Basic Information | |
---|---|
Family ID | F014140 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 265 |
Average Sequence Length | 46 residues |
Representative Sequence | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEK |
Number of Associated Samples | 175 |
Number of Associated Scaffolds | 265 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 4.60 % |
% of genes near scaffold ends (potentially truncated) | 29.81 % |
% of genes from short scaffolds (< 2000 bps) | 67.92 % |
Associated GOLD sequencing projects | 154 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (43.019 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (19.623 % of family members) |
Environment Ontology (ENVO) | Unclassified (49.811 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.377 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.33% β-sheet: 22.67% Coil/Unstructured: 56.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 265 Family Scaffolds |
---|---|---|
PF02467 | Whib | 25.66 |
PF05257 | CHAP | 7.17 |
PF00085 | Thioredoxin | 1.89 |
PF13640 | 2OG-FeII_Oxy_3 | 1.51 |
PF00082 | Peptidase_S8 | 1.51 |
PF06067 | DUF932 | 1.13 |
PF01583 | APS_kinase | 1.13 |
PF05099 | TerB | 0.75 |
PF00166 | Cpn10 | 0.75 |
PF00154 | RecA | 0.75 |
PF14579 | HHH_6 | 0.75 |
PF13662 | Toprim_4 | 0.75 |
PF09834 | DUF2061 | 0.38 |
PF02945 | Endonuclease_7 | 0.38 |
PF00578 | AhpC-TSA | 0.38 |
PF00041 | fn3 | 0.38 |
PF00436 | SSB | 0.38 |
PF13884 | Peptidase_S74 | 0.38 |
PF00210 | Ferritin | 0.38 |
PF13936 | HTH_38 | 0.38 |
PF02075 | RuvC | 0.38 |
PF01844 | HNH | 0.38 |
PF05118 | Asp_Arg_Hydrox | 0.38 |
COG ID | Name | Functional Category | % Frequency in 265 Family Scaffolds |
---|---|---|---|
COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 1.13 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.75 |
COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 0.75 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.38 |
COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 0.38 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.38 |
COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.38 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.89 % |
Unclassified | root | N/A | 18.11 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10000965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 11515 | Open in IMG/M |
3300000756|JGI12421J11937_10000980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 11434 | Open in IMG/M |
3300000756|JGI12421J11937_10121319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300000882|FwDRAFT_10015798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5382 | Open in IMG/M |
3300001282|B570J14230_10039650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1619 | Open in IMG/M |
3300001282|B570J14230_10152684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 659 | Open in IMG/M |
3300002161|JGI24766J26685_10083076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
3300002408|B570J29032_109008788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 565 | Open in IMG/M |
3300002835|B570J40625_100000179 | Not Available | 98877 | Open in IMG/M |
3300002835|B570J40625_100053086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5718 | Open in IMG/M |
3300002835|B570J40625_100085920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4017 | Open in IMG/M |
3300003413|JGI25922J50271_10000794 | Not Available | 9303 | Open in IMG/M |
3300003413|JGI25922J50271_10011588 | All Organisms → cellular organisms → Bacteria | 2363 | Open in IMG/M |
3300003413|JGI25922J50271_10024495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1487 | Open in IMG/M |
3300003413|JGI25922J50271_10046286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300003413|JGI25922J50271_10141626 | Not Available | 503 | Open in IMG/M |
3300003430|JGI25921J50272_10056478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 881 | Open in IMG/M |
3300003650|SLW30_103494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1349 | Open in IMG/M |
3300003654|SLW08_103642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1627 | Open in IMG/M |
3300003654|SLW08_115636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 607 | Open in IMG/M |
3300003986|Ga0063233_10119246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300004112|Ga0065166_10242546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
3300004240|Ga0007787_10032651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2256 | Open in IMG/M |
3300004460|Ga0066222_1435406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300004792|Ga0007761_11298273 | All Organisms → Viruses → Predicted Viral | 1900 | Open in IMG/M |
3300004795|Ga0007756_11587613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 946 | Open in IMG/M |
3300004796|Ga0007763_11486883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300004804|Ga0007796_10101191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 890 | Open in IMG/M |
3300005517|Ga0070374_10073762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1778 | Open in IMG/M |
3300005517|Ga0070374_10188339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1064 | Open in IMG/M |
3300005517|Ga0070374_10273418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
3300005517|Ga0070374_10569888 | Not Available | 563 | Open in IMG/M |
3300005527|Ga0068876_10041290 | All Organisms → cellular organisms → Bacteria | 2844 | Open in IMG/M |
3300005580|Ga0049083_10002666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 6776 | Open in IMG/M |
3300005583|Ga0049085_10146560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300005583|Ga0049085_10303991 | Not Available | 518 | Open in IMG/M |
3300005584|Ga0049082_10045835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1531 | Open in IMG/M |
3300005662|Ga0078894_10036811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4070 | Open in IMG/M |
3300005662|Ga0078894_10093317 | Not Available | 2645 | Open in IMG/M |
3300005662|Ga0078894_10315541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1417 | Open in IMG/M |
3300005662|Ga0078894_10499581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1092 | Open in IMG/M |
3300005662|Ga0078894_10702482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300005662|Ga0078894_10839222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
3300005662|Ga0078894_11166605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300005662|Ga0078894_11271094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 620 | Open in IMG/M |
3300005662|Ga0078894_11418426 | Not Available | 579 | Open in IMG/M |
3300005662|Ga0078894_11489185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 562 | Open in IMG/M |
3300005662|Ga0078894_11514350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300005662|Ga0078894_11623315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 533 | Open in IMG/M |
3300005941|Ga0070743_10000204 | Not Available | 22231 | Open in IMG/M |
3300005941|Ga0070743_10209355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300005942|Ga0070742_10087873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 855 | Open in IMG/M |
3300005942|Ga0070742_10110888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
3300006484|Ga0070744_10001868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 6355 | Open in IMG/M |
3300006484|Ga0070744_10021330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1922 | Open in IMG/M |
3300006641|Ga0075471_10068758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1940 | Open in IMG/M |
3300006805|Ga0075464_10837737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 573 | Open in IMG/M |
3300007551|Ga0102881_1027511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1600 | Open in IMG/M |
3300007559|Ga0102828_1181355 | Not Available | 535 | Open in IMG/M |
3300007560|Ga0102913_1001640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 7319 | Open in IMG/M |
3300007560|Ga0102913_1049192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1377 | Open in IMG/M |
3300007585|Ga0102916_1189547 | Not Available | 558 | Open in IMG/M |
3300007593|Ga0102918_1167869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 663 | Open in IMG/M |
3300007603|Ga0102921_1193159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 733 | Open in IMG/M |
3300007621|Ga0102872_1161503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300007624|Ga0102878_1037129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1509 | Open in IMG/M |
3300007625|Ga0102870_1117759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 770 | Open in IMG/M |
3300007627|Ga0102869_1031617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1489 | Open in IMG/M |
3300007630|Ga0102903_1007259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3135 | Open in IMG/M |
3300007634|Ga0102901_1223394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300007651|Ga0102900_1029035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1153 | Open in IMG/M |
3300007653|Ga0102868_1172353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300007658|Ga0102898_1138784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300007661|Ga0102866_1063823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
3300007706|Ga0102899_1011825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2026 | Open in IMG/M |
3300007708|Ga0102859_1122270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
3300007715|Ga0102827_1157970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 524 | Open in IMG/M |
3300007716|Ga0102867_1018267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1791 | Open in IMG/M |
3300007716|Ga0102867_1050513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1092 | Open in IMG/M |
3300007862|Ga0105737_1202695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300007954|Ga0105739_1125989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300007962|Ga0102907_1061981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1000 | Open in IMG/M |
3300007962|Ga0102907_1086500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 823 | Open in IMG/M |
3300007972|Ga0105745_1166728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 681 | Open in IMG/M |
3300007972|Ga0105745_1241779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300007972|Ga0105745_1283031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300007992|Ga0105748_10304592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300008107|Ga0114340_1026852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2663 | Open in IMG/M |
3300008107|Ga0114340_1139269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1628 | Open in IMG/M |
3300008110|Ga0114343_1001694 | Not Available | 19960 | Open in IMG/M |
3300008110|Ga0114343_1039023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1914 | Open in IMG/M |
3300008113|Ga0114346_1002236 | Not Available | 13137 | Open in IMG/M |
3300008116|Ga0114350_1001270 | Not Available | 20104 | Open in IMG/M |
3300008119|Ga0114354_1234772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 603 | Open in IMG/M |
3300008120|Ga0114355_1008728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5833 | Open in IMG/M |
3300008261|Ga0114336_1005861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 8338 | Open in IMG/M |
3300008953|Ga0104241_1008316 | Not Available | 718 | Open in IMG/M |
3300008961|Ga0102887_1227528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 566 | Open in IMG/M |
3300008961|Ga0102887_1278910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300008962|Ga0104242_1015619 | Not Available | 1326 | Open in IMG/M |
3300008962|Ga0104242_1022312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
3300008962|Ga0104242_1068096 | Not Available | 595 | Open in IMG/M |
3300008964|Ga0102889_1045478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
3300008996|Ga0102831_1195436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300008996|Ga0102831_1259224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300009026|Ga0102829_1116044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 843 | Open in IMG/M |
3300009059|Ga0102830_1085320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 940 | Open in IMG/M |
3300009068|Ga0114973_10020366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4128 | Open in IMG/M |
3300009079|Ga0102814_10367725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
3300009151|Ga0114962_10000028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 108013 | Open in IMG/M |
3300009152|Ga0114980_10735004 | Not Available | 551 | Open in IMG/M |
3300009154|Ga0114963_10000010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 115658 | Open in IMG/M |
3300009158|Ga0114977_10062583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2290 | Open in IMG/M |
3300009158|Ga0114977_10260720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 998 | Open in IMG/M |
3300009159|Ga0114978_10628980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300009161|Ga0114966_10026344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4338 | Open in IMG/M |
3300009161|Ga0114966_10149819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1520 | Open in IMG/M |
3300009163|Ga0114970_10070107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2219 | Open in IMG/M |
3300009164|Ga0114975_10059137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2247 | Open in IMG/M |
3300009180|Ga0114979_10608515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300009181|Ga0114969_10039626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3206 | Open in IMG/M |
3300009181|Ga0114969_10053135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2702 | Open in IMG/M |
3300009181|Ga0114969_10407686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
3300009181|Ga0114969_10597025 | Not Available | 605 | Open in IMG/M |
3300009182|Ga0114959_10005170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 9784 | Open in IMG/M |
3300009183|Ga0114974_10046280 | Not Available | 2935 | Open in IMG/M |
3300009183|Ga0114974_10078884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2148 | Open in IMG/M |
3300009183|Ga0114974_10341901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
3300009194|Ga0114983_1063833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
3300009419|Ga0114982_1000061 | Not Available | 54120 | Open in IMG/M |
3300009419|Ga0114982_1018604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2332 | Open in IMG/M |
3300009419|Ga0114982_1106863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
3300009419|Ga0114982_1117827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300010354|Ga0129333_10127273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2344 | Open in IMG/M |
3300010388|Ga0136551_1020434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1290 | Open in IMG/M |
3300010885|Ga0133913_11343674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1822 | Open in IMG/M |
3300010965|Ga0138308_107274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 7501 | Open in IMG/M |
3300012663|Ga0157203_1001005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 7306 | Open in IMG/M |
3300012663|Ga0157203_1003795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3086 | Open in IMG/M |
3300012665|Ga0157210_1010439 | Not Available | 1644 | Open in IMG/M |
3300012667|Ga0157208_10035558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 671 | Open in IMG/M |
3300012702|Ga0157596_1172629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1308 | Open in IMG/M |
3300012716|Ga0157605_1257711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1933 | Open in IMG/M |
3300012722|Ga0157630_1205213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
3300012731|Ga0157616_1051233 | Not Available | 577 | Open in IMG/M |
3300012733|Ga0157606_1033782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1327 | Open in IMG/M |
3300012764|Ga0157624_1032059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300013004|Ga0164293_10102650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2192 | Open in IMG/M |
3300013005|Ga0164292_10197275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1435 | Open in IMG/M |
3300014050|Ga0119952_1032478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1575 | Open in IMG/M |
3300014050|Ga0119952_1065344 | Not Available | 933 | Open in IMG/M |
3300014050|Ga0119952_1130250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 557 | Open in IMG/M |
3300014819|Ga0119954_1064736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 613 | Open in IMG/M |
3300019784|Ga0181359_1074165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1284 | Open in IMG/M |
3300020048|Ga0207193_1034654 | Not Available | 5702 | Open in IMG/M |
3300020048|Ga0207193_1127175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2216 | Open in IMG/M |
3300020141|Ga0211732_1104188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
3300020141|Ga0211732_1213722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300020141|Ga0211732_1426663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
3300020141|Ga0211732_1581030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2052 | Open in IMG/M |
3300020151|Ga0211736_10278708 | All Organisms → Viruses → Predicted Viral | 1961 | Open in IMG/M |
3300020151|Ga0211736_10664568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1166 | Open in IMG/M |
3300020159|Ga0211734_10203964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1228 | Open in IMG/M |
3300020159|Ga0211734_10204235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
3300020161|Ga0211726_11042234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1454 | Open in IMG/M |
3300020172|Ga0211729_10322662 | Not Available | 531 | Open in IMG/M |
3300020480|Ga0208201_113334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 580 | Open in IMG/M |
3300020497|Ga0208592_1031498 | Not Available | 627 | Open in IMG/M |
3300020498|Ga0208050_1000020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 60220 | Open in IMG/M |
3300020498|Ga0208050_1020215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300020549|Ga0207942_1001606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4220 | Open in IMG/M |
3300020561|Ga0207934_1084958 | Not Available | 521 | Open in IMG/M |
3300021141|Ga0214163_1032914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1460 | Open in IMG/M |
3300021438|Ga0213920_1058977 | Not Available | 779 | Open in IMG/M |
3300021438|Ga0213920_1083991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300021602|Ga0194060_10074661 | Not Available | 1909 | Open in IMG/M |
3300021952|Ga0213921_1054260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300021956|Ga0213922_1018580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1792 | Open in IMG/M |
3300021962|Ga0222713_10457919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
3300021963|Ga0222712_10005510 | Not Available | 12796 | Open in IMG/M |
3300021963|Ga0222712_10026302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4701 | Open in IMG/M |
3300021963|Ga0222712_10500635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300021963|Ga0222712_10623315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300021963|Ga0222712_10770036 | Not Available | 534 | Open in IMG/M |
3300022748|Ga0228702_1035926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1446 | Open in IMG/M |
3300023174|Ga0214921_10000872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 53638 | Open in IMG/M |
3300023174|Ga0214921_10026028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5952 | Open in IMG/M |
3300023174|Ga0214921_10032386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5069 | Open in IMG/M |
3300023174|Ga0214921_10058728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3280 | Open in IMG/M |
3300023174|Ga0214921_10341650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 803 | Open in IMG/M |
3300023179|Ga0214923_10003043 | Not Available | 21450 | Open in IMG/M |
3300023184|Ga0214919_10010667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 11592 | Open in IMG/M |
3300024343|Ga0244777_10000080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 71570 | Open in IMG/M |
3300024343|Ga0244777_10000595 | Not Available | 28235 | Open in IMG/M |
3300024343|Ga0244777_10557877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300024346|Ga0244775_10159241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1903 | Open in IMG/M |
3300024346|Ga0244775_10446083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1061 | Open in IMG/M |
3300024346|Ga0244775_11455728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300024346|Ga0244775_11524879 | Not Available | 510 | Open in IMG/M |
3300025606|Ga0207954_1072452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 891 | Open in IMG/M |
3300027129|Ga0255067_1037712 | Not Available | 691 | Open in IMG/M |
3300027134|Ga0255069_1040581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300027138|Ga0255064_1060839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300027186|Ga0208797_1024191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 807 | Open in IMG/M |
3300027196|Ga0208438_1066651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 587 | Open in IMG/M |
3300027197|Ga0208922_1000037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 47138 | Open in IMG/M |
3300027203|Ga0208925_105431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 926 | Open in IMG/M |
3300027216|Ga0208677_1032033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
3300027219|Ga0208167_1050609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300027227|Ga0208929_1021921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1457 | Open in IMG/M |
3300027231|Ga0208172_1038890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300027239|Ga0208807_1029110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 801 | Open in IMG/M |
3300027241|Ga0208805_1016900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1446 | Open in IMG/M |
3300027258|Ga0208558_1033933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 744 | Open in IMG/M |
3300027314|Ga0208811_1045378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 986 | Open in IMG/M |
3300027320|Ga0208923_1045502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
3300027366|Ga0208556_1102193 | Not Available | 515 | Open in IMG/M |
3300027387|Ga0208311_1041019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
3300027508|Ga0255072_1120778 | Not Available | 510 | Open in IMG/M |
3300027563|Ga0209552_1111237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300027621|Ga0208951_1000004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 115112 | Open in IMG/M |
3300027627|Ga0208942_1016122 | Not Available | 2441 | Open in IMG/M |
3300027644|Ga0209356_1000129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26966 | Open in IMG/M |
3300027679|Ga0209769_1280106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 502 | Open in IMG/M |
3300027710|Ga0209599_10000387 | Not Available | 29316 | Open in IMG/M |
3300027710|Ga0209599_10001317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 12131 | Open in IMG/M |
3300027710|Ga0209599_10006929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3746 | Open in IMG/M |
3300027733|Ga0209297_1000035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 115006 | Open in IMG/M |
3300027733|Ga0209297_1000053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 93676 | Open in IMG/M |
3300027734|Ga0209087_1031775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2519 | Open in IMG/M |
3300027734|Ga0209087_1100319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1229 | Open in IMG/M |
3300027741|Ga0209085_1000015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 115655 | Open in IMG/M |
3300027749|Ga0209084_1000049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 113987 | Open in IMG/M |
3300027754|Ga0209596_1002005 | Not Available | 17000 | Open in IMG/M |
3300027754|Ga0209596_1006293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 8607 | Open in IMG/M |
3300027754|Ga0209596_1007418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 7758 | Open in IMG/M |
3300027754|Ga0209596_1248342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300027757|Ga0208671_10328302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300027769|Ga0209770_10040464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2004 | Open in IMG/M |
3300027769|Ga0209770_10303446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 608 | Open in IMG/M |
3300027770|Ga0209086_10074106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1814 | Open in IMG/M |
3300027772|Ga0209768_10247566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
3300027793|Ga0209972_10180120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
3300027797|Ga0209107_10000565 | Not Available | 21336 | Open in IMG/M |
3300027805|Ga0209229_10139412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
3300027805|Ga0209229_10187285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
3300027805|Ga0209229_10451993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300028025|Ga0247723_1027165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1848 | Open in IMG/M |
3300031784|Ga0315899_11663020 | Not Available | 526 | Open in IMG/M |
3300031857|Ga0315909_10019201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6926 | Open in IMG/M |
3300031857|Ga0315909_10464255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
3300032092|Ga0315905_10005537 | Not Available | 12861 | Open in IMG/M |
3300032092|Ga0315905_10197697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1981 | Open in IMG/M |
3300033816|Ga0334980_0059465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1611 | Open in IMG/M |
3300033992|Ga0334992_0000229 | Not Available | 48211 | Open in IMG/M |
3300033992|Ga0334992_0089312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1666 | Open in IMG/M |
3300034066|Ga0335019_0007243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 7559 | Open in IMG/M |
3300034066|Ga0335019_0043378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3088 | Open in IMG/M |
3300034121|Ga0335058_0054910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2325 | Open in IMG/M |
3300034168|Ga0335061_0136602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1305 | Open in IMG/M |
3300034283|Ga0335007_0189075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1440 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 19.62% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.45% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.68% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.15% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.77% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.77% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.02% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.64% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.26% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.26% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.89% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.89% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.51% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.51% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.51% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.51% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.51% |
Subglacial Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater | 1.13% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.75% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.75% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.38% |
Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.38% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.38% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.38% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.38% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.38% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.38% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300003650 | Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 3.0 micron filter | Environmental | Open in IMG/M |
3300003654 | Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 0.8 micron filter | Environmental | Open in IMG/M |
3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007715 | Estuarine microbial communities from the Columbia River estuary - metaG S.751 | Environmental | Open in IMG/M |
3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
3300007962 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012764 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020480 | Freshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020497 | Freshwater microbial communities from Lake Mendota, WI - 18MAY2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020561 | Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027134 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h | Environmental | Open in IMG/M |
3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
3300027196 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes) | Environmental | Open in IMG/M |
3300027197 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes) | Environmental | Open in IMG/M |
3300027203 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027216 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027219 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027227 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027231 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027239 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027241 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027258 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027314 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027366 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027387 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_1000096526 | 3300000756 | Freshwater And Sediment | MNKYRIKLDVEVEVEAFNPEDASEYIHDIFNIDDEIKKVNIVKMQQK* |
JGI12421J11937_1000098029 | 3300000756 | Freshwater And Sediment | LGVEVEVEAFTSEDASEYIYDIFNVDDEIKKVNIISIKEK* |
JGI12421J11937_101213193 | 3300000756 | Freshwater And Sediment | MDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKAK* |
FwDRAFT_100157985 | 3300000882 | Freshwater And Marine | MKTYLIKLSVDIEIEAFNEDDAKEYLLDIFNVDDEIKKVGIVKIIEK* |
B570J14230_100396504 | 3300001282 | Freshwater | MNKYRIKLDIEVEVEAFNTEDASEYIHDIFNVDDEIKKINVVKISPI |
B570J14230_101526844 | 3300001282 | Freshwater | MNKYRIKLDVEVEVEAFNQEDASEYIHDIFNIDDEIKKVNIVKIITK* |
JGI24766J26685_100830762 | 3300002161 | Freshwater And Sediment | TYKVKLDVEVEVDAFSTEDAADYVHDIFNIDDEIKKVNIINIKEK* |
B570J29032_1090087881 | 3300002408 | Freshwater | KVKLDVEIEVEAFNQEDASEYVHDIFNLDDEIKKVTIVKISQK* |
B570J40625_1000001794 | 3300002835 | Freshwater | MNTYRVKLEVEAEVEAFNETDAKDYVADIFNIDDEIKKVNIIKITEKNK* |
B570J40625_1000530864 | 3300002835 | Freshwater | MNTYKVKLDVEIEVEAFNQEDASEYVHDIFNLDDEIKKVTIVKISQK* |
B570J40625_1000859204 | 3300002835 | Freshwater | MHKYIVKLLVEVEVEAFNLDDATDYIGDIFNIDDEIKKVSISSIKEKK* |
JGI25922J50271_1000079417 | 3300003413 | Freshwater Lake | MNTYTVKLNVELEVQAFNETDAKDYVSDIFNIDDEIKGVNIVKIIQK* |
JGI25922J50271_100115885 | 3300003413 | Freshwater Lake | MNKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKINVVKISPINH* |
JGI25922J50271_100244954 | 3300003413 | Freshwater Lake | MNKYRIKLDVEVEVEAFNTEDATEYIHDIFNIDDEIKKVNIVK |
JGI25922J50271_100462863 | 3300003413 | Freshwater Lake | MNKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKVNIVKITTK* |
JGI25922J50271_101416263 | 3300003413 | Freshwater Lake | TYRVKLEVEAEVEAFNETDAKDYVADIFNIDDEIKKVNIIKITEKNK* |
JGI25921J50272_100564784 | 3300003430 | Freshwater Lake | MNTYTVKLNVELEVQAFNETDAKDYVSDIFNVDDEIXGVNIVKIIQK* |
SLW30_1034943 | 3300003650 | Subglacial Freshwater | MNTYIVKLNVSLEVNAFNEDDAKEYVSDIFSVDDEIKAVNIVKIQQK* |
SLW08_1036425 | 3300003654 | Subglacial Freshwater | MNTYIVKLNVSLEVMAFNEEDAKEYVSDIFSIDDEIKSVVIVKIHQK* |
SLW08_1156361 | 3300003654 | Subglacial Freshwater | SMNTYTVKLNVSLEVVAFNEEDAKEYVSDIFSVDDEIKSVNIVKIQQK* |
Ga0063233_101192461 | 3300003986 | Freshwater Lake | MNTYKVKLNVELEVQAFNETDAKDYVSDIFNIDDEIKGVNIVKII |
Ga0065166_102425462 | 3300004112 | Freshwater Lake | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVSIVKITEKK* |
Ga0007787_100326518 | 3300004240 | Freshwater Lake | MNTYKVKLEVEAEVEAFNETDARDYVADIFNVDDEIKKVNIIKITEKNK* |
Ga0066222_14354062 | 3300004460 | Marine | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVSIVKITEKNK* |
Ga0007761_112982734 | 3300004792 | Freshwater Lake | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNILKITEKNK* |
Ga0007756_115876132 | 3300004795 | Freshwater Lake | MNKYRIKLDVEVEVEAFNTEDATEYIHDIFNIDDEIKKVNIVKITTK* |
Ga0007763_114868833 | 3300004796 | Freshwater Lake | MNKYRIKLDIEVEVEAFNTEDASEYIHDIFNVDDEIKKINVV |
Ga0007796_101011912 | 3300004804 | Freshwater | MNSYKIKLDVEIEVDAFNQEDAAEYVHDIFNIDDEIKSINIVRIIEK* |
Ga0070374_100737624 | 3300005517 | Freshwater Lake | MNKYRIKLDVEVEVEAFNPEDASEYIHDIFNIDDEIKKVNIVKITTK* |
Ga0070374_101883393 | 3300005517 | Freshwater Lake | MNTYKVKMDVELEVTAFNETDARDYVGDIFNVDDEIKKVNIVKITEKTK* |
Ga0070374_102734183 | 3300005517 | Freshwater Lake | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKNK* |
Ga0070374_105698882 | 3300005517 | Freshwater Lake | MNTYKVKLNVELEVQAFNETDAKDYVSDIFNIDDEIKGVNIVKIIQK* |
Ga0068876_100412905 | 3300005527 | Freshwater Lake | MNIYKVSLEVEVEVEAFTSEDASEYIYDIFNVDDEIKKVNIVSIKEK* |
Ga0049083_1000266616 | 3300005580 | Freshwater Lentic | MNTYKVKLDVEIEVEAFNQEDASEYVHDIFNLDDEIKKVSIVKISQK* |
Ga0049085_101465602 | 3300005583 | Freshwater Lentic | KSMHNYVVKLNVEVEVQAFDESDAKDYVGDIFNIDDEIKKVTINSIKEK* |
Ga0049085_103039911 | 3300005583 | Freshwater Lentic | MNTYKVKLDVEIEVEAFNQEDASEYVHDIFNLDDEIKKVNIVKIIEK* |
Ga0049082_100458354 | 3300005584 | Freshwater Lentic | MNNYVVKLNVEVEVQAFDESDAKDYVGDIFNIDDEIKKVTINSIKEK* |
Ga0078894_100368116 | 3300005662 | Freshwater Lake | MNTYTVKLNVELEVQAFNEADAKDYVSDIFNVDEEIKGVNIVKIIQK* |
Ga0078894_100933175 | 3300005662 | Freshwater Lake | MNKYRIKLEVEVEVEAFNSQDASEYIHDIFNIDDEIKKVTISSIKEQQK* |
Ga0078894_103155414 | 3300005662 | Freshwater Lake | MNKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKI |
Ga0078894_104995814 | 3300005662 | Freshwater Lake | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKAK* |
Ga0078894_107024822 | 3300005662 | Freshwater Lake | MNTYTVKLNVELEVQAFNETDAKDYVSDIFNVDDEIKGVNIVKIIQK* |
Ga0078894_108392223 | 3300005662 | Freshwater Lake | MNKYRIKLDIEVEVEAFNTEDASEYIHDIFNVDDEIKKINVVKISPINH* |
Ga0078894_111666052 | 3300005662 | Freshwater Lake | VNTYKVKLEVEAEVEAFNETDARDYVADIFNIDDEIKKVNIIKITEKNK* |
Ga0078894_112710944 | 3300005662 | Freshwater Lake | EAFNETDAKDYVADIFNIDDEIKKVNIIKITEKNK* |
Ga0078894_114184263 | 3300005662 | Freshwater Lake | MNTYTVKLNVELEVQAFNETDAKDYVSDIFNVDEEIKGVNIVKIIQK* |
Ga0078894_114891851 | 3300005662 | Freshwater Lake | TYKVKLDVEIEVEAFNQEDASEYVHDIFNLDDEIKKVNIVKIAQK* |
Ga0078894_115143503 | 3300005662 | Freshwater Lake | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEK |
Ga0078894_116233152 | 3300005662 | Freshwater Lake | EVEAFNLDDATDYIGDIFNIDDEIKKVSISSIKEKK* |
Ga0070743_1000020434 | 3300005941 | Estuarine | MNKYRIKLDVEVEVEAFNAEDASEYIHDIFNIDDEIKKVNIIKITNK* |
Ga0070743_102093552 | 3300005941 | Estuarine | MNTYKVKLDVEVEVDAFSTDDAADYVHDIFNIDDEIKKVNIINIKEK* |
Ga0070742_100878731 | 3300005942 | Estuarine | VELEVTAFNETDARDYVGDIFNIDDEIKKVNILKITEKNK* |
Ga0070742_101108881 | 3300005942 | Estuarine | MNTYTVKLNVELEVQAFNETDAKDYVSDIFNIDDEIK |
Ga0070744_1000186817 | 3300006484 | Estuarine | MNKYRIKLDIEVEVEAFNTEDANEYIHDIFNIDDEIKKINVVKISQINH* |
Ga0070744_100213302 | 3300006484 | Estuarine | MHNYVVKLNVEVEVQAFDESDAKDYVGDIFNIDDEIKKVTINSIKEK* |
Ga0075471_100687582 | 3300006641 | Aqueous | MNTYKIKLDVEVEVQAFNENDASDYVSDIFSVDDEIKNIKINSIKEK* |
Ga0075464_108377371 | 3300006805 | Aqueous | LEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKNK* |
Ga0102881_10275111 | 3300007551 | Estuarine | KMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNILKITEKNK* |
Ga0102828_11813552 | 3300007559 | Estuarine | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKTK* |
Ga0102913_100164012 | 3300007560 | Estuarine | MNKYRIKLDVEVEVEAFNAEDASEYIHDIFNIDDEIKKVNIIKITSK* |
Ga0102913_10491921 | 3300007560 | Estuarine | TYTVKLNVELEVQAFNETDAKDYVSDIFNVDEEIKGVNIVKIIQK* |
Ga0102916_11895471 | 3300007585 | Estuarine | TYTVKLNVELEVQAFNETDAKDYVSDIFNIDDEIKGVNIVKIIQK* |
Ga0102918_11678691 | 3300007593 | Estuarine | MNKYRIKLDIEVEVEAFNAEDASEYIHDIFNIDDEIKKINVVKISPINH* |
Ga0102921_11931594 | 3300007603 | Estuarine | MNKYRIKLDVEVEVEAFNIEDASEYIHDIFNIDDEIKKVNIVKITTK* |
Ga0102923_12845791 | 3300007606 | Estuarine | DIEIEAFNEDDAKEYLLDIFNVDDEIKKVGIVKIIEK* |
Ga0102872_11615032 | 3300007621 | Estuarine | MNTYKVKMDVELEVTAFNETDARDYVGDIFNVDDEIKKVNIVKITEKNK* |
Ga0102878_10371291 | 3300007624 | Estuarine | MNKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDAIKKINVVKISPLNH* |
Ga0102870_11177591 | 3300007625 | Estuarine | NKYRIKLDVEVEVEAFNPEDASEYIHDIFNIDDEIKKVNIVKITTK* |
Ga0102869_10316171 | 3300007627 | Estuarine | MNTYKVKLSVELEVDAFDDTDARDYITDIFNIDDEIKSVNIV |
Ga0102903_10072591 | 3300007630 | Estuarine | YRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKINVVKISPINH* |
Ga0102901_12233941 | 3300007634 | Estuarine | MNTYTVKLNVELEVQAFNETDAKDYVSDIFNIDDEIKGVNIVKII |
Ga0102900_10290356 | 3300007651 | Estuarine | RIKLDVEVEVKAFNTEDASEYIHDIFNIDDEIKKINVVKISPINH* |
Ga0102868_11723531 | 3300007653 | Estuarine | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNILKIT |
Ga0102898_11387843 | 3300007658 | Estuarine | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITE |
Ga0102866_10638233 | 3300007661 | Estuarine | MNKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKISVVKISPINH* |
Ga0102899_10118251 | 3300007706 | Estuarine | MNKYRIKLDVEVEVEAFNAEDAREDIHDIFNIDDEIKKVNIIKITSK* |
Ga0102859_11222703 | 3300007708 | Estuarine | MNKYRIKLDVEVEVEAFNVEDASEYIHDIFNIDDEIKKVNIVKITTK* |
Ga0102827_11579701 | 3300007715 | Estuarine | YRIKLDVEVEVEAFNAEDASEYIHDIFNIDDEIKKVNIIKITNK* |
Ga0102867_10182676 | 3300007716 | Estuarine | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIIKITNK* |
Ga0102867_10505135 | 3300007716 | Estuarine | MNKYRIKLDVEVEVEAFNAEDASEYIHDMFNIDVGVKKG |
Ga0105737_12026953 | 3300007862 | Estuary Water | MNKYRIKLDIEVEVEAFNTEDANEYIHDIFNIDDEIKKINVV |
Ga0105739_11259892 | 3300007954 | Estuary Water | MNTYRVKLEVEAEVEAFNETDAKDYVADIFNIDDEIKKVNIIKITEK |
Ga0102907_10619811 | 3300007962 | Estuarine | MNKYRIKLDVEVEVEAFNAEDASEYIHDIFNIDDEIKKVNIIK |
Ga0102907_10865001 | 3300007962 | Estuarine | NKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKINVVKISPINH* |
Ga0105745_11667282 | 3300007972 | Estuary Water | MNKYSIKLNVEVEVEAFNAEDAADYIHDIFNIDDEIKKINIVKISQK* |
Ga0105745_12417792 | 3300007972 | Estuary Water | MDVELEVTAFNETDARDYVGDIFNIDDEIKKVNILKITEKNK* |
Ga0105745_12830313 | 3300007972 | Estuary Water | MNTYTVKLNVELEVQAFNETDAKDYVSDIFNIDDEIKGVN |
Ga0105748_103045923 | 3300007992 | Estuary Water | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNILKITEKN |
Ga0114340_10268522 | 3300008107 | Freshwater, Plankton | MNSYSVKLNVELEIQAFDETDARDYALDILNVDDEIKTVNIVKIKKV* |
Ga0114340_11392693 | 3300008107 | Freshwater, Plankton | MKTYLIKLSVDIEIEAFNEDDAKEYLSDIFNIDDEIKKVGIVKIIEK* |
Ga0114343_100169431 | 3300008110 | Freshwater, Plankton | MNTYRVKLDVEVEVQAFNQQDAEDYVHDIFNVDDEIKSVSILKVKEK* |
Ga0114343_10390238 | 3300008110 | Freshwater, Plankton | MNTYKVKMDVELEVIAFSENDARDYVGDIFNIDDEIKKVNIIKITEKNK* |
Ga0114346_100223631 | 3300008113 | Freshwater, Plankton | MKTYLAKLSVEVEIEAFNETDAMDYVSDIFNIDDEIKKVNIVKIIEKNR* |
Ga0114346_10285761 | 3300008113 | Freshwater, Plankton | EIEAFNEDDAKEYLSDIFNIDDEIKKVGIVKIIEK* |
Ga0114350_100127037 | 3300008116 | Freshwater, Plankton | MNKYIVQLSVEIEVEAFNSDDALEYIQDIFSVDDEIKKVSINKISPK* |
Ga0114354_12347723 | 3300008119 | Freshwater, Plankton | MHKYIVKLLVEVEVEAFNLDDATDYIGDIFNIDDEIKKVNISSIKEKK* |
Ga0114355_100872810 | 3300008120 | Freshwater, Plankton | MNKYIVQLSVEIEVEAFNSDDALEYVQDIFSIDDEIKKVSINKISPK* |
Ga0114336_10058614 | 3300008261 | Freshwater, Plankton | MNRYFIKMEIEVEVDAFNTEDAKEYINDIFNIDDEIKKVNIVKITTK* |
Ga0104241_10083162 | 3300008953 | Freshwater | MNTYKVKMDVELEATAFNETDARDYVGDIFNIDDEIKKVNIVKITEKSK* |
Ga0102887_12275281 | 3300008961 | Estuarine | MNKYRIKLDVEVEVEAFNAEDASEYIHDIFNIDDEIKKVNLVKITTK* |
Ga0102887_12789103 | 3300008961 | Estuarine | MNTYTVKLNVELEVQAFNETDAKDYVSDIFNVDEEI |
Ga0104242_10156194 | 3300008962 | Freshwater | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKSK* |
Ga0104242_10223122 | 3300008962 | Freshwater | MNTYKVKLSVEVEVEAFNEADARDYVGDIFNIDDEIKHVNIVKILEK* |
Ga0104242_10680963 | 3300008962 | Freshwater | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKI |
Ga0102889_10454784 | 3300008964 | Estuarine | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVK |
Ga0102831_11954361 | 3300008996 | Estuarine | MNTYKVKLSVELEVDAFDDTDARDYITDIFNIDDEIKSVNIVKIQQK* |
Ga0102831_12592242 | 3300008996 | Estuarine | MNTYKVKLDVEVEVDAFNSEDAADYVHDIFNVDDEIKKVSIVNIKEK* |
Ga0102829_11160444 | 3300009026 | Estuarine | AFNETDARDYVGDIFNIDDEIKKVNILKITEKNK* |
Ga0102830_10853202 | 3300009059 | Estuarine | MNKYRIKLDVEVEVEAFNQEDATEYIYDIFNIDDEIKKVNIVKITTK* |
Ga0114973_100203661 | 3300009068 | Freshwater Lake | MNKYRIKLDIEVEVEAFNTEDASEYIHDIFNIDDEIKKINVVKISPINH* |
Ga0102814_103677252 | 3300009079 | Estuarine | MNKYRIKLDVEVEVEAFNTEDASEYIHDIFNLDDEIKKINIVKISPINH* |
Ga0114962_10000028128 | 3300009151 | Freshwater Lake | MNNYSVKLNVELEISAFNLEDASEYVHDIFNIDDEIKKVSIVKIQENK* |
Ga0114980_107350042 | 3300009152 | Freshwater Lake | MNTYRVKLDVEIEVEAFNEADAKDYVGDIFNIDDEIKSVNIIKIREK* |
Ga0114963_10000010178 | 3300009154 | Freshwater Lake | MNKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKVNIVKITNK* |
Ga0114977_100625835 | 3300009158 | Freshwater Lake | MNKYSIKLDIEVEVEAFNSEDAKEYIHDIFNIDDEIKKVNILKIITK* |
Ga0114977_102607202 | 3300009158 | Freshwater Lake | MNTYKVKLNVEVEVEAFNEEDAREYIGDIFNIDDEIKSVNITKIQEN* |
Ga0114978_106289802 | 3300009159 | Freshwater Lake | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDAEIKKVNIVKITEKK* |
Ga0114966_100263444 | 3300009161 | Freshwater Lake | MNKYRIKLDVEVEVEAFNAEDASEYIHDIFNIDDEIKKINIIKITSK* |
Ga0114966_101135839 | 3300009161 | Freshwater Lake | EVQAFNETDAKDYVSDIFNVDDEIKGVNIVKIIQK* |
Ga0114966_101498192 | 3300009161 | Freshwater Lake | MNKYRIKLDVEVEVEAFNPEDASEYIHDIFNIDDEIKKVNIVKIITK* |
Ga0114970_100701071 | 3300009163 | Freshwater Lake | YKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKNK* |
Ga0114975_100591373 | 3300009164 | Freshwater Lake | MNTYKVKMDVELEVAAFNETDARDYVGDIFNIDDEIKKVNIVKITEKNK* |
Ga0114979_106085151 | 3300009180 | Freshwater Lake | MNKYRIKLDVEVEVEAFNPEDASEYIHDIFNIDDEIKKVN |
Ga0114969_100396264 | 3300009181 | Freshwater Lake | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVTIVKITEKNK* |
Ga0114969_100531354 | 3300009181 | Freshwater Lake | MNKYRIKLDVEVEVEAFNSEDASEYIHDIFNIDDEIKKVNIVKITSK* |
Ga0114969_104076862 | 3300009181 | Freshwater Lake | MNTYKVKLELEAHIEAFNEDDVRDYISDIMGIDEEFK |
Ga0114969_105970253 | 3300009181 | Freshwater Lake | MHNYVVKLNVEVEVQAFDESDARDYVGDIFNIDDEIKKVTINNIREK* |
Ga0114959_1000517019 | 3300009182 | Freshwater Lake | MNTYKVKMDVESEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKNK* |
Ga0114974_100462803 | 3300009183 | Freshwater Lake | MNIYKVSLGVEVEVEAFTSEDASEYIYDIFNVDDEIKKVNIISIKEK* |
Ga0114974_100788842 | 3300009183 | Freshwater Lake | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKK* |
Ga0114974_103419012 | 3300009183 | Freshwater Lake | MNTYKVKLNVEVEVEAFNEQDAREYISDIFNIDDEIKSVNITKIQEK* |
Ga0114983_10638333 | 3300009194 | Deep Subsurface | MNTYKVKLEVEAEVEAFNETDARDYVGDIFNIDDEIKKVNIIKIT |
Ga0114982_100006122 | 3300009419 | Deep Subsurface | MNKYRIKLDVEVEVEAFNSEDAGEYIHDIFNIDDEIKKVNIVKIQQK* |
Ga0114982_10186046 | 3300009419 | Deep Subsurface | MNTYKVKLEVEAEVEAFNETDARDYVGDIFNIDDEIKKVNIIKITEKSK* |
Ga0114982_11068633 | 3300009419 | Deep Subsurface | MNTYKVKLDVEVEVDAFNSEDAADYVHDIFNIDDEIKKVNIVNIKEK* |
Ga0114982_11178273 | 3300009419 | Deep Subsurface | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNITKITEKSK* |
Ga0129333_101272732 | 3300010354 | Freshwater To Marine Saline Gradient | MKSYLVKLSVELEVQAFNEDDAKDYVLDILNVDEEIKSVNIVKIKEK* |
Ga0136551_10204342 | 3300010388 | Pond Fresh Water | MKFYKVSLEVEVEVEAFTSEDASEYIHDIFNIDDEIKKVTIVKLREK* |
Ga0133913_113436742 | 3300010885 | Freshwater Lake | MNTYIVKMSVELEVQAFNETDARDYIGDIFNTDDEIKNIDILKIKQK* |
Ga0138308_1072744 | 3300010965 | Lake Chemocline | MNKYSIKLDIEVEVEAFNAEDAQEYIHDIFNIDDEIKKVNIVKITNK* |
Ga0157203_10010054 | 3300012663 | Freshwater | MHKYIVKLVVEVEVEAFNLDDATDYIGDIFNIDDEIKKVSISSIKEKK* |
Ga0157203_100379511 | 3300012663 | Freshwater | MNTYKVKLSVEIEIDAFDETDARDYVTDIFNIDDEIKTVNIVKIQQK* |
Ga0157210_10104394 | 3300012665 | Freshwater | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNILKITEKTK* |
Ga0157208_100355581 | 3300012667 | Freshwater | MNNYRIKLEVEVEVEAFNPEDASEYIHDIFNIDDEIKKINIVNIKQTNK* |
Ga0157596_11726291 | 3300012702 | Freshwater | MNTYRVKLEVEAEVEAFNETDAKDYVSDIFNIDDEIKKVNIIKITEKNK* |
Ga0157605_12577114 | 3300012716 | Freshwater | MNTYRVKLEVEAEVEAFNETDAKDYVSDIFNIDDEIKKVNIIKITEKKQIKSLTEP* |
Ga0157630_12052133 | 3300012722 | Freshwater | MNTYRVKLEVEAEVEAFNETDAKDYVSDIFNIDDEIKKVNIIK |
Ga0157616_10512332 | 3300012731 | Freshwater | MNTYKVKLEVEAEVEAFNETDARDYVADIFNIDDEIKKVNIIKITEKNK* |
Ga0157606_10337824 | 3300012733 | Freshwater | MNTYRVKLEVEAEVEAFNETDAKDYVSDIFNIDDEIKKVNIIKITEKN |
Ga0157624_10320592 | 3300012764 | Freshwater | MNTYRVKLEVEAEVEAFNETDAKDYVADIFNIDEEIKKFNIIKITEKNK* |
Ga0164293_101026506 | 3300013004 | Freshwater | MNTYKVKLEVEAEVEAFNETDARDYVADIFNIDDEIKKVNIIKITEKAK* |
Ga0164292_101972751 | 3300013005 | Freshwater | VEAEVEAFNETDAKDYVADIFNIDDEIKKVNIIKITEKNK* |
Ga0119952_10324783 | 3300014050 | Freshwater | MNTYKVKMDVELEVIAFSETDARDYVGDIFNTDDEIKKVNIIKIIEKTK* |
Ga0119952_10653441 | 3300014050 | Freshwater | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKIK* |
Ga0119952_11302502 | 3300014050 | Freshwater | MKTYLAKLSVDIEIEAFNETDAMDYVSDIFNVDDEIKKVSIIKIIEKNR* |
Ga0119954_10647364 | 3300014819 | Freshwater | TAFNETDARDYVGDIFNIDDEIKKVNIVKITEKNK* |
Ga0181359_10741654 | 3300019784 | Freshwater Lake | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNILKITEKNK |
Ga0207193_103465416 | 3300020048 | Freshwater Lake Sediment | MNTYKVKLEVEAEVEAFNETDARDYVADIFNVDDEIKKVNIIKITEKNK |
Ga0207193_11271755 | 3300020048 | Freshwater Lake Sediment | MNKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKVNIVKITTK |
Ga0211732_11041881 | 3300020141 | Freshwater | MDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKAK |
Ga0211732_12137222 | 3300020141 | Freshwater | MNTYRVKLSVEIEIDAFNETDARDYVTDIFNIDDEIKTVNIVKIQQK |
Ga0211732_14266632 | 3300020141 | Freshwater | MNTYKVKLDVEVEVDAFNSEDAADYVHDIFNIDDEIKKVNIVNIKEK |
Ga0211732_15810308 | 3300020141 | Freshwater | MNTYKVKLDVEIEVEAFNQEDASEYVHDIFNLDDEIKKVSIVKIAQK |
Ga0211736_102787084 | 3300020151 | Freshwater | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKK |
Ga0211736_106645682 | 3300020151 | Freshwater | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKIK |
Ga0211734_102039642 | 3300020159 | Freshwater | MDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKK |
Ga0211734_102042353 | 3300020159 | Freshwater | MNTYKVKINVELEVQAFNETDAKDYVSDIFNIDDEIKGVNIVKIIQK |
Ga0211726_110422342 | 3300020161 | Freshwater | MDVELEVTAFNETDARDYVGDIFNIDDEIKKVSIVKITEKK |
Ga0211729_103226622 | 3300020172 | Freshwater | MNTYKVKINVELEVQAFNETDAKDYVSDIFNVDDEIKGVNIVKIIQK |
Ga0208201_1133343 | 3300020480 | Freshwater | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKNK |
Ga0208592_10314981 | 3300020497 | Freshwater | MNTYKVKLDVEIEVEAFNQEDASEYVHDIFNLDDEIKKVTIVKISQK |
Ga0208050_100002044 | 3300020498 | Freshwater | MNKYRIKLDIEVEVEAFNTEDASEYIHDIFNVDDEIKKINVVKISPINH |
Ga0208050_10202152 | 3300020498 | Freshwater | MNTYRVKLEVEAEVEAFNETDAKDYVADIFNIDDEIKKVNIIKITEKNK |
Ga0207942_100160610 | 3300020549 | Freshwater | MHKYIVKLLVEVEVEAFNLDDATDYIGDIFNIDDEIKKVSISSIKEKK |
Ga0207934_10849582 | 3300020561 | Freshwater | MNTYKVKLNVEVEVEAFNEEDAREYIGDIFNIDDEIKSVNITKIQEN |
Ga0214163_10329144 | 3300021141 | Freshwater | MNKYRIKLDIEVEVEAFNTEDASEYIHDIFNVDDEIKKINVVK |
Ga0213920_10589773 | 3300021438 | Freshwater | MNTYKVKLDVEVEVQAFNPEDAEDYVHDIFNVDDEIKSVTIVKIKEK |
Ga0213920_10839912 | 3300021438 | Freshwater | MNTYKAKLNIEVEIEAFSEDDAREYISDIFNVDDEVKSVNITSIMEK |
Ga0194060_100746613 | 3300021602 | Anoxic Zone Freshwater | MNKYSVKLSVEVEVEAFNETDATDYVHDIFNIDDEIKKVDITKIVQK |
Ga0213921_10542601 | 3300021952 | Freshwater | MNTYKVKLNVEVEVEAFNEEDAREYIGDIFNVDDEIKSVNITKIQEK |
Ga0213922_10185801 | 3300021956 | Freshwater | MNTYKVKLDVEIEVEAFNQEDASEYVHDIFNLDDEIKKVNIVKIAQ |
Ga0222713_102396341 | 3300021962 | Estuarine Water | MKTYLIKLSVDIEIEAFNEDDAKEYLLDIFNVDDEIKKVGIVKIIEK |
Ga0222713_104579192 | 3300021962 | Estuarine Water | MNTYKVKLDVEVEVDAFSTDDAADYVHDIFNIDDEIKKVNIINIKEK |
Ga0222712_1000551020 | 3300021963 | Estuarine Water | MDRYRIKLDVEVEVEAFNPEDASEYINDIFNIDDEIKKVNIVKITKK |
Ga0222712_1002630210 | 3300021963 | Estuarine Water | MNKYRIKLDVEVEVEAFNAEDASEYIHDIFNIDDEIKKVNIIKITNK |
Ga0222712_105006352 | 3300021963 | Estuarine Water | MNKYSIKLDVEVEVEAFNSEDASEYIHDIFNIDDEIKKVSIVKITTK |
Ga0222712_106233151 | 3300021963 | Estuarine Water | MDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKI |
Ga0222712_107700363 | 3300021963 | Estuarine Water | MNKYRIKLDIEVEVEAFNAEDASEYIHDIFNIDDEIKK |
Ga0228702_10359266 | 3300022748 | Freshwater | MNTYKVKMDVELEVIAFSETDARDYVGDIFNTDDEIKKVNIIKIVEKTK |
Ga0214921_1000087249 | 3300023174 | Freshwater | MNTYKVKLSVEVEVEAFNEADARDYVGDIFNIDDEIKHVNIVKILEK |
Ga0214921_100260282 | 3300023174 | Freshwater | MNTYKVKLDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIIKITEKNK |
Ga0214921_1003238615 | 3300023174 | Freshwater | VTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKNK |
Ga0214921_100587282 | 3300023174 | Freshwater | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIVKITEKAK |
Ga0214921_103416505 | 3300023174 | Freshwater | MNKYRIKLDIEVEVEAFNTEDANEYIHDIFNIDDEIKKINVVKISPINH |
Ga0214923_1000304319 | 3300023179 | Freshwater | MNTYKIKLDVEIEVQAFNENDASDYVNDIFSVDDEIKNIKINSIKEK |
Ga0214919_100106674 | 3300023184 | Freshwater | MNTYRVKLDVEIEVEAFNEADAKDYVGDIFNIDDEIKSVNIIKIREK |
Ga0244777_1000008075 | 3300024343 | Estuarine | MNTYTVKLNVELEVQAFNETDAKDYVSDIFNVDEEIKGVNIVKIIQK |
Ga0244777_1000059540 | 3300024343 | Estuarine | MNKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKINVVKISPINH |
Ga0244777_105578772 | 3300024343 | Estuarine | MNTYTVKLNVELEVQAFNETDAKDYVSDIFNIDDEIKGVNIVKIIQK |
Ga0244775_101592412 | 3300024346 | Estuarine | MHNYVVKLNVEVEVQAFDESDAKDYVGDIFNIDDEIKKVTINSIKEK |
Ga0244775_104460834 | 3300024346 | Estuarine | VEIEVEAFNQEDASEYVHDIFNLDDEIKKVSIVKISQK |
Ga0244775_114557281 | 3300024346 | Estuarine | MNTYKVKLSVELEVDAFDDTDARDYITDIFNIDDEIKSVNIVKIQQK |
Ga0244775_115248792 | 3300024346 | Estuarine | MNTYKVKMDVELEVTAFNETDARDYVGDIFNVDDEIKKVNIVKITEKTK |
Ga0207954_10724522 | 3300025606 | Freshwater | MNSYKIKLDVEIEVDAFNQEDAAEYVHDIFNIDDEIKSINIVRIIEK |
Ga0255067_10377123 | 3300027129 | Freshwater | MNTYKVKLSVDVEIDAFDETDAKDYITDIFNIDDEIKSVNIVKIQQK |
Ga0255069_10405813 | 3300027134 | Freshwater | MNTYTVKLNVELEVQAFNETDAKDYVSDIFNIDDEIKGVNIV |
Ga0255064_10608391 | 3300027138 | Freshwater | MDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIL |
Ga0208797_10241911 | 3300027186 | Estuarine | VEVEVEAFNPEDASEYIHDIFNIDDEIKKVNIVKITTK |
Ga0208438_10666514 | 3300027196 | Estuarine | TMNKYRIKLDVEVEVEAFNPEDASEYIHDIFNIDDEIKKVNIVKITTK |
Ga0208922_100003756 | 3300027197 | Estuarine | MNKYRIKLDVEVEVEAFNAEDASEYIHDIFNIDDEIKKV |
Ga0208925_1054314 | 3300027203 | Estuarine | MNKYRIKLDIEVEVEAFNTEDANEYIHDIFNIDDEIKKINVVKISQINH |
Ga0208677_10320331 | 3300027216 | Estuarine | MNKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKISVVKISPINH |
Ga0208167_10506091 | 3300027219 | Estuarine | MNKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKINVV |
Ga0208929_10219211 | 3300027227 | Estuarine | MNKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKIN |
Ga0208172_10388904 | 3300027231 | Estuarine | MNTYTVKLNVELEVQAFNETDAKDYVSDIFNVDEEIKGVNIVK |
Ga0208807_10291101 | 3300027239 | Estuarine | CYNYLMNKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKINVVKISPINH |
Ga0208805_10169001 | 3300027241 | Estuarine | MDVELEVTAFNETDARDYVGDIFNIDDEIKKVNILKIT |
Ga0208558_10339331 | 3300027258 | Estuarine | MNTYTVKLNVELEVQAFNEADAKDYVSDIFNVDEEIKGVNIVKIIQK |
Ga0208811_10453785 | 3300027314 | Estuarine | KLNVELEVQAFNETDAKDYVSDIFNIDDEIKGVNIVKIIQK |
Ga0208923_10455022 | 3300027320 | Estuarine | YTRSMHNYVVKLNVEVEVQAFDESDAKDYVGDIFNIDDEIKKVTINSIKEK |
Ga0208556_11021933 | 3300027366 | Estuarine | LNVELEVQAFNETDAKDYVSDIFNVDEEIKGVNIVKIIQK |
Ga0208311_10410194 | 3300027387 | Estuarine | MDVELEVTAFNETDARDYVGDIFNIDDEIKKVNILKITEKNK |
Ga0255072_11207783 | 3300027508 | Freshwater | MNTYKVKLSVDVEIDAFDETDAKDYITDIFNIDDEIK |
Ga0209552_11112373 | 3300027563 | Freshwater Lake | MNTYKVKLNVELEVQAFNETDAKDYVSDIFNIDDEIKGVNIVKIIQK |
Ga0208951_1000004180 | 3300027621 | Freshwater Lentic | MNTYKVKLDVEIEVEAFNQEDASEYVHDIFNLDDEIKKVSIVKISQK |
Ga0208942_10161221 | 3300027627 | Freshwater Lentic | MNTYKVKMDVELEVTAFNETDARDYVGDIFNVDDEIKKVNIVKIT |
Ga0209356_100012942 | 3300027644 | Freshwater Lake | MNKYRIKLDVEVEVEAFNPEDASEYIHDIFNIDDEI |
Ga0209769_12801061 | 3300027679 | Freshwater Lake | VEVEAFNTEDASEYIHDIFNIDDEIKKINVVKISPINH |
Ga0209599_1000038716 | 3300027710 | Deep Subsurface | MNKYRIKLDVEVEVEAFNSEDAGEYIHDIFNIDDEIKKVNIVKIQQK |
Ga0209599_1000131731 | 3300027710 | Deep Subsurface | MDVELEVTAFNETDARDYVGDIFNIDDEIKKVNITKITEKSK |
Ga0209599_100069296 | 3300027710 | Deep Subsurface | MNTYKVKLEVEAEVEAFNETDARDYVGDIFNIDDEIKKVNIIKITEKSK |
Ga0209297_1000035149 | 3300027733 | Freshwater Lake | MNKYSIKLDIEVEVEAFNSEDAKEYIHDIFNIDDEIKKVNILKIITK |
Ga0209297_100005358 | 3300027733 | Freshwater Lake | MNKYRIKLDIEVEVEAFNTEDASEYIHDIFNIDDEIKKINVVKISPINH |
Ga0209087_10317752 | 3300027734 | Freshwater Lake | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVSIVKITEKNK |
Ga0209087_11003193 | 3300027734 | Freshwater Lake | MNTYKVKMDVELEVAAFNETDARDYVGDIFNIDDEIKKVNIVKITEKNK |
Ga0209085_10000154 | 3300027741 | Freshwater Lake | MNKYRIKLDVEVEVEAFNTEDASEYIHDIFNIDDEIKKVNIVKITNK |
Ga0209084_100004938 | 3300027749 | Freshwater Lake | MNNYSVKLNVELEISAFNLEDASEYVHDIFNIDDEIKKVSIVKIQENK |
Ga0209596_10020052 | 3300027754 | Freshwater Lake | MHNYVVKLNVEVEVQAFDESDARDYVGDIFNIDDEIKKVTINNIREK |
Ga0209596_100629316 | 3300027754 | Freshwater Lake | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDEIKKVTIVKITEKNK |
Ga0209596_100741815 | 3300027754 | Freshwater Lake | MNKYRIKLDVEVEVEAFNSEDASEYIHDIFNIDDEIKKVNIVKITSK |
Ga0209596_12483421 | 3300027754 | Freshwater Lake | MNKYRIKLDVEVEVEAFNSEDASEYIHDIFNIDDEIKKVNIVKITTK |
Ga0208671_103283021 | 3300027757 | Estuarine | MDVELEVTAFNETDARDYVGDIFNIDDEIKKVNIIGNSRVNS |
Ga0209770_100404641 | 3300027769 | Freshwater Lake | MNKYRIKLDVEVEVEAFNTEDATEYIHDIFNIDDEIKKVNIVKITTK |
Ga0209770_103034464 | 3300027769 | Freshwater Lake | EVEVEAFNTEDATEYIHDIFNIDDEIKKVNIVKITTK |
Ga0209086_100741063 | 3300027770 | Freshwater Lake | MNKYRIKLDVEVEVEAFNAEDASEYIHDIFNIDDEIKKINIIKITSK |
Ga0209768_102475661 | 3300027772 | Freshwater Lake | MNTYKVKMDVELEVTAFNETDARDYVGDIFNIDDE |
Ga0209972_101801202 | 3300027793 | Freshwater Lake | MNIYKVSLEVEVEVEAFTSEDASEYIYDIFNVDDEIKKINIVTIKEK |
Ga0209107_1000056547 | 3300027797 | Freshwater And Sediment | MNKYRIKLDVEVEVEAFNPEDASEYIHDIFNIDDEIKKVNIVKMQQK |
Ga0209229_101394122 | 3300027805 | Freshwater And Sediment | MNTYKVKLDVEVEVDAFSTEDAADYVHDIFNIDDEIKKVNIINIKEK |
Ga0209229_101872853 | 3300027805 | Freshwater And Sediment | MDVELEVTAFNETDARDYVGDIFNIDDEIKKVSIVKIT |
Ga0209229_104519932 | 3300027805 | Freshwater And Sediment | MNTYKVKLDVEVEVDAFSSEDAADYVHDIFNIDDEIKKVNIVNIKEK |
Ga0247723_10271652 | 3300028025 | Deep Subsurface Sediment | MKSYRVKIEVEVEVSAFNSDDALEYVHDIFNVDDEIKKINILSIKEK |
Ga0315899_116630201 | 3300031784 | Freshwater | MNSYSVKLNVELEIQAFDETDARDYALDILNVDDEIKTVNIVKIKKV |
Ga0315909_1001920113 | 3300031857 | Freshwater | MNKYIVQLSVEIEVEAFNSDDALEYVQDIFSVDDEIKKVSINKISPK |
Ga0315909_104642552 | 3300031857 | Freshwater | MKTYRFKLDVEVEVQAFNSDDATEYVQDIFNVDDEIKKVNIVNIKEK |
Ga0315905_1000553721 | 3300032092 | Freshwater | MHKYIVKLLVEVEVEAFNLDDATDYIGDIFNIDDEIKKVNISSIKEKK |
Ga0315905_101976974 | 3300032092 | Freshwater | MNKYRIKLDIEVEVEAFNAEDANEYIHDIFNIDDEIKKINIVKVSPINH |
Ga0334980_0059465_1140_1289 | 3300033816 | Freshwater | MNTYRVKLEVEAEVEAFNETDAKDYVSDIFNIDDEIKKVNIIKITEKNK |
Ga0334992_0000229_30127_30270 | 3300033992 | Freshwater | MNKYRIKLDVEVEVEAFNPEDASEYIHDIFNIDDEIKKVNIIKITSK |
Ga0334992_0089312_1531_1665 | 3300033992 | Freshwater | VKLEVEAEVEAFNETDAKDYVADIFNIDDEIKKVNIIKITEKNK |
Ga0335019_0007243_1835_1981 | 3300034066 | Freshwater | MNTYKVKLDVEIEVEAFNQEDASEYVHDIFNLDDEIKKVNIVKIAQKL |
Ga0335019_0043378_382_525 | 3300034066 | Freshwater | MHIYKIQLDVEIEVEAFNQEDASEYVHDIFNLDDEIKKINIVKILKK |
Ga0335058_0054910_3_134 | 3300034121 | Freshwater | MNTYKVKLEVEAEVEAFNETDARDYVADIFNIDDEIKKVNIIKI |
Ga0335061_0136602_769_912 | 3300034168 | Freshwater | VNTYKVKLEVEVEVNAFNSDDAADYINDIFNVDDEIKKVNIVNIKEK |
Ga0335007_0189075_1_120 | 3300034283 | Freshwater | NVEVEVEAFNEEDAREYIGDIFNIDDEIKSVNITKIQEN |
⦗Top⦘ |