1206375 | Not Available | 519 | Open in IMG/M |
| 3300027635|Ga0209625_1109768 | Not Available | 619 | Open in IMG/M |
| 3300027639|Ga0209387_1138453 | Not Available | 628 | Open in IMG/M |
| 3300027783|Ga0209448_10059460 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1285 | Open in IMG/M |
| 3300027825|Ga0209039_10021390 | All Organisms → cellular organisms → Bacteria | 3287 | Open in IMG/M |
| 3300027909|Ga0209382_11847406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 586 | Open in IMG/M |
| 3300027911|Ga0209698_10868398 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300027911|Ga0209698_11214347 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300028665|Ga0302160_10171597 | Not Available | 514 | Open in IMG/M |
| 3300028731|Ga0302301_1077236 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300028776|Ga0302303_10130290 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300029951|Ga0311371_11780933 | Not Available | 667 | Open in IMG/M |
| 3300030000|Ga0311337_10119221 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 2112 | Open in IMG/M |
| 3300030007|Ga0311338_11454486 | Not Available | 635 | Open in IMG/M |
| 3300030053|Ga0302177_10243346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 975 | Open in IMG/M |
| 3300030056|Ga0302181_10257153 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300030503|Ga0311370_10817461 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300030524|Ga0311357_11725485 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300030618|Ga0311354_10572216 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300031233|Ga0302307_10583854 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031236|Ga0302324_100141881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3958 | Open in IMG/M |
| 3300031241|Ga0265325_10482534 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300031525|Ga0302326_10181415 | All Organisms → cellular organisms → Bacteria | 3556 | Open in IMG/M |
| 3300031573|Ga0310915_10652359 | Not Available | 744 | Open in IMG/M |
| 3300031716|Ga0310813_10370919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1224 | Open in IMG/M |
| 3300031754|Ga0307475_11355064 | Not Available | 550 | Open in IMG/M |
| 3300031763|Ga0318537_10044617 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1600 | Open in IMG/M |
| 3300031765|Ga0318554_10767085 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300031771|Ga0318546_11235472 | Not Available | 525 | Open in IMG/M |
| 3300031777|Ga0318543_10246051 | Not Available | 797 | Open in IMG/M |
| 3300031779|Ga0318566_10040283 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 2187 | Open in IMG/M |
| 3300031799|Ga0318565_10254884 | Not Available | 853 | Open in IMG/M |
| 3300031805|Ga0318497_10862880 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031879|Ga0306919_10213049 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1440 | Open in IMG/M |
| 3300031890|Ga0306925_10546162 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300031890|Ga0306925_11677698 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031890|Ga0306925_11943504 | Not Available | 557 | Open in IMG/M |
| 3300031912|Ga0306921_10187061 | All Organisms → cellular organisms → Bacteria | 2428 | Open in IMG/M |
| 3300031939|Ga0308174_11438678 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300031942|Ga0310916_11535927 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031946|Ga0310910_11534796 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031954|Ga0306926_12976400 | Not Available | 507 | Open in IMG/M |
| 3300032001|Ga0306922_11362209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300032002|Ga0307416_100614705 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300032013|Ga0310906_10581992 | Not Available | 769 | Open in IMG/M |
| 3300032051|Ga0318532_10093838 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300032051|Ga0318532_10160218 | Not Available | 799 | Open in IMG/M |
| 3300032074|Ga0308173_11932995 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300032160|Ga0311301_10403088 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 2093 | Open in IMG/M |
| 3300032205|Ga0307472_102298251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 546 | Open in IMG/M |
| 3300032261|Ga0306920_102272845 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300032783|Ga0335079_10429503 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300032783|Ga0335079_10629513 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300032783|Ga0335079_11617974 | Not Available | 636 | Open in IMG/M |
| 3300032783|Ga0335079_11995241 | Not Available | 559 | Open in IMG/M |
| 3300032805|Ga0335078_11737315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300032805|Ga0335078_12494669 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300032828|Ga0335080_11832973 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300032829|Ga0335070_11190996 | Not Available | 699 | Open in IMG/M |
| 3300032892|Ga0335081_11832003 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300032892|Ga0335081_12442468 | Not Available | 542 | Open in IMG/M |
| 3300032892|Ga0335081_12495157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300032897|Ga0335071_10150123 | All Organisms → cellular organisms → Bacteria | 2284 | Open in IMG/M |
| 3300032897|Ga0335071_11997270 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300033004|Ga0335084_10185723 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 2159 | Open in IMG/M |
| 3300033158|Ga0335077_10120452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3052 | Open in IMG/M |
| 3300033158|Ga0335077_10212570 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 2166 | Open in IMG/M |
| 3300033289|Ga0310914_10866913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300033412|Ga0310810_10552663 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300033412|Ga0310810_11185568 | Not Available | 621 | Open in IMG/M |
| 3300033480|Ga0316620_11045805 | Not Available | 796 | Open in IMG/M |
| 3300034151|Ga0364935_0232183 | Not Available | 599 | Open in IMG/M |
| 3300034199|Ga0370514_158386 | Not Available | 585 | Open in IMG/M |
| 3300034268|Ga0372943_0523544 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.20% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.06% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.92% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.41% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.03% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.03% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.27% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.52% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.14% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.14% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.14% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.14% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.14% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.76% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.38% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.38% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.38% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.38% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.38% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.38% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.38% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.38% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.38% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.38% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.38% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.38% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.38% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.38% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.38% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.38% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 3300001181 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014876 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_07301600 | 2070309004 | Green-Waste Compost | VRFALVERSARRQEERTTEAALELVLATGERLRIGTGVDPTTLRAVLDVLRA |
| JGI12663J13571_1030081 | 3300001181 | Forest Soil | DRRVARREPEPEAALELVMATGERLRIGAGVDAATLRTVLEVLRP* |
| JGI12635J15846_100912113 | 3300001593 | Forest Soil | VDRGVARQEPATEAALELVLATGERLRIGAGVDAAALRTVLEVLRP* |
| JGIcombinedJ26865_10610851 | 3300002347 | Arctic Peat Soil | TTEASLELVLATGERLRIGVGVDGATLRTVLEALRA* |
| Ga0062593_1020357111 | 3300004114 | Soil | VRFALVERSVRRQERTAEAPLELVLATGERLRIGTGVDTATLRAVLDVLRA* |
| Ga0062386_1010277073 | 3300004152 | Bog Forest Soil | VRFALVERSSRRQERTAEAVLELVLATGERLRIGTGVDPATLRVVLDVLRA* |
| Ga0063455_1002670923 | 3300004153 | Soil | DRRAARLESATEATLELVLTTGARLRIGAGVDAATLRTVLEALRT* |
| Ga0008092_110229411 | 3300004629 | Tropical Rainforest Soil | VRFALVERNAPQQERPAEALLELVLATGERLRIGAGVDTATLRAVLDILRA* |
| Ga0066395_105758001 | 3300004633 | Tropical Forest Soil | EQSATDTDLEVVFATGERLRIRRGVDGATLRTVVEALRG* |
| Ga0062591_1005690403 | 3300004643 | Soil | PVRFALVERSTRRQERTPEAALELVLLATGERLRIGPGVDMMTLRTVLDALRG* |
| Ga0062591_1028308452 | 3300004643 | Soil | RRQEHAAEAALEVVLATGERLRISAGVDATTLRTVLDVLRA* |
| Ga0066677_105031993 | 3300005171 | Soil | LVERRATRQERTAEAALELVLPTGERLRIGAGVDTATLRAVLDVLRA* |
| Ga0066388_1005160263 | 3300005332 | Tropical Forest Soil | VERSARRQERTAEPIMELVLATGERLRIGPGVDITTLRIVLNVLRG* |
| Ga0070689_1013855122 | 3300005340 | Switchgrass Rhizosphere | ESGPVRFAVVERSARRQERTAEAALELVLATGERLRISAGVDAATLRTVLDVLRA* |
| Ga0070659_1020996921 | 3300005366 | Corn Rhizosphere | LVDRGPRREERATEAALELLLASGERLRISAGVDAATLRLVLDVLRA* |
| Ga0070713_1017002821 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RQELATEAALELVIATGERLRIGAGVDAATLRTVLEVLRP* |
| Ga0070713_1017834652 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GPVRFALVEKSARRQERGAEAVLELVLKSGDLLRIGSGVETATLRAVLDALRA* |
| Ga0070710_113815542 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LVERNARQQERQAEAVLELVLGTGERLRIGAGVDSATLRAVLDILRA* |
| Ga0070705_1019355332 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | ARRRERTAEPVLEVVLATGERLRIGTGVDITTLRTVLDVLRG* |
| Ga0070700_1006763363 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | LQECATEALLELVLANGERLRVGTGVDSSTLRTVLEALRA* |
| Ga0066681_109950252 | 3300005451 | Soil | ALVERSGRRQERTTEAALELVLATGERLRIGTGVDPATLRAVLDVLRV* |
| Ga0070706_1017465851 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LVERGAARQEPATEAALELVLATGERLRIGAGVDAATLHTVLEAVRA* |
| Ga0070679_1013635911 | 3300005530 | Corn Rhizosphere | TGPVRFALVDRSPRRQEHAAEVALELVLATGERLRISAGVDAATLRLVLDVLRA* |
| Ga0070684_1016811571 | 3300005535 | Corn Rhizosphere | LVDRGPRREERATEAALELLLASGERLRISAGVDAATLRTVLDVL |
| Ga0070693_1014938621 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | FALVDRSTRRQEWTAESVLELVLATGERLRICPGVDLTTLRTVLDVLRA* |
| Ga0066701_105081781 | 3300005552 | Soil | EAALELVMATGERLRIGIGVDAATLRTVLEILRP* |
| Ga0066693_103486291 | 3300005566 | Soil | ALVERSARRQERTTEAALELVLATGERLRIGTGVDPATLRAVLDVLRV* |
| Ga0066702_101401023 | 3300005575 | Soil | VRFALVERSARRQECTAEAALELVLPTGERLRIATGVDTATLRAVLDVLRA* |
| Ga0068854_1011167421 | 3300005578 | Corn Rhizosphere | FALVDRGPRREERATEAALELLLASGERLRISAGVDAATLRLALDVLRA* |
| Ga0068856_1014002743 | 3300005614 | Corn Rhizosphere | EKGPVRFALVEKSARRQERTAEAALELLLATGERLRIGPGVDKTTLRTVLDALRG* |
| Ga0066903_1013958043 | 3300005764 | Tropical Forest Soil | RQERTAETVLELVLATGERLRISPGVDITTLRIVLDVLRA* |
| Ga0066903_1044293053 | 3300005764 | Tropical Forest Soil | DHATDAALELVLASGARLRIGAGVDAATLRTVLDALRG* |
| Ga0068860_1012246611 | 3300005843 | Switchgrass Rhizosphere | VRFALVERSTRRQERTGEAALELVLATGERLRIVAGVDTATLRAVLDVLRA* |
| Ga0075282_10105903 | 3300005896 | Rice Paddy Soil | ESGPVRFALVERSVRRQERTTEPALELVLATGERLRIGAGVDTATLRIVLDLLRA* |
| Ga0066788_100516423 | 3300005944 | Soil | EPMLELVLKTGERLRIGRGVDEAALRTVLAALRA* |
| Ga0070717_100991714 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PASEANLELILASGERLRIGAGVDAITLRMVLTALRA* |
| Ga0070717_102188903 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RLQEKGPVRFALVERSARRQERTAEAALELRLATGERLRIGPGVDKTTLRTVLDALRG* |
| Ga0066651_102318301 | 3300006031 | Soil | VRFALVDRRAGHHEPAAEADLELVLANGERLRIGAGVDAAALRTVLSVLRA* |
| Ga0066656_110426452 | 3300006034 | Soil | VERRATRQERTAEAALELVLPTGERLRIGAGVDTATLRAVLDVLRA* |
| Ga0075030_1012381322 | 3300006162 | Watersheds | VDRRVARQEPATEAALELVMATGERLRIGAGVDAATLRTVLEVLRP* |
| Ga0079222_102819851 | 3300006755 | Agricultural Soil | GEVGLELVLTTGERLRIGKQVDAAMLRMVVEALRG* |
| Ga0079222_117067182 | 3300006755 | Agricultural Soil | LQEKGPVRFALVERSARRQERPAEAVLELVLASGERLRIGMGVDSATLRVVLDVLRA* |
| Ga0066653_102855263 | 3300006791 | Soil | QQTGPVRFALVDRSPRRQERAAEAALELVLATGERLRISAGVEAATLRTVLDVLRA* |
| Ga0066665_106270192 | 3300006796 | Soil | VSLVERGPVRQELETALELVLATGERLRIGAGVDGTTLRTVLEALRA* |
| Ga0075420_1012853203 | 3300006853 | Populus Rhizosphere | ATRQERTAEATLELVMVSGARLRIGSGVDTATLRKVLEVLRA* |
| Ga0075434_1022905991 | 3300006871 | Populus Rhizosphere | QATDAALELVLATGERLRIGAGVDATTLRTVLDTLRA* |
| Ga0068865_1021523161 | 3300006881 | Miscanthus Rhizosphere | PGGASEHSLELVLVTGERLRIGAGVSGAALRTVLDALRK* |
| Ga0073928_111022542 | 3300006893 | Iron-Sulfur Acid Spring | VRFALVERNGRRQQRTAEAVLELVLATGERLRIGSGVDAATLRSGLDVLRA* |
| Ga0073928_111151221 | 3300006893 | Iron-Sulfur Acid Spring | AAQQEPATEAALELVWATGERLRIGAGVDATTLRTVLEALRT* |
| Ga0079219_113996902 | 3300006954 | Agricultural Soil | VRFALVERNARQQERQAEAVLELGTGERLRIGAGVDSATLRAVLDILRA* |
| Ga0079218_100397751 | 3300007004 | Agricultural Soil | EKAPVRFALVDRRAARRESATEAALELVLATGERLRIAAGVDAATLRTVLDALRA* |
| Ga0066710_1029415131 | 3300009012 | Grasslands Soil | QRATEPDLELVLATGERLRISAGVDPTALRRVLEALRA |
| Ga0099830_100811973 | 3300009088 | Vadose Zone Soil | RRVARQEPATEAALELVMANGERLRIGAGVDAATLRTVLEVLRP* |
| Ga0099828_118571331 | 3300009089 | Vadose Zone Soil | EAGLELALATGERLRIGAGVDGTTLRTVLEALRA* |
| Ga0099827_100733991 | 3300009090 | Vadose Zone Soil | QEPATEAALELVLATGERLRIGAGVDAATLHTVLEAVRT* |
| Ga0102851_111988702 | 3300009091 | Freshwater Wetlands | VERGRLGQEAAAEVSLELVLATGERLRIGAGVDGVTLRTVLDALRA* |
| Ga0105240_106700511 | 3300009093 | Corn Rhizosphere | RRQEWTAESVLELVLATGERLRICPGVDLTTLRTVLDVLRA* |
| Ga0111538_101823713 | 3300009156 | Populus Rhizosphere | VLETEVVRQQAATEVGLELVLATGERLRIGAGVETATLRRVLEALRG* |
| Ga0105241_102604753 | 3300009174 | Corn Rhizosphere | VDRGPRREERATEAALELLLASGERLRISAGVDAATLRLVLDVLRA* |
| Ga0105248_100340481 | 3300009177 | Switchgrass Rhizosphere | VRFALVERSVRRQERTAEAPLELVLATGERLRIGTGVDTATLRA |
| Ga0105248_109218183 | 3300009177 | Switchgrass Rhizosphere | EHTAEPALELVLATGERLRIGPGVDITTLRTVLDALRG* |
| Ga0116214_10923513 | 3300009520 | Peatlands Soil | EVVRQATAAELELVLGNGERLRIGAGVDATTLRTVLEALRA* |
| Ga0116218_15490652 | 3300009522 | Peatlands Soil | VETTTRESAADAALELVLTTGERLRISAGVDAAALRKVLEALRA* |
| Ga0105237_103697611 | 3300009545 | Corn Rhizosphere | RKRLQQTGSVRFALVDRSSRRQEHAAEAALEVVLATGERLRISAGVDAATLRLVLDVLRA |
| Ga0105249_110200181 | 3300009553 | Switchgrass Rhizosphere | FALVERSTRRQERTGEAALELVLATGERLRIVAGVDTATLRAVLDVLRA* |
| Ga0116118_11777261 | 3300009637 | Peatland | ERGRMLQPSATEPVLELVLNTGERLRIGAGVNAAALRTVLAALRA* |
| Ga0116106_11627643 | 3300009645 | Peatland | TAQASLELVLATGERLLIGAGVDAATLRTVMDALRA* |
| Ga0116217_110339361 | 3300009700 | Peatlands Soil | GPVRFALVERNARRQERTAEPVLELVLATGERLRIGPGVDITTLRTVLDVLRG* |
| Ga0126315_103074861 | 3300010038 | Serpentine Soil | RSPRRQEGAVEAALELVLASGERLRISAGVDATTLRTVLDVLRA* |
| Ga0126384_103525422 | 3300010046 | Tropical Forest Soil | VRQESALEAQLELVLASGERLRIGAGVEAATLRLVVEALRA* |
| Ga0126373_110778082 | 3300010048 | Tropical Forest Soil | VRFALVDRSARRQERTAEAALELMLASGERLRISPGVDIMTLRTVLEVLRG* |
| Ga0126373_125898752 | 3300010048 | Tropical Forest Soil | RQERMTESVLELVLTTGERLRIGTGVDITTLQTVLVVLRG* |
| Ga0126373_130762272 | 3300010048 | Tropical Forest Soil | ALVDRSARQQERRAEPALELVLATGERLRIGPGVDITTFRTVLDVLRG* |
| Ga0074045_100490821 | 3300010341 | Bog Forest Soil | VRFALVDRRPARPQQRAAEAALELVLANGERLRIGTGADGATLRIVLEVLRA* |
| Ga0126370_117470722 | 3300010358 | Tropical Forest Soil | VERGARRQEGTAEVSLELVLATGERLRIGPGVDITTLRTVLDVLRA* |
| Ga0126378_115291911 | 3300010361 | Tropical Forest Soil | EWNLELTLLNGERLRIGARVDAVTLRTVLEALRA* |
| Ga0126378_124240712 | 3300010361 | Tropical Forest Soil | VRFALVETSARRQERTTEPVMELVLATGERLRIGAGVDTATLRTVLDILRA* |
| Ga0126377_119886081 | 3300010362 | Tropical Forest Soil | EGNLELTLLTGERLRIGAGVDAVTLRTVLEALRA* |
| Ga0126379_120944791 | 3300010366 | Tropical Forest Soil | VEGSVRKQVRTAESVMELVLATGERLRISRGVDTATLRAVLDILRA* |
| Ga0126381_1003443973 | 3300010376 | Tropical Forest Soil | LAETASGKGTVFALVERSTRRQDRPTEAVLELVLVTGARLRIGTGVDAATLRTVLDALRA |
| Ga0126381_1005547803 | 3300010376 | Tropical Forest Soil | VRQESALEAQLELVLANGERLRIGAGVEAATLRLVVEALRA* |
| Ga0126381_1022911213 | 3300010376 | Tropical Forest Soil | LHESGPVRFALVERNARRQERMTESVLELVLTTGERLRIGTGVDITTLQTVLVVLRG* |
| Ga0126381_1044653542 | 3300010376 | Tropical Forest Soil | ALVERSARRQERTAEAALELMLATGERLRISPGVDIMTLRTVLEVLRG* |
| Ga0136449_1001849526 | 3300010379 | Peatlands Soil | GQEPAAEASLELVLATGERLRIGAGVDAATLRTVLDALRA* |
| Ga0136449_1002736343 | 3300010379 | Peatlands Soil | MGNPQQPVRFALVEKEAVRQVPATEAALELVLGTGERLRIGTGVDGSTLRIVLEALRG* |
| Ga0136449_1015347531 | 3300010379 | Peatlands Soil | EASLELVLATGERLRIGAGVDPATLRTVLDALCA* |
| Ga0136847_102439681 | 3300010391 | Freshwater Sediment | VQTGRARPELTREASLELVLATGERLRIGAGVDPATLRRVLEALRA* |
| Ga0134121_124623702 | 3300010401 | Terrestrial Soil | VRFALVDRSPRRQESAAETALELVLATGERLRISAGVDAATLRTVLDVLRA* |
| Ga0134123_131511421 | 3300010403 | Terrestrial Soil | LQESGPVRFALVEKSARRQERTAEAVLELVLATGERLRIGAGVDITTLRTVLDVLRR* |
| Ga0137776_17586883 | 3300010937 | Sediment | AGDRAAEAAIELMLTTGERLRIGTGVHPTALRRVLEALRA* |
| Ga0105246_116638222 | 3300011119 | Miscanthus Rhizosphere | QESATEAALELVLTTGERLRIGVGVDATTLHLVLEALRA* |
| Ga0137392_115442942 | 3300011269 | Vadose Zone Soil | LLETRPARQQPATESGLELVLATGERLRIGAGVDPAVLRRMVEALRA* |
| Ga0137314_11262662 | 3300011420 | Soil | LQETGPVGFALVDRRPARPQQRAAEAALELVLANGERLRIGTGADGATLRIVLEVLRA* |
| Ga0137458_12693371 | 3300011436 | Soil | GAARQEPATETGLELVLATGERLRIATGVDATTLRIVLDALRA* |
| Ga0136631_101428733 | 3300012043 | Polar Desert Sand | ALVERSARRQERTAEPVLELMLATGERLRIGTGVDIATLRSVLDVLRG* |
| Ga0136623_102578773 | 3300012045 | Polar Desert Sand | EQGPVRFALVEREPARQELGKEVSLELVLPTGERLRIGAGVESTTLRTVLDALRA* |
| Ga0137388_112538392 | 3300012189 | Vadose Zone Soil | VARQESATEAALELVLATGERLRIGAGVDATTLRTVVEALRR* |
| Ga0137382_100609451 | 3300012200 | Vadose Zone Soil | RRQPAMETALELVLATGERLRIGAGVDGTTLRTVLEALRA* |
| Ga0137399_116435562 | 3300012203 | Vadose Zone Soil | RQEPATEAALELVLATGERLRIGAGVDAATLRTVLEALRP* |
| Ga0150985_1104402572 | 3300012212 | Avena Fatua Rhizosphere | QERTAEAALELVLTTGERLRISTSVDTATLRAVLDVLRA* |
| Ga0137367_107799861 | 3300012353 | Vadose Zone Soil | VDKSARRQERTAEAVLELVLVLATGERLRIGAGMDTATLRAVLEVLRT* |
| Ga0137398_108324701 | 3300012683 | Vadose Zone Soil | LVDRRAARQDWATEAALELVLATGERPRIGAGVDAATLRRVLEAVRT* |
| Ga0137394_114043751 | 3300012922 | Vadose Zone Soil | REPVRFALVDRGATRQETATEAALELVMASGERLRIGAGVDAATLHTVLEVLRP* |
| Ga0137410_103916933 | 3300012944 | Vadose Zone Soil | LVDRRAARQEPATEAALELVMATGERLRIGAGVDAATLRTVLEALRP* |
| Ga0164303_111903932 | 3300012957 | Soil | LQEKGPVRFALVESARRQERTTEAALELMLATGERLRIGTGFDPATLRAVLDVLRA* |
| Ga0126369_110207443 | 3300012971 | Tropical Forest Soil | QERTTESVLELVLATGERLRIGTGVDITTLRTVLDVLRG* |
| Ga0126369_132766602 | 3300012971 | Tropical Forest Soil | SARRQERTAEPVLELVLVTGERLRIATGVDGATLRTVIEALRG* |
| Ga0164305_121828351 | 3300012989 | Soil | ATEAVLELVLTTGARLRIGTGVDAATLRTVLDLLRA* |
| Ga0157372_123117143 | 3300013307 | Corn Rhizosphere | ESRPVRFALVERSPRRQERSAEPMLELVLTTGERLRISVGVDITTQRTMPDLRA* |
| Ga0157375_112417733 | 3300013308 | Miscanthus Rhizosphere | QERGPVRFALVERSARRQERTTEPVLDLVLATGERLRIGTGVDITTLRTVLDVLRG* |
| Ga0157375_133741832 | 3300013308 | Miscanthus Rhizosphere | AIRQERVPEAMLEVVFATGERLRIGVGVDTATLRTVVEVLRA* |
| Ga0134079_101895211 | 3300014166 | Grasslands Soil | VRFALVERSARRQERTTEPVLELVLATGERLRIGTGVDVTTLRAVLDVLRA* |
| Ga0181528_102226701 | 3300014167 | Bog | AVRFALVERGARRQERTAEAVLELVLATGERLRIAPGVDTATLRAVLDVLRS* |
| Ga0181535_106113471 | 3300014199 | Bog | GPVRFALVDRGPARPHQRAAEAALELVLANGERLRIGAGADAATLRIVLEVLRA* |
| Ga0157380_105201051 | 3300014326 | Switchgrass Rhizosphere | PATEVGLELVLATGERLRIGAGVETATLRRVLEALRG* |
| Ga0182000_101592071 | 3300014487 | Soil | AVRHQSATEVGLELVLATGERLRIGAGVETGTLRRVLEALRG* |
| Ga0180064_10644503 | 3300014876 | Soil | DVAEAALELVLPTGERLRISTGVDAATLRTVIDVLRA* |
| Ga0157379_113337653 | 3300014968 | Switchgrass Rhizosphere | PRRQESAAEAALELVLATGERLRISAGVDAATLRTVLDVLRA* |
| Ga0157376_125118041 | 3300014969 | Miscanthus Rhizosphere | RLQEKGPVRFALVESARRQERTTEAALELMLATGERLRISAGIDAATLRTVLDVLRA* |
| Ga0182007_101252171 | 3300015262 | Rhizosphere | SSHPRPVTDSVLELVLRNGERLRIGAGVDAVELRRVLAALRA* |
| Ga0132258_101453121 | 3300015371 | Arabidopsis Rhizosphere | VEKSAGRPERMAEATLELVLATGERLRIGPVVEITTLRTVLDVLRK* |
| Ga0132258_120720471 | 3300015371 | Arabidopsis Rhizosphere | ESATEAALELVLTTGERLRIGVGVDATTLHLVLEALRA* |
| Ga0132257_1010498063 | 3300015373 | Arabidopsis Rhizosphere | VRFALVDRSPRRQERAVEATLELVLATRERLHISAGVDAATLRTVLDVLRA* |
| Ga0132257_1025970342 | 3300015373 | Arabidopsis Rhizosphere | ALVDRRPRSQECAAEAALELVLATGERLRIGAGADAATLRIVLDVLRA* |
| Ga0132257_1039131052 | 3300015373 | Arabidopsis Rhizosphere | RGDGSVRFALVERSARRQERTPEAVLELVLATGERLRIGNGVDTATLRTVLDILRA* |
| Ga0132255_1016429791 | 3300015374 | Arabidopsis Rhizosphere | AARRQEGVGQASLELVLPTGARLRISAGVDSITLRTVLEALHI* |
| Ga0182036_112108842 | 3300016270 | Soil | WRKRLQESGPVRFALLERSVRRQERTAEPALELVLATGERLRIGVGVDTTTLRTVLDLLR |
| Ga0182033_114726601 | 3300016319 | Soil | RTTHAALELVLTTGERLRIGAGVDAATLRLVLDVLRP |
| Ga0182032_107527093 | 3300016357 | Soil | REQGPVRFALVERRGPRKELPAEPVLELVVASGERLRIGIGVDTATLRAVLDVLRA |
| Ga0187807_10170404 | 3300017926 | Freshwater Sediment | AEFGLELALANGDRLRIGTGVDTKTLRTVLELLRA |
| Ga0187877_10573343 | 3300017931 | Peatland | VRFALVERSARRRERTAEPVQELLLATGEWLRISPGVDLTTLRTVLDVLRG |
| Ga0187808_101330371 | 3300017942 | Freshwater Sediment | GPVRFALVERGARRQERTAEAALELVLATGERLRIGVGVDAATLRTVLDVLRA |
| Ga0187879_100085532 | 3300017946 | Peatland | MRFALVDRRPARPQQRAAEAVLELVLENGERLRIGAGADAATLRIVRDVLRA |
| Ga0187879_100773993 | 3300017946 | Peatland | RFAVVERGRMLQPSATEPVLELVLNTGERLRIGAGVDAAALRTVLAALRA |
| Ga0187785_105469161 | 3300017947 | Tropical Peatland | AVRFALVERSARRQERTAEAALELVLATGERLRIGPGVDITTLRTVLDVLRG |
| Ga0187817_102345851 | 3300017955 | Freshwater Sediment | QPSATEPVLEVVLNTGERLRIGAGVDAAVLRAVLAALRA |
| Ga0181520_103516873 | 3300017988 | Bog | PLRFALVEKEAARQAPATEAALELVLGTGERLRIGTGVDASTLHTVLEVLRA |
| Ga0187816_103515081 | 3300017995 | Freshwater Sediment | PVRFALVERGAQQVSAEFGLELALANGDRLRIGTGVDTKTLRTVLELLRA |
| Ga0187885_104852612 | 3300018025 | Peatland | PSATEPVLELVLNTGERLRIGAGVNAAALRTVLAALRA |
| Ga0187857_103409171 | 3300018026 | Peatland | EAARQAPATEAALELVLGTGERLRIGTGVDAATLGTVLEVLRA |
| Ga0184605_100811053 | 3300018027 | Groundwater Sediment | GPVLVALVDRGAVRQEATTGGSLELVLATGERLRIGAGVDATTLRTVLDALRA |
| Ga0187883_100598782 | 3300018037 | Peatland | VRFALVERDAARQETAKKADLELVLATGERLCIGTGVDGATLRTVLDALRA |
| Ga0187851_101552561 | 3300018046 | Peatland | DRGPARPHQRAAEAALELVLANGERLRIGAGADAATLRIVLEVLRA |
| Ga0187858_107651222 | 3300018057 | Peatland | WRKRLQEKGPVRFALVERSPRRQERTAEAVLELVLATGERLRIGAGVDIATLRAVLDVLR |
| Ga0187766_108422371 | 3300018058 | Tropical Peatland | RSARRQERTAEAALELVLATGDRLRIGAGVDITTLRTVLDVLRG |
| Ga0184615_104973641 | 3300018059 | Groundwater Sediment | ARETGLELILATGERLRIGAGVDGATLRAVLDVLRA |
| Ga0187770_110355693 | 3300018090 | Tropical Peatland | ERSARQQARMTEAALELVFATGERLRIGAGVDAATLRSVVEALRA |
| Ga0187770_113373901 | 3300018090 | Tropical Peatland | PVRFALIERGAAPPDSVATAALELVLATGERLRISAGVDAGTLRTVLQALRA |
| Ga0066655_107184573 | 3300018431 | Grasslands Soil | TETGLELVLATGERLRISAGVDPTVLRTVLEVLRA |
| Ga0190269_103228951 | 3300018465 | Soil | TAEAVLELMLATGERLRIGAGVDTATLQTVLDVLRA |
| Ga0066662_125589762 | 3300018468 | Grasslands Soil | PLVERSARRQDRTAEAVLELVLASGARLRIGSGVDAATLRTVLDALRA |
| Ga0173482_100301741 | 3300019361 | Soil | GTARQEPATESALELVLATGERLRIGAGVDADTLRTVLDALRA |
| Ga0190264_103203263 | 3300019377 | Soil | ALLETEAARQQPATEGGLELVLTTGERLRIGAGVETAALRRVLESLRG |
| Ga0193755_10373353 | 3300020004 | Soil | QEPTTERSLELVLVSGERLRIGAGVDATTLRTVLDALRV |
| Ga0196964_104912972 | 3300020202 | Soil | LVDRSPRRQELAPEAALELVLTTGERLRISAGVDAATLRIVLDALRA |
| Ga0196963_101559153 | 3300020215 | Soil | SRQEDAGQGALELVLPSGARLRISAGVDSTILRTVLEALQV |
| Ga0196963_104363821 | 3300020215 | Soil | RQEPAGEGQLELVLVTGARLRIGAGVDSTTLRTVLEALHV |
| Ga0210395_100785213 | 3300020582 | Soil | VPQAPEGNLELTLLTGERLRIGAGVDAVTLRTILEALRT |
| Ga0213876_101579331 | 3300021384 | Plant Roots | AKGGTAELVAGLELVLSSGERLRIGKGVDTATLRMVLELVQG |
| Ga0210393_111277341 | 3300021401 | Soil | PGRGPAEHAALELVLTTGARLRIGAGVDATTLRQVLEALRA |
| Ga0210389_105426781 | 3300021404 | Soil | GVRRQELAADAPLELVLPSGERLRISSGVDITTLRVVLDVLRA |
| Ga0210391_110962591 | 3300021433 | Soil | LASEASLELIVASGERLRIGVGVDATTLHPVLTALRA |
| Ga0210402_117287281 | 3300021478 | Soil | GLRPEAQTDVCIELILPGGERLRIAAGVDAVTLRRVLEALRA |
| Ga0126371_139322442 | 3300021560 | Tropical Forest Soil | HGPEWNLELTLLSGERLRIGAGVDGVTLRTVLEALRT |
| Ga0212123_108699231 | 3300022557 | Iron-Sulfur Acid Spring | AAQQEPATEAALELVWATGERLRIGAGVDATTLRTVLEALRT |
| Ga0207692_103679963 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ARREERTAEAALELVLATGERLRIGTGVDTATLRAVLDVLRA |
| Ga0207643_110309881 | 3300025908 | Miscanthus Rhizosphere | FALVDRSPRRQEHAAEAALEVVLATGERLRISAGVDATTLRTVLDVLRA |
| Ga0207663_100626083 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RGVRSARREERTAEAALELVLATGERLRIGTGVDTATLRAVLDVLRA |
| Ga0207657_108062341 | 3300025919 | Corn Rhizosphere | AEPALEVVLTTGERLRIGVGVDTATLRTVLDLLRA |
| Ga0207646_108672473 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AEPALELVLATGERLRIGAGVDTATLRTVLDLLRA |
| Ga0207694_109786842 | 3300025924 | Corn Rhizosphere | LVDRGPRREERATEAALELLLASGERLRISAGVDAATLRLVLDVLRA |
| Ga0207665_101061961 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVDRRVARQELATEAALELVIATGERLRIGAGVDAATLRTVLEVLRP |
| Ga0207691_101444132 | 3300025940 | Miscanthus Rhizosphere | MDGGLELVLVTGERLRIGAGVDGTTLRTVLVALRA |
| Ga0207679_116296772 | 3300025945 | Corn Rhizosphere | VDRGPRREERATEAALELLLASGERLRISAGVDAATLRTVLDVLRA |
| Ga0207667_112923973 | 3300025949 | Corn Rhizosphere | ARQESATEAALELVLTTGERLRIGVGVDATTLHLVLEALRA |
| Ga0207651_114807301 | 3300025960 | Switchgrass Rhizosphere | WRKRLQERGPVRFALVERSARRQERTTEPVLDLVLATGERLRIGTGVDITTLRTVLDVLR |
| Ga0207640_102986953 | 3300025981 | Corn Rhizosphere | LVDRGPRREERATEAALELLLASGERLRISAGVDAATLRLALDVLRA |
| Ga0207702_100699382 | 3300026078 | Corn Rhizosphere | VRFALVDRSPRRQESAAEAALELVLATGERLRISAGVDAATLRTVLDVLRA |
| Ga0207641_109298942 | 3300026088 | Switchgrass Rhizosphere | KGLVRFALVERSVRRQERTAEAPLELVLATGERLRIGTGVDTATLRAVLDVLRA |
| Ga0207648_122185721 | 3300026089 | Miscanthus Rhizosphere | EPTMDGGLELVLVTGERLRIGAGVDGTTLRTVLVALRA |
| Ga0209154_12765931 | 3300026317 | Soil | RVARQEPATEAALELVMATGERLRIGAGVDAATLRTVLEVLRP |
| Ga0209152_100541893 | 3300026325 | Soil | DRRVARQEPATEAALELVMATGERLRIGAGVDAATLRTVLEVLRP |
| Ga0207802_10152151 | 3300026847 | Tropical Forest Soil | VRFALVERSARRQERTADPVLELVLATGERLRIGPGVDITTLRTVLDVLRG |
| Ga0207741_10198373 | 3300026941 | Tropical Forest Soil | RLQEQGPVRFALVERSARRQERTAEPVLELVLATGERLRIGTGVDIPTFRAVLDVLRG |
| Ga0207776_10142023 | 3300027035 | Tropical Forest Soil | QERTTDPALELVLATGERLCIGTGVDITTLRTVLDVLRG |
| Ga0207777_10076771 | 3300027330 | Tropical Forest Soil | AGSATEQPALELFLPSGERLRIFSGVDAATLRTVLAALRA |
| Ga0207761_10946992 | 3300027516 | Tropical Forest Soil | GSATEQPALELFLPSGERLRIFSGVDAATLRTVLAALRA |
| Ga0209524_10075573 | 3300027521 | Forest Soil | RQEPATEAALELVVATGERLRIGAGVDAATLRTVLEILRP |
| Ga0208984_10874711 | 3300027546 | Forest Soil | GATRQEPATEAALELVMATGERLRIGAGVDAATLRRVLEVLRP |
| Ga0208324_12063751 | 3300027604 | Peatlands Soil | VETTTRESAADAALELVLTTGERLRISAGVDAAALRKVLEALRA |
| Ga0209625_11097681 | 3300027635 | Forest Soil | AARQEPATEAALELVMATGERLRIGAGVDAATLRTVLEILRP |
| Ga0209387_11384531 | 3300027639 | Agricultural Soil | RKRLLEKAPVRFALVDRRAARRESATEAALELVLATGERLRIAAGVDAATLRTVLDALRA |
| Ga0209448_100594603 | 3300027783 | Bog Forest Soil | VDRGAARQEPATEAALELVMATGERLRIGAGVDAATLRTVLEILRP |
| Ga0209039_100213904 | 3300027825 | Bog Forest Soil | VVRFALVDRGGVGQEPAAEASLELVLATGERLRIGAGVDAATLGTVLDALRA |
| Ga0209382_118474063 | 3300027909 | Populus Rhizosphere | VRFALVERSARRQERTAEAVLELVLATGERLRIGTGVDTATLRTVLDVLRT |
| Ga0209698_108683982 | 3300027911 | Watersheds | VDRRVARQEPATEAALELVMATGERLRIGAGVDAATLRTVLEVLRP |
| Ga0209698_112143471 | 3300027911 | Watersheds | RLQEKGPVQFALVERNARRQERTAEAVLELVLATGERLRIGTGVDTATLRSVLDVLRA |
| Ga0302160_101715972 | 3300028665 | Fen | EHTAEAALELVLATGERLRISRGVDTATLRAVLDVLRA |
| Ga0302301_10772363 | 3300028731 | Palsa | GEGRMLQPSATEPVLELVLHTGERLRIGAGVDAAALRTVLAALRA |
| Ga0302303_101302903 | 3300028776 | Palsa | VVERGRMLQPSGTEPVLELVLNTGERLRIGAGVDAAALRTVVAALRA |
| Ga0311371_117809333 | 3300029951 | Palsa | RQGLPAETVLELVLTTGERLRIGTGVDGVTLRAVLEALRA |
| Ga0311337_101192211 | 3300030000 | Fen | SARRPEHTAEAALELVLATGERLRISRGVDTATLRAVLDVLRA |
| Ga0311338_107556413 | 3300030007 | Palsa | AMVERGRVQLPSATQPVLELVLNTGERLRIGAGVDTAALRTVLAALRA |
| Ga0311338_114544862 | 3300030007 | Palsa | MLQPSATEPVLELVLNSGERLRIGAGVDAAALRTVLAALRA |
| Ga0302177_102433463 | 3300030053 | Palsa | KRLREKESVRFALVERRASRQGLPAETVLELVLTTGERLRIGTGVDGVTLRAVLEALRA |
| Ga0302181_102571533 | 3300030056 | Palsa | TEASLELVLATGERLRIGAGVDGATLRTVLDALRA |
| Ga0311370_108174613 | 3300030503 | Palsa | GTEPVLELVLNTGERLRIGAGVDAAALRTVVAALRA |
| Ga0311357_117254851 | 3300030524 | Palsa | GGVRREPTTEASLELVLATGERLRIGAGVDGATLRTVLDALRA |
| Ga0311354_105722163 | 3300030618 | Palsa | SGTEPVLELVLNTGERLRIGAGVDAAALRTVVAALRA |
| Ga0302307_105838542 | 3300031233 | Palsa | VERGGVRREPTTEASLELVLATGERLRIGAGVDGATLRTVLDALRA |
| Ga0302324_1001418815 | 3300031236 | Palsa | MLQPSATEPVLELVLNSGERLRIGAGVDPAALRTVLAALRA |
| Ga0265325_104825341 | 3300031241 | Rhizosphere | RLLEKGPVRFALVEKSARRQERTAEAVLEVVLATGELVRIGAGVDTATLRAVLDVLRA |
| Ga0302326_101814155 | 3300031525 | Palsa | MLQPSATEPVLELALNSGERLRIGAGVDAAALRTVLAALRA |
| Ga0310915_106523591 | 3300031573 | Soil | VRRQERTAEPALELVLATGERLRIGVGVDTTTLRTVLDLLRA |
| Ga0310813_103709191 | 3300031716 | Soil | LVERSVRRQERTAEAPLELVLATGERLRIGTGVDTATLRAVLDVLRA |
| Ga0307475_113550641 | 3300031754 | Hardwood Forest Soil | GAAQRELATKAALELVMATGERLRIGTGVDAATLRTVLEVLRS |
| Ga0318537_100446171 | 3300031763 | Soil | RLHEGGPVRFALVERSARRQERTAEAALELMLATGERLRIGPGVDITTLRTVLDALRG |
| Ga0318554_107670851 | 3300031765 | Soil | DRGARRQDRAAEASLELVLANGERLRIGPGVDVTTLRTVLDVLRA |
| Ga0318546_112354722 | 3300031771 | Soil | RTVEAVLELVLATGERLRIGAGVDAATLRIVLDALRA |
| Ga0318543_102460511 | 3300031777 | Soil | RFALVERSARRQERTAEAALELMLATGERLRIGPGVDITTLRTVLDALRG |
| Ga0318566_100402833 | 3300031779 | Soil | SARRQERMAEAVLELVLATGDRLRIGTGVDITTLRTVLDVLRG |
| Ga0318565_102548841 | 3300031799 | Soil | FFSFWCARRQERTAEAALELVLASGERLRIGIGVDTATLRAVLDALRR |
| Ga0318497_108628801 | 3300031805 | Soil | GPVRFALVERSARRQERTVEAVLELVLATGERLRIGAGVDAATLRIVLDALRA |
| Ga0306919_102130491 | 3300031879 | Soil | PRQELPAGAVLELVLTTGERLRIGAGVDGVTLRAVLDALRA |
| Ga0306925_105461623 | 3300031890 | Soil | SGPVRFALVERSARRQERTAETVLELVLATGERLRISPGVDIATLRTVLEVLRA |
| Ga0306925_116776983 | 3300031890 | Soil | QERTTESVLELVLATGERLRIGTGVDITTLRTVLDVLRG |
| Ga0306925_119435041 | 3300031890 | Soil | KRLQKKEPVRFAVVERGGARPAITTEAALELVLATGERLRISAGVDGATLRTVLEVLRA |
| Ga0306921_101870611 | 3300031912 | Soil | ALVERSARRQERTVEAGLELVLATGERLRIGAGVDAATLRTVLDALRA |
| Ga0308174_114386781 | 3300031939 | Soil | TAPVRFALVDRSPRRQERAAEAALELVLASGERLRISAGVDATTLRTVLDVLRA |
| Ga0310916_115359271 | 3300031942 | Soil | SGPVRFALVERSVRRQERTTESVLELVLATGERLRIGTGVDITTLRTVLDVLRG |
| Ga0310910_115347961 | 3300031946 | Soil | WRKRLQESGPVRFALVERSVRRQERTAEPALELVLATGERLRIGVGVDTTTLRTVLDLLR |
| Ga0306926_129764002 | 3300031954 | Soil | RLQEKGPVRFALVERSLRKQERTAESVMELVLATGERLRISTGVDSATLRAVLDVLRA |
| Ga0306922_113622093 | 3300032001 | Soil | GPVRFALVERIARRQECTTDAALELMLATGERLRIGAGVDAATLRLVLDVLRP |
| Ga0307416_1006147053 | 3300032002 | Rhizosphere | LVERGAVRQGSATDADLELVLASGERLRISNKVNAATLRTVLEVLRA |
| Ga0310906_105819923 | 3300032013 | Soil | RLQETGPVRFALVDRRPARPQQRAAEAALELVLANGERLRIGTGADGATLRIVLEVLRA |
| Ga0318532_100938381 | 3300032051 | Soil | WRKRLQESGPVRFALVERSARRQERMAEAVLELVLATGDRLRIGTGVDITTLRTVLDVLR |
| Ga0318532_101602183 | 3300032051 | Soil | PVRFALVERSARRQERTAEAALELMLATGERLRIGPGVDITTLRTVLDALRG |
| Ga0308173_119329951 | 3300032074 | Soil | VRFALVDRSPRRQERAVEAALELVLARGERLHISAGVDAATLRTVLDVLRA |
| Ga0311301_104030881 | 3300032160 | Peatlands Soil | RGRMLQSSATEPVLELVLNTGERLRIGAGVNAAALRTVLAALRA |
| Ga0307472_1022982511 | 3300032205 | Hardwood Forest Soil | LVDRRAARQEPATEAALELVLATGERLRIGAGVDATTLRSVLEALRA |
| Ga0306920_1022728452 | 3300032261 | Soil | VERSSQRRERTAEAVLQLVLPTGERLLIGAGVDAATLRAVLDVLRT |
| Ga0335079_104295031 | 3300032783 | Soil | AIQQDRTVEATLELVFATGERLRIGAGVDTAMLRIVVEALRA |
| Ga0335079_106295131 | 3300032783 | Soil | ELPAEALLELVLVTGERLRIGAGADTATLRSVLNILRT |
| Ga0335079_116179743 | 3300032783 | Soil | ARPQAPAESGLELVLTTGERLRIGAGVDPTRLRQVLAALRA |
| Ga0335079_119952412 | 3300032783 | Soil | SGPVRFALVERTVRRQERTTEPALELVLATGERLRIGAGVDTATLRTVLDLLRA |
| Ga0335078_117373151 | 3300032805 | Soil | GTAEAVLELVLATGERLRIGAGVDTATLRTVLDILRV |
| Ga0335078_124946692 | 3300032805 | Soil | LQQTGPVRSALVDRSPRRQESAAEAALELVLATGERLRISAGVDAATLRTVLDVLRA |
| Ga0335080_118329732 | 3300032828 | Soil | VRFALVEGSVRRQERTAEPALELVLATGERLRIGVGVDTATLRNVLDLLRA |
| Ga0335070_111909961 | 3300032829 | Soil | PARQQRATELDLELVLATGERLRIGADVDPTALRRVLAALRA |
| Ga0335081_118320033 | 3300032892 | Soil | LEWNLELTLLTGERLRIGAGVDAATFRTVLEALRA |
| Ga0335081_124424682 | 3300032892 | Soil | ERLQQRGPVRFALVERDARQQEWQAEAVLELVLATGERLRIGAGVDTATLRTVLDILRA |
| Ga0335081_124951572 | 3300032892 | Soil | VQFALVEESVRLPARMAETALELVLATGKRLRIGTGVDAATLRTVLDGLRA |
| Ga0335071_101501234 | 3300032897 | Soil | LVERNARRQERTAEPVLELVLATGERLRIGPAVDVAVLRTVLDVLRG |
| Ga0335071_119972701 | 3300032897 | Soil | LVDSSPRRQESAAEAALELVLATGERLRISAGVDAATLRTVLDVLRA |
| Ga0335084_101857233 | 3300033004 | Soil | PAEAVLELVLATGERLRIGAGVDTTTLRAVLDILRV |
| Ga0335077_101204521 | 3300033158 | Soil | PEWKLELTLLSGERLRIGAGVDGATLRAVLEALRG |
| Ga0335077_102125703 | 3300033158 | Soil | MEAGLELVLATGERLRIGAGVDAATLRTVLEALRG |
| Ga0310914_108669133 | 3300033289 | Soil | GGSARRQERTTHAALELVLTTGERLRIGAGVDAATLRLVLDVLRP |
| Ga0310810_105526633 | 3300033412 | Soil | VRFALVERSVRRQERTAEAPLELVLATGERLRIGTGVDTATLRAVLDVLRA |
| Ga0310810_111855681 | 3300033412 | Soil | RQERTAEAVLELVLATGERLRIGTGVDTATLRTVLDALRA |
| Ga0316620_110458051 | 3300033480 | Soil | PVRFALVERSARRLERTAEPLLELVLTTGERLRIGTGVDTVTLRTVLDVVRV |
| Ga0364935_0232183_469_597 | 3300034151 | Sediment | GARQERRAETVLELVLATGERLHIGAGVDGATLRTVLDALRA |
| Ga0370514_158386_18_161 | 3300034199 | Untreated Peat Soil | LVEKGAVRQAPAPEADLELVLATGERLRIGAGVNATTLRTVLEALRA |
| Ga0372943_0523544_662_775 | 3300034268 | Soil | PATEVGLELVLVTGERLRIGAGVETATLRRVLEALRG |
| ⦗Top⦘ |