| Basic Information | |
|---|---|
| Family ID | F013568 |
| Family Type | Metagenome |
| Number of Sequences | 270 |
| Average Sequence Length | 48 residues |
| Representative Sequence | DKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Number of Associated Samples | 201 |
| Number of Associated Scaffolds | 270 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.38 % |
| % of genes near scaffold ends (potentially truncated) | 97.41 % |
| % of genes from short scaffolds (< 2000 bps) | 92.22 % |
| Associated GOLD sequencing projects | 183 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.815 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.148 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.926 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.778 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.32% β-sheet: 0.00% Coil/Unstructured: 50.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 270 Family Scaffolds |
|---|---|---|
| PF03358 | FMN_red | 23.70 |
| PF01401 | Peptidase_M2 | 16.67 |
| PF01757 | Acyl_transf_3 | 4.44 |
| PF13414 | TPR_11 | 2.22 |
| PF13432 | TPR_16 | 1.48 |
| PF04134 | DCC1-like | 1.48 |
| PF00583 | Acetyltransf_1 | 1.11 |
| PF00753 | Lactamase_B | 1.11 |
| PF00326 | Peptidase_S9 | 0.74 |
| PF01476 | LysM | 0.74 |
| PF04321 | RmlD_sub_bind | 0.74 |
| PF02637 | GatB_Yqey | 0.37 |
| PF13946 | DUF4214 | 0.37 |
| PF01433 | Peptidase_M1 | 0.37 |
| PF11199 | DUF2891 | 0.37 |
| PF07730 | HisKA_3 | 0.37 |
| PF07719 | TPR_2 | 0.37 |
| PF13181 | TPR_8 | 0.37 |
| PF13460 | NAD_binding_10 | 0.37 |
| PF00675 | Peptidase_M16 | 0.37 |
| PF02086 | MethyltransfD12 | 0.37 |
| PF04773 | FecR | 0.37 |
| PF14870 | PSII_BNR | 0.37 |
| PF01569 | PAP2 | 0.37 |
| PF01436 | NHL | 0.37 |
| PF00795 | CN_hydrolase | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 270 Family Scaffolds |
|---|---|---|---|
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.48 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 1.48 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 1.48 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 1.48 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.74 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.37 |
| COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.37 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.37 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.37 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.37 |
| COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 0.37 |
| COG1610 | Uncharacterized conserved protein YqeY, may have tRNA amino acid amidase activity | General function prediction only [R] | 0.37 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.37 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.30 % |
| Unclassified | root | N/A | 23.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459015|G14TP7Y02HVZHC | Not Available | 681 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105542349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1337 | Open in IMG/M |
| 3300000891|JGI10214J12806_10816371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 645 | Open in IMG/M |
| 3300001431|F14TB_104493008 | Not Available | 526 | Open in IMG/M |
| 3300001431|F14TB_107950728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300001431|F14TB_109214597 | Not Available | 533 | Open in IMG/M |
| 3300002503|C687J35164_10177822 | Not Available | 611 | Open in IMG/M |
| 3300003324|soilH2_10140295 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300004013|Ga0055465_10065659 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300004156|Ga0062589_100031616 | All Organisms → cellular organisms → Bacteria | 2708 | Open in IMG/M |
| 3300004157|Ga0062590_100826182 | Not Available | 856 | Open in IMG/M |
| 3300004157|Ga0062590_101309013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300004463|Ga0063356_100815362 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300004463|Ga0063356_106484649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300004480|Ga0062592_100794324 | Not Available | 838 | Open in IMG/M |
| 3300004480|Ga0062592_101749091 | Not Available | 606 | Open in IMG/M |
| 3300004633|Ga0066395_10315094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300005093|Ga0062594_100236050 | Not Available | 1320 | Open in IMG/M |
| 3300005093|Ga0062594_101269110 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005171|Ga0066677_10791246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300005184|Ga0066671_10189262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
| 3300005289|Ga0065704_10660192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300005293|Ga0065715_11023651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300005293|Ga0065715_11052907 | Not Available | 531 | Open in IMG/M |
| 3300005294|Ga0065705_10022315 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300005294|Ga0065705_10608672 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300005294|Ga0065705_10759027 | Not Available | 627 | Open in IMG/M |
| 3300005328|Ga0070676_10880704 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005328|Ga0070676_11034382 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005328|Ga0070676_11345585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300005330|Ga0070690_101013235 | Not Available | 655 | Open in IMG/M |
| 3300005331|Ga0070670_101200459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300005334|Ga0068869_100576711 | Not Available | 948 | Open in IMG/M |
| 3300005334|Ga0068869_100683659 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300005334|Ga0068869_101024147 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005335|Ga0070666_11204457 | Not Available | 564 | Open in IMG/M |
| 3300005340|Ga0070689_100619940 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300005343|Ga0070687_100662761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300005344|Ga0070661_100544485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
| 3300005345|Ga0070692_10482722 | Not Available | 800 | Open in IMG/M |
| 3300005364|Ga0070673_100101336 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
| 3300005365|Ga0070688_101059547 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005366|Ga0070659_100948407 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005440|Ga0070705_101292773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 604 | Open in IMG/M |
| 3300005441|Ga0070700_100225306 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300005444|Ga0070694_100306066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300005444|Ga0070694_100484361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300005444|Ga0070694_100661694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300005444|Ga0070694_100693456 | Not Available | 827 | Open in IMG/M |
| 3300005444|Ga0070694_101007844 | Not Available | 691 | Open in IMG/M |
| 3300005445|Ga0070708_100715402 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300005445|Ga0070708_101987623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300005445|Ga0070708_102254682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300005447|Ga0066689_10228542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1138 | Open in IMG/M |
| 3300005458|Ga0070681_11625495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300005459|Ga0068867_100756144 | Not Available | 863 | Open in IMG/M |
| 3300005459|Ga0068867_101569876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300005468|Ga0070707_100840493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300005468|Ga0070707_101894191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 564 | Open in IMG/M |
| 3300005543|Ga0070672_101156111 | Not Available | 689 | Open in IMG/M |
| 3300005546|Ga0070696_100141290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1760 | Open in IMG/M |
| 3300005546|Ga0070696_101141023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300005548|Ga0070665_101495494 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005549|Ga0070704_101587647 | Not Available | 603 | Open in IMG/M |
| 3300005559|Ga0066700_10933037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 575 | Open in IMG/M |
| 3300005560|Ga0066670_10712431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300005578|Ga0068854_101298335 | Not Available | 655 | Open in IMG/M |
| 3300005719|Ga0068861_100818922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 875 | Open in IMG/M |
| 3300005841|Ga0068863_100766877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300005842|Ga0068858_101241940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300005842|Ga0068858_101672238 | Not Available | 628 | Open in IMG/M |
| 3300005843|Ga0068860_102727160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300005844|Ga0068862_100157288 | All Organisms → cellular organisms → Bacteria | 2026 | Open in IMG/M |
| 3300005844|Ga0068862_101438379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300005887|Ga0075292_1020600 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300006049|Ga0075417_10261899 | Not Available | 831 | Open in IMG/M |
| 3300006169|Ga0082029_1503252 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300006169|Ga0082029_1588149 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300006173|Ga0070716_100620155 | Not Available | 816 | Open in IMG/M |
| 3300006755|Ga0079222_12170115 | Not Available | 551 | Open in IMG/M |
| 3300006796|Ga0066665_11311764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 556 | Open in IMG/M |
| 3300006800|Ga0066660_10477142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
| 3300006844|Ga0075428_100171861 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
| 3300006844|Ga0075428_100891064 | Not Available | 944 | Open in IMG/M |
| 3300006844|Ga0075428_101768130 | Not Available | 644 | Open in IMG/M |
| 3300006852|Ga0075433_10133553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2206 | Open in IMG/M |
| 3300006853|Ga0075420_100664237 | Not Available | 899 | Open in IMG/M |
| 3300006876|Ga0079217_10348738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300006876|Ga0079217_10696652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300006894|Ga0079215_11253933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300006918|Ga0079216_11013896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 643 | Open in IMG/M |
| 3300006931|Ga0097620_100881984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
| 3300006954|Ga0079219_10257850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1043 | Open in IMG/M |
| 3300007004|Ga0079218_12217457 | All Organisms → cellular organisms → Archaea | 639 | Open in IMG/M |
| 3300007004|Ga0079218_13375978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 541 | Open in IMG/M |
| 3300009038|Ga0099829_11160488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 640 | Open in IMG/M |
| 3300009090|Ga0099827_10509860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1034 | Open in IMG/M |
| 3300009093|Ga0105240_11188136 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300009098|Ga0105245_10960620 | Not Available | 898 | Open in IMG/M |
| 3300009098|Ga0105245_12368748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300009100|Ga0075418_10252933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1877 | Open in IMG/M |
| 3300009100|Ga0075418_11310801 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300009101|Ga0105247_11296801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300009147|Ga0114129_12227214 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300009148|Ga0105243_10231505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1639 | Open in IMG/M |
| 3300009148|Ga0105243_11690497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300009148|Ga0105243_12410320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300009162|Ga0075423_10443600 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300009174|Ga0105241_11395788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300009174|Ga0105241_11955907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300009176|Ga0105242_12113924 | All Organisms → cellular organisms → Archaea | 607 | Open in IMG/M |
| 3300009553|Ga0105249_11576427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 729 | Open in IMG/M |
| 3300010036|Ga0126305_11117271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300010037|Ga0126304_10381496 | Not Available | 940 | Open in IMG/M |
| 3300010038|Ga0126315_10428723 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300010039|Ga0126309_11095690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300010040|Ga0126308_10548533 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300010041|Ga0126312_11188091 | Not Available | 562 | Open in IMG/M |
| 3300010046|Ga0126384_11382694 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300010047|Ga0126382_10642905 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300010321|Ga0134067_10355444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300010359|Ga0126376_10142649 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300010359|Ga0126376_12258092 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300010366|Ga0126379_13286037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300010366|Ga0126379_13551151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300010373|Ga0134128_11259188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300010375|Ga0105239_10748188 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300010397|Ga0134124_10603770 | Not Available | 1075 | Open in IMG/M |
| 3300010397|Ga0134124_10715661 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300010397|Ga0134124_11457704 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300010397|Ga0134124_12732847 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300010399|Ga0134127_12062243 | Not Available | 649 | Open in IMG/M |
| 3300010399|Ga0134127_12068676 | Not Available | 648 | Open in IMG/M |
| 3300010400|Ga0134122_11353345 | Not Available | 723 | Open in IMG/M |
| 3300010400|Ga0134122_11495480 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300010400|Ga0134122_13143091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300010401|Ga0134121_13231825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300012015|Ga0120187_1030473 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012043|Ga0136631_10142020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 925 | Open in IMG/M |
| 3300012200|Ga0137382_10881452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300012203|Ga0137399_11637033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300012209|Ga0137379_10473934 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300012211|Ga0137377_10032249 | All Organisms → cellular organisms → Bacteria | 4759 | Open in IMG/M |
| 3300012212|Ga0150985_106637093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300012357|Ga0137384_10819568 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300012360|Ga0137375_10269021 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300012361|Ga0137360_10553281 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300012361|Ga0137360_11091574 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012496|Ga0157353_1038440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300012509|Ga0157334_1037283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300012685|Ga0137397_10691392 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300012685|Ga0137397_11142035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300012912|Ga0157306_10408035 | Not Available | 533 | Open in IMG/M |
| 3300012918|Ga0137396_11190769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 538 | Open in IMG/M |
| 3300012922|Ga0137394_10414188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300012923|Ga0137359_10680147 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300012927|Ga0137416_11635646 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012927|Ga0137416_11803212 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300012927|Ga0137416_12068707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300012951|Ga0164300_10766847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300012957|Ga0164303_10308222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
| 3300012961|Ga0164302_11057878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300013296|Ga0157374_11384697 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300013297|Ga0157378_10323281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1499 | Open in IMG/M |
| 3300013297|Ga0157378_11350222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300013297|Ga0157378_11612103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300013297|Ga0157378_12499389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300013308|Ga0157375_12341803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300013770|Ga0120123_1075889 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300014325|Ga0163163_12405294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300014325|Ga0163163_13025236 | Not Available | 524 | Open in IMG/M |
| 3300014745|Ga0157377_10246572 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300015201|Ga0173478_10402695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300015371|Ga0132258_11013065 | All Organisms → cellular organisms → Bacteria | 2099 | Open in IMG/M |
| 3300015371|Ga0132258_11125935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1984 | Open in IMG/M |
| 3300015372|Ga0132256_100004120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12388 | Open in IMG/M |
| 3300015372|Ga0132256_101599705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300015372|Ga0132256_102961558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300015372|Ga0132256_103249963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300018071|Ga0184618_10139858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 982 | Open in IMG/M |
| 3300018422|Ga0190265_10858525 | Not Available | 1030 | Open in IMG/M |
| 3300018433|Ga0066667_12069457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300018465|Ga0190269_10027404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2576 | Open in IMG/M |
| 3300018469|Ga0190270_12536698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 575 | Open in IMG/M |
| 3300018476|Ga0190274_12079085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300018920|Ga0190273_11804250 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300019142|Ga0193597_1004919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 5587 | Open in IMG/M |
| 3300019142|Ga0193597_1005326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5313 | Open in IMG/M |
| 3300019142|Ga0193597_1081500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
| 3300019361|Ga0173482_10471391 | Not Available | 602 | Open in IMG/M |
| 3300019377|Ga0190264_10279713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 993 | Open in IMG/M |
| 3300019487|Ga0187893_10134771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2055 | Open in IMG/M |
| 3300019767|Ga0190267_11024229 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300019767|Ga0190267_11367605 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300019879|Ga0193723_1083192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300019883|Ga0193725_1044300 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300020202|Ga0196964_10121556 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300020215|Ga0196963_10443114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300021061|Ga0196973_1057959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300021362|Ga0213882_10032685 | Not Available | 2018 | Open in IMG/M |
| 3300025735|Ga0207713_1211673 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300025899|Ga0207642_10755010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300025904|Ga0207647_10695076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300025907|Ga0207645_10456076 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300025907|Ga0207645_10815241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300025908|Ga0207643_10926513 | Not Available | 564 | Open in IMG/M |
| 3300025911|Ga0207654_10431825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
| 3300025911|Ga0207654_10572964 | Not Available | 804 | Open in IMG/M |
| 3300025911|Ga0207654_11063404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300025911|Ga0207654_11118478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300025920|Ga0207649_10259543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1255 | Open in IMG/M |
| 3300025925|Ga0207650_10716078 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300025927|Ga0207687_11606204 | Not Available | 558 | Open in IMG/M |
| 3300025930|Ga0207701_11706932 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300025933|Ga0207706_11652620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300025934|Ga0207686_10340509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300025934|Ga0207686_11621215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300025935|Ga0207709_11870750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300025936|Ga0207670_11886082 | Not Available | 508 | Open in IMG/M |
| 3300025937|Ga0207669_11368196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300025937|Ga0207669_11897591 | Not Available | 509 | Open in IMG/M |
| 3300025941|Ga0207711_10440813 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300025942|Ga0207689_10313971 | Not Available | 1300 | Open in IMG/M |
| 3300025961|Ga0207712_11379990 | Not Available | 630 | Open in IMG/M |
| 3300025981|Ga0207640_11981314 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300025981|Ga0207640_12190033 | Not Available | 502 | Open in IMG/M |
| 3300026078|Ga0207702_11467231 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300026088|Ga0207641_10189851 | Not Available | 1888 | Open in IMG/M |
| 3300026089|Ga0207648_11801215 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 574 | Open in IMG/M |
| 3300026095|Ga0207676_12273370 | Not Available | 540 | Open in IMG/M |
| 3300026118|Ga0207675_100851204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 927 | Open in IMG/M |
| 3300026118|Ga0207675_101049959 | Not Available | 834 | Open in IMG/M |
| 3300026285|Ga0209438_1222967 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300026312|Ga0209153_1152904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300027765|Ga0209073_10447578 | All Organisms → cellular organisms → Archaea | 537 | Open in IMG/M |
| 3300027840|Ga0209683_10272627 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300027886|Ga0209486_11011795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 559 | Open in IMG/M |
| 3300028380|Ga0268265_10871335 | Not Available | 882 | Open in IMG/M |
| 3300028381|Ga0268264_10147396 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
| 3300028381|Ga0268264_12577110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300028578|Ga0272482_10063827 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300028814|Ga0307302_10423503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 659 | Open in IMG/M |
| 3300030496|Ga0268240_10179604 | Not Available | 533 | Open in IMG/M |
| 3300031548|Ga0307408_101108183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300031716|Ga0310813_10458954 | Not Available | 1107 | Open in IMG/M |
| 3300031716|Ga0310813_10788986 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031820|Ga0307473_10938423 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300031908|Ga0310900_10612164 | Not Available | 862 | Open in IMG/M |
| 3300031995|Ga0307409_102245918 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300032002|Ga0307416_101786144 | Not Available | 719 | Open in IMG/M |
| 3300032075|Ga0310890_10945246 | Not Available | 690 | Open in IMG/M |
| 3300032122|Ga0310895_10370947 | Not Available | 694 | Open in IMG/M |
| 3300032126|Ga0307415_101787934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300033412|Ga0310810_10876105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300033412|Ga0310810_11134016 | Not Available | 645 | Open in IMG/M |
| 3300034001|Ga0334919_010977 | All Organisms → Viruses → Predicted Viral | 1581 | Open in IMG/M |
| 3300034003|Ga0334922_033847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300034005|Ga0334930_001934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3310 | Open in IMG/M |
| 3300034009|Ga0334944_097961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300034028|Ga0334950_071358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300034165|Ga0364942_0101601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 930 | Open in IMG/M |
| 3300034178|Ga0364934_0165724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → unclassified Ktedonobacteraceae → Ktedonobacteraceae bacterium | 837 | Open in IMG/M |
| 3300034221|Ga0334937_014499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2000 | Open in IMG/M |
| 3300034779|Ga0334945_039712 | Not Available | 801 | Open in IMG/M |
| 3300034820|Ga0373959_0114479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.07% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.22% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.22% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.48% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.11% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.11% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.74% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.74% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.74% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.74% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.37% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.37% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.37% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.37% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.37% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.37% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.37% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.37% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.37% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.37% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.37% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.37% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.37% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002503 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012015 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019142 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid late stage, 3 min after wetting v1 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021061 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5-13C | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034001 | Biocrust microbial communities from Mojave Desert, California, United States - 15HMC | Environmental | Open in IMG/M |
| 3300034003 | Biocrust microbial communities from Mojave Desert, California, United States - 18HMC | Environmental | Open in IMG/M |
| 3300034005 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 26HNS | Environmental | Open in IMG/M |
| 3300034009 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 40SMS | Environmental | Open in IMG/M |
| 3300034028 | Biocrust microbial communities from Mojave Desert, California, United States - 46SNC | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034221 | Biocrust microbial communities from Mojave Desert, California, United States - 33SMC | Environmental | Open in IMG/M |
| 3300034779 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 41SMS | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4PV_04315550 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | VYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAT |
| INPhiseqgaiiFebDRAFT_1055423491 | 3300000364 | Soil | RTSRIDFVAQEMGLTRKQAKRRIRNFEAWQRNIKKGLVSP* |
| JGI10214J12806_108163711 | 3300000891 | Soil | AARIDYVAEKMNLTHKQAKRRVRNYESWQRNIKKRLVEP* |
| F14TB_1044930081 | 3300001431 | Soil | KDRTTRIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGLVSP* |
| F14TB_1079507281 | 3300001431 | Soil | TSRIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGIAT* |
| F14TB_1092145971 | 3300001431 | Soil | FYVKAPGDRFDKKKDRTARIDYLAQEMNLTRKQAKRRIRNYEAWQRNIKKGIVSP* |
| C687J35164_101778221 | 3300002503 | Soil | AYDIYLNAPGDRYDKKNDRTKRIDHVAREMKLTRKQAKRRVRNYEAWQRNIKKGLVTP* |
| soilH2_101402951 | 3300003324 | Sugarcane Root And Bulk Soil | AYKVYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAAP* |
| Ga0055465_100656591 | 3300004013 | Natural And Restored Wetlands | RFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIARP* |
| Ga0062589_1000316165 | 3300004156 | Soil | HAYKLYLKAPGDRYDKKKDRTTRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTP* |
| Ga0062590_1008261822 | 3300004157 | Soil | DRFDKKKDRTQRIDYVAREMKLTRKQAKRRIRNYEAWQRNIKKGLVRP* |
| Ga0062590_1013090132 | 3300004157 | Soil | RFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAT* |
| Ga0063356_1008153621 | 3300004463 | Arabidopsis Thaliana Rhizosphere | KAPGDRYDKKKDRTARIDSVATELRLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0063356_1064846491 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RTARIDSVATELRLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0062592_1007943241 | 3300004480 | Soil | DRTQRIDYVAREMKLTRKQAKRRIRNYEAWQRNIKKGLVRP* |
| Ga0062592_1017490911 | 3300004480 | Soil | GDRYDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAMP* |
| Ga0066395_103150941 | 3300004633 | Tropical Forest Soil | AAGDPYDKKSDRTERIGHVARVMRLTRKQAKRRIRNYEAWQRNIKKGLVNP* |
| Ga0062594_1002360501 | 3300005093 | Soil | AYKFYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAT* |
| Ga0062594_1012691102 | 3300005093 | Soil | WSLAYKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0066677_107912462 | 3300005171 | Soil | RTERINFVADKMRLTRKQAKRRVKNFEAWQRNIKKGLITP* |
| Ga0066671_101892621 | 3300005184 | Soil | AYQIYLQAPGDKYDKKNDRTERITYVAQKLNLTRKQAKRRVRNYEAWQRNIKSGLVPP* |
| Ga0065704_106601922 | 3300005289 | Switchgrass Rhizosphere | KDRTSRIDFVAQEMGLTRKQAKRRIRNFEAWQRNIKKGLVSP* |
| Ga0065715_110236512 | 3300005293 | Miscanthus Rhizosphere | YLKAPGDRYDKKKDRTARIDSVATELRLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0065715_110529072 | 3300005293 | Miscanthus Rhizosphere | RTARIDFVAQEMKLTRKQAKRRIRNFEAWQRNIKKGIVNP* |
| Ga0065705_100223153 | 3300005294 | Switchgrass Rhizosphere | DRYDKKKDRTARIDSVATELRLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0065705_106086722 | 3300005294 | Switchgrass Rhizosphere | LRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0065705_107590271 | 3300005294 | Switchgrass Rhizosphere | KKDRTTRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTP* |
| Ga0070676_108807042 | 3300005328 | Miscanthus Rhizosphere | AYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0070676_110343822 | 3300005328 | Miscanthus Rhizosphere | IYLRAPGDRYDKKKDRTARIDSVANELQLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0070676_113455851 | 3300005328 | Miscanthus Rhizosphere | AYQIYLKAPGDRYDKKKDRTARIDSVATELRLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0070690_1010132352 | 3300005330 | Switchgrass Rhizosphere | GDRYDKKKDRTTRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTP* |
| Ga0070670_1012004591 | 3300005331 | Switchgrass Rhizosphere | APGDRYDKKKDRTARIDSVANELRLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0068869_1005767112 | 3300005334 | Miscanthus Rhizosphere | LAYKYYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVRP* |
| Ga0068869_1006836591 | 3300005334 | Miscanthus Rhizosphere | RAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0068869_1010241472 | 3300005334 | Miscanthus Rhizosphere | ATAYKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0070666_112044571 | 3300005335 | Switchgrass Rhizosphere | WSTAYKFYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAT |
| Ga0070689_1006199401 | 3300005340 | Switchgrass Rhizosphere | LRAPGDRYDKKKDRTARIDSVANELQLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0070687_1006627611 | 3300005343 | Switchgrass Rhizosphere | YDKKKDRTSRIDHVAVEMKLTRKQAKRRIRNYEAWQRNIKKGVVEP* |
| Ga0070661_1005444852 | 3300005344 | Corn Rhizosphere | DKKKDRTSRIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGIVSP* |
| Ga0070692_104827221 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | AYKYYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVSP* |
| Ga0070669_1000752461 | 3300005353 | Switchgrass Rhizosphere | YLEAPGDRNPKNDRAERIKYVAKQMNLTHKQAKRRVRNYESWQRNIKKRLVSP* |
| Ga0070673_1001013361 | 3300005364 | Switchgrass Rhizosphere | KKKDRTQRIDYVAREMKLTRKQAKRRIRNYEAWQRNIKKGLVRP* |
| Ga0070688_1010595471 | 3300005365 | Switchgrass Rhizosphere | RAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVTP* |
| Ga0070659_1009484071 | 3300005366 | Corn Rhizosphere | KDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVHP* |
| Ga0070705_1012927732 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | TRAYQIYLRAPGDRYDKKKDRTARIDSVAQELRLTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0070700_1002253062 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | YKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0070694_1003060662 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | KKKDRTARIDSVATELSLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0070694_1004843611 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | TARIDSVANELRLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0070694_1006616941 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | TARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTP* |
| Ga0070694_1006934562 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | DKKKDRTTRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTP* |
| Ga0070694_1010078441 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | SLAYKYYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVSP |
| Ga0070708_1007154021 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | FYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTP* |
| Ga0070708_1019876232 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PGDRYDKKKDRTARIDSVATELRLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0070708_1022546822 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | KKKDRTARIDSVANELRLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0066689_102285422 | 3300005447 | Soil | RAYQIYLKAPGDRYDKKNDRTARIDFVAQELQLTRKQAKRRVRNYEAWQRNIKKGLVSP* |
| Ga0070681_116254951 | 3300005458 | Corn Rhizosphere | KKDRTSRIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGIVSP* |
| Ga0068867_1007561442 | 3300005459 | Miscanthus Rhizosphere | WSYAYKLYLKAPGDRYDKKKDRTTRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTP* |
| Ga0068867_1015698761 | 3300005459 | Miscanthus Rhizosphere | RAYQIYQRAPGDRYDKKKDRTSRIDHVAVEMKLTRKQAKRRIRNYEAWQRNIKKGVVEP* |
| Ga0070707_1008404933 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AYELYRQAPGDPYDKKNDRTERIGYVAKAMQLTRKQAKRRIRNFEAWQRNIKKGLVNA* |
| Ga0070707_1018941912 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | PGDRYDKKNDRTERIGYVARAMKLTRKQAKRRIRNYEAWQRNIKKGLVSSLGSGL* |
| Ga0070672_1011561112 | 3300005543 | Miscanthus Rhizosphere | IDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTP* |
| Ga0070696_1001412901 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | TARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLAEP* |
| Ga0070696_1011410233 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AYKLYLKAPGDRFDKKKDRTARIDFVAQEMSLTRKQAKRRIRNYEAWQRNIKKGLVSP* |
| Ga0070665_1014954942 | 3300005548 | Switchgrass Rhizosphere | AYQIYLRAPGDRYDKKKDRTARIDSVANELQLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0070704_1015876472 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TAYKFYLRAPGDRFDKKKDRTQRIDYVAREMKLTRKQAKRRIRNYEAWQRNIKKGLVRP* |
| Ga0066700_109330371 | 3300005559 | Soil | KKNDRTERIGYVARAMKLTRKQAKRRIRNYEAWQRNIKKGLVT* |
| Ga0066670_107124311 | 3300005560 | Soil | DRTERITYVAQKLNLTRKQAKRRVRNYEAWQRNIKSGLVTP* |
| Ga0068854_1012983352 | 3300005578 | Corn Rhizosphere | YVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIANP* |
| Ga0068861_1008189222 | 3300005719 | Switchgrass Rhizosphere | YQIYLRAPGDRYDKKKDRTARIDSVAQELKLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0068863_1007668771 | 3300005841 | Switchgrass Rhizosphere | YDKKKDRTSRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIASP* |
| Ga0068858_1012419402 | 3300005842 | Switchgrass Rhizosphere | KAYKVYLKAPGDRFDKKKDRTARIDFVAQEMRLTRKQAKRRIRNYEAWQRNIKKGIANPLD* |
| Ga0068858_1016722381 | 3300005842 | Switchgrass Rhizosphere | KKDRTQRIDYVAREMKLTRKQAKRRIRNYEAWQRNIKKGLVRP* |
| Ga0068860_1027271601 | 3300005843 | Switchgrass Rhizosphere | APGDRYDKKKDRTSRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIASP* |
| Ga0068862_1001572881 | 3300005844 | Switchgrass Rhizosphere | YVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLAEP* |
| Ga0068862_1014383792 | 3300005844 | Switchgrass Rhizosphere | DKKKDRTARIDSVATELRLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0075292_10206002 | 3300005887 | Rice Paddy Soil | DYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0075417_102618991 | 3300006049 | Populus Rhizosphere | TARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAAP* |
| Ga0082029_15032521 | 3300006169 | Termite Nest | KKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0082029_15881491 | 3300006169 | Termite Nest | LRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0070716_1006201552 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KDRTARIDYVSQEMKLTRKQAKRRIRNYEAWQRNIKKGIAAP* |
| Ga0079222_121701151 | 3300006755 | Agricultural Soil | YKIYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAAP* |
| Ga0066665_113117641 | 3300006796 | Soil | NDRTERIGYVARAMKLTRKQAKRRIRNYEAWQRNIKKGLVT* |
| Ga0066660_104771421 | 3300006800 | Soil | NFYLEAPGFPYDKKKDRTERIDFVARKMNLTRKQAKRRIKNYEAWQRNIKKGLVTA* |
| Ga0075428_1001718615 | 3300006844 | Populus Rhizosphere | TARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIATP* |
| Ga0075428_1008910641 | 3300006844 | Populus Rhizosphere | APGDRYDKKKDRTTRIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGLVSP* |
| Ga0075428_1017681302 | 3300006844 | Populus Rhizosphere | KLYLKAPGDRYDKKKDRTTRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTP* |
| Ga0075433_101335531 | 3300006852 | Populus Rhizosphere | KIYLKAPGDRYDKKKDRTSRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIASP* |
| Ga0075420_1006642373 | 3300006853 | Populus Rhizosphere | RIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAPP* |
| Ga0079217_103487382 | 3300006876 | Agricultural Soil | IDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAAP* |
| Ga0079217_106966521 | 3300006876 | Agricultural Soil | GVPHNKKLDRTERINYVADKMHLTRKQAKRRVKNFEAWQRNIKKGLVTP* |
| Ga0079215_112539332 | 3300006894 | Agricultural Soil | YDHYQSAPGVPHNKKLDRTERINYVADKMHLTRKQAKRRVKNFEAWQRNIKKGLVTP* |
| Ga0079216_110138962 | 3300006918 | Agricultural Soil | KKKDRTARIDSVAQELRLTRKEAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0097620_1008819841 | 3300006931 | Switchgrass Rhizosphere | PGDRYDKKKDRTARIDSVANELQLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0079219_102578502 | 3300006954 | Agricultural Soil | YDKKKDRTSRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVSP* |
| Ga0079218_122174572 | 3300007004 | Agricultural Soil | DKKKDRTTRIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGLVTP* |
| Ga0079218_133759782 | 3300007004 | Agricultural Soil | YLRAPGDRYDKKKDRTARIDSVAQELRLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0099829_111604881 | 3300009038 | Vadose Zone Soil | HAYSLYLHAPGDRYDKKNDRTERIGYVARAMKLTRKQAKRRIRNYEAWQRNIKKGLVGS* |
| Ga0099827_105098601 | 3300009090 | Vadose Zone Soil | DRTARIDSVAQELKLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0105240_111881362 | 3300009093 | Corn Rhizosphere | FYIRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0105245_109606201 | 3300009098 | Miscanthus Rhizosphere | RFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0105245_123687481 | 3300009098 | Miscanthus Rhizosphere | IYLKAPGDRYDKKKDRTSRIDFVAQEMKLTRKQAKRRIRNFEAWQRNIKKGIASP* |
| Ga0075418_102529334 | 3300009100 | Populus Rhizosphere | KKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAT* |
| Ga0075418_113108011 | 3300009100 | Populus Rhizosphere | WSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0105247_112968011 | 3300009101 | Switchgrass Rhizosphere | TAYKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0114129_122272142 | 3300009147 | Populus Rhizosphere | YVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0105243_102315053 | 3300009148 | Miscanthus Rhizosphere | RIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTP* |
| Ga0105243_116904972 | 3300009148 | Miscanthus Rhizosphere | WAFAYKIYLKAPGDRYDKKKDRTSRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIASP* |
| Ga0105243_124103201 | 3300009148 | Miscanthus Rhizosphere | LAYKYYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVLP* |
| Ga0075423_104436001 | 3300009162 | Populus Rhizosphere | KYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0105241_113957881 | 3300009174 | Corn Rhizosphere | QRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0105241_119559072 | 3300009174 | Corn Rhizosphere | YLRAPGDRYDKKKDRTARIDSVAHELRLTRKQAKRRIRNYEAWQRNIKKGLVEP* |
| Ga0105242_121139242 | 3300009176 | Miscanthus Rhizosphere | GDRYDKKKDRTSRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAS* |
| Ga0105249_115764271 | 3300009553 | Switchgrass Rhizosphere | AAPGDRNPKNDRAARIDYVAEKMNLTHKQAKRRVRNYESWQRNIKKRLVEP* |
| Ga0126305_111172712 | 3300010036 | Serpentine Soil | EHYQAAPGVPHNKKLDRTERINYVADKMHLTRKQAKRRVKNFEAWQRNIKKGLITP* |
| Ga0126304_103814962 | 3300010037 | Serpentine Soil | KKKDRTARIDYVAQEMNLTRKQAKRRIRNYEAWQRNIKKGLVTP* |
| Ga0126315_104287231 | 3300010038 | Serpentine Soil | RAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVSP* |
| Ga0126309_110956902 | 3300010039 | Serpentine Soil | GDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVHP* |
| Ga0126308_105485331 | 3300010040 | Serpentine Soil | HYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVHP* |
| Ga0126312_111880911 | 3300010041 | Serpentine Soil | WSTAYKFYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVHP* |
| Ga0126384_113826941 | 3300010046 | Tropical Forest Soil | KKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIERP* |
| Ga0126382_106429052 | 3300010047 | Tropical Forest Soil | RFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0134067_103554442 | 3300010321 | Grasslands Soil | FVAEKLHLTRKQAKRRVKNFEAWQRNIKKGLVTP* |
| Ga0126376_101426491 | 3300010359 | Tropical Forest Soil | APGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0126376_122580921 | 3300010359 | Tropical Forest Soil | DRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRA* |
| Ga0126379_132860371 | 3300010366 | Tropical Forest Soil | KSDRTERIGHVARVMRLTRKQAKRRIRNYEAWQRNIKKGLVNP* |
| Ga0126379_135511512 | 3300010366 | Tropical Forest Soil | PGDRYDKKKDRTSRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVSP* |
| Ga0134128_112591881 | 3300010373 | Terrestrial Soil | IDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0105239_107481881 | 3300010375 | Corn Rhizosphere | RTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVTP* |
| Ga0134124_106037704 | 3300010397 | Terrestrial Soil | RTQRIDYVAREMKLTRKQAKRRIRNYEAWQRNIKKGLVRP* |
| Ga0134124_107156612 | 3300010397 | Terrestrial Soil | DRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0134124_114577041 | 3300010397 | Terrestrial Soil | RTQRIDYVAQEMKLTRKQAKRRIRNYEVWQRNIKKGIVTP* |
| Ga0134124_127328471 | 3300010397 | Terrestrial Soil | GDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGVVSP* |
| Ga0134127_120622432 | 3300010399 | Terrestrial Soil | YVAREMKLTRKQAKRRIRNYEAWQRNIKKGLVRP* |
| Ga0134127_120686762 | 3300010399 | Terrestrial Soil | TARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAT* |
| Ga0134122_113533451 | 3300010400 | Terrestrial Soil | KKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0134122_114954802 | 3300010400 | Terrestrial Soil | RTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVRP* |
| Ga0134122_131430912 | 3300010400 | Terrestrial Soil | WTRAYQIYLRAPGDRYDKKKDRTARIDTVAQELKLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0134121_132318251 | 3300010401 | Terrestrial Soil | LRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIANP* |
| Ga0120187_10304732 | 3300012015 | Terrestrial | DKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0136631_101420202 | 3300012043 | Polar Desert Sand | RIDTVAKELQLTRKQAKRRVRNYEAWQRNIKKALVAP* |
| Ga0136632_100960612 | 3300012093 | Polar Desert Sand | KLYLKAPGDPRDKKNDRSERISYVAKEMNLTHKQAKRRIRNYESWQRNIKKRLVEP* |
| Ga0137382_108814521 | 3300012200 | Vadose Zone Soil | NLYLQAPGDPYDKKNDRTERIGYVAKAMQLTRKQAKRRIRNFEAWQRNIKKGLVSA* |
| Ga0137399_116370331 | 3300012203 | Vadose Zone Soil | LKAPGDRFDKKKDRTARIDFVATEMNLTRKQAKRRVRNYEAWQRNIKRGLVTP* |
| Ga0137379_104739341 | 3300012209 | Vadose Zone Soil | LQAPGDRYDKKNDRTERIGYVAKALQLTRKQAKRRIRNYEAWQRNIKKGLVTA* |
| Ga0137377_100322491 | 3300012211 | Vadose Zone Soil | APGDRFDKKKDRTARIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGLVSP* |
| Ga0150985_1066370931 | 3300012212 | Avena Fatua Rhizosphere | WKRAYRIYQEAPGDPYDKKKDRTVRIDYVARQLNLTRKQAKRRIRNFEAWQRNLKRGLVEP* |
| Ga0137384_108195682 | 3300012357 | Vadose Zone Soil | TARIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGLVSP* |
| Ga0137375_102690211 | 3300012360 | Vadose Zone Soil | RTARIDSVAQELRLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0137360_105532812 | 3300012361 | Vadose Zone Soil | DKKKDRTARIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGLVNP* |
| Ga0137360_110915741 | 3300012361 | Vadose Zone Soil | KKLDRTERINYVAREMNLTRKQAKRRIRNYEAWQRNIKKGLVSP* |
| Ga0157353_10384401 | 3300012496 | Unplanted Soil | AYKFYLKAPGDRYDKKKDRTSRIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGIVSP* |
| Ga0157334_10372831 | 3300012509 | Soil | KKDRTSRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIASP* |
| Ga0136613_104071932 | 3300012681 | Polar Desert Sand | PGDPRDKKNDRSERISYVAREMNLTHKQAKRRVRNYESWQRNIKKRLVEP* |
| Ga0137397_106913921 | 3300012685 | Vadose Zone Soil | QRAPGDRYDKKKDRTARIDSVAEELKLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0137397_111420351 | 3300012685 | Vadose Zone Soil | RTERIGFVAKAMQLTRKQAKRRIRNFEAWQRNIKKGLVSA* |
| Ga0157306_104080352 | 3300012912 | Soil | RIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0137396_111907692 | 3300012918 | Vadose Zone Soil | IDTVAQELKLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0137394_104141881 | 3300012922 | Vadose Zone Soil | LQAPGDLYDKKNDRTERIGYVARALTLTRKQAKRRIRNYEAWQRNIKKGLVSN* |
| Ga0137359_106801471 | 3300012923 | Vadose Zone Soil | DRYDKKKDRTARIDSVAAELNLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0137416_116356461 | 3300012927 | Vadose Zone Soil | INYVARELNLTRKQAKRRIRNYEAWQRNVKKGLVSP* |
| Ga0137416_118032121 | 3300012927 | Vadose Zone Soil | PGDRFDKKKDRTARIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGLVSP* |
| Ga0137416_120687071 | 3300012927 | Vadose Zone Soil | QIYQRAPGDRYDKKKDRTSRIDHVAVEMKLTRKQAKRRIRNYEAWQRNIKKGLVEP* |
| Ga0164300_107668471 | 3300012951 | Soil | KKDRTSRIDHVAVEMKLTRKQAKRRIRNYEAWQRNIKKGIVEP* |
| Ga0164303_103082221 | 3300012957 | Soil | KIYLKAPGDRYDKKKDRTSRIDFVAQEMKLTRKQAKRRIRNFEAWQRNIKKGIASP* |
| Ga0164302_110578781 | 3300012961 | Soil | DFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIASP* |
| Ga0157374_113846971 | 3300013296 | Miscanthus Rhizosphere | LRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVTP* |
| Ga0157378_103232812 | 3300013297 | Miscanthus Rhizosphere | HVAVEMKLTRKQAKRRIRNYEAWQRNIKKGIVEP* |
| Ga0157378_113502221 | 3300013297 | Miscanthus Rhizosphere | KDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVTP* |
| Ga0157378_116121032 | 3300013297 | Miscanthus Rhizosphere | DRYDKKKDRTSRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIASP* |
| Ga0157378_124993892 | 3300013297 | Miscanthus Rhizosphere | GDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0157375_123418031 | 3300013308 | Miscanthus Rhizosphere | YDKKKDRTSRIDHVAVEMKLTRKQAKRRIRNYEAWQRNIKKGIVEP* |
| Ga0120123_10758891 | 3300013770 | Permafrost | SVATELNLTRKQAKRRVRNYEAWQRNIKKGLVEP* |
| Ga0163163_124052942 | 3300014325 | Switchgrass Rhizosphere | GDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVTP* |
| Ga0163163_130252362 | 3300014325 | Switchgrass Rhizosphere | SKAYKVYLKAPGDRFDKKKDRTARIDFVAQEMRLTRKQAKRRIRNYEAWQRNIKKGIANP |
| Ga0157377_102465721 | 3300014745 | Miscanthus Rhizosphere | KDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAAP* |
| Ga0173478_104026952 | 3300015201 | Soil | FVAQEMGLTRKQAKRRIRNFEAWQRNIKKGLVSP* |
| Ga0180089_11033892 | 3300015254 | Soil | PGDPRDKKNDRSERISFVAKEMNLTHKQAKRRIRNYESWQRNIKKRLVEP* |
| Ga0132258_110130651 | 3300015371 | Arabidopsis Rhizosphere | KKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP* |
| Ga0132258_111259351 | 3300015371 | Arabidopsis Rhizosphere | TTRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTP* |
| Ga0132256_1000041209 | 3300015372 | Arabidopsis Rhizosphere | YDKKKDRTTRIDFVAQEMKLTRKQAKRRIRNYEPWQRNIKKGLVTP* |
| Ga0132256_1015997051 | 3300015372 | Arabidopsis Rhizosphere | SRIDFVAQEMGLTRKQAKRRIRNFEAWQRNIKKGLVSP* |
| Ga0132256_1029615581 | 3300015372 | Arabidopsis Rhizosphere | AFAYKVYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAAP |
| Ga0132256_1032499631 | 3300015372 | Arabidopsis Rhizosphere | AAAYKFYLKAPGDRYDKKKDRTSRIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGIVSP |
| Ga0184618_101398582 | 3300018071 | Groundwater Sediment | PGDRYDKKKDRTARIDSVANELRLTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0190265_108585251 | 3300018422 | Soil | TARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGVVPP |
| Ga0066667_120694571 | 3300018433 | Grasslands Soil | RTARIYYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAAP |
| Ga0190269_100274043 | 3300018465 | Soil | RTERINFVADKMRLTRKQAKRRVKNFEAWQRNIKKGLITP |
| Ga0190270_125366982 | 3300018469 | Soil | YQIYLRAPGDRYDKKKDRTARIDSVAQELRLTRKQAKRRVRNYEAWQRNISKKLVS |
| Ga0190274_120790851 | 3300018476 | Soil | RAYQIYLKAPGDRYDKKKDRTARIDTVANELKLTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0190273_118042501 | 3300018920 | Soil | HDKKRDRTERIDYVARMMNLTRKQAKRRVKNYEAWQRNIKKGLVES |
| Ga0193597_10049191 | 3300019142 | Soil | APGVPYDKKLDRTERITYVATKLNLTRKQAKRRIRNYEAWQRNIKKGLVDR |
| Ga0193597_10053263 | 3300019142 | Soil | LDRTERITYVATKLNLTRKQAKRRIRNYEAWQRNIKKGLVDR |
| Ga0193597_10815001 | 3300019142 | Soil | LDRTERITYVATKLNLTRKQAKRRIRNYEAWQRNIKKGLVDG |
| Ga0173482_104713911 | 3300019361 | Soil | YLKAPGDRYDKKKDRTTRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTP |
| Ga0190264_102797132 | 3300019377 | Soil | YQICLRAPGDRYDKKKDRTARIDSVAQELRLTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0187893_101347711 | 3300019487 | Microbial Mat On Rocks | RTSRIDFVAQELKLTRKQAKRRVRNYEAWQRNINKGLVKP |
| Ga0190267_110242292 | 3300019767 | Soil | NYVAEKLDITRKQAKRRVRNYEAWQRNIKKGLVQP |
| Ga0190267_113676051 | 3300019767 | Soil | DRYDKKKDRTERINYVADKMNLTRKQAKRRVRNYEAWQRNIKKGLVTP |
| Ga0193723_10831923 | 3300019879 | Soil | EWTRAYQIYLKAPGDRYDKKKDRTARIDSVANELSLTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0193725_10443002 | 3300019883 | Soil | YDKKKDRTARIDSVAHELNLTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0196964_101215562 | 3300020202 | Soil | MEAPGVPYDKKKDRTERITYVARRMNLTRKQAKRRIRNYEAWQRNIKKGLVSP |
| Ga0196963_104431142 | 3300020215 | Soil | NKKLDRTERINFVAQSMNLTRKQAKRRVKNYEAWQRNIKKGLITP |
| Ga0196973_10579592 | 3300021061 | Soil | YDKKKDRTERITYVARRMNLTRKQAKRRIRNYEAWQRNIKKGLVTP |
| Ga0213882_100326851 | 3300021362 | Exposed Rock | RISYVARQMNLTHKQAKRRVRNYEAWQRNIKKGIVQP |
| Ga0207713_12116732 | 3300025735 | Switchgrass Rhizosphere | GDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVTP |
| Ga0207642_107550101 | 3300025899 | Miscanthus Rhizosphere | DKKKDRTSRIDHVAVEMKLTRKQAKRRIRNYEAWQRNIKKGIVEP |
| Ga0207647_106950762 | 3300025904 | Corn Rhizosphere | DFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVEP |
| Ga0207645_104560762 | 3300025907 | Miscanthus Rhizosphere | RFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0207645_108152412 | 3300025907 | Miscanthus Rhizosphere | AYQIYLKAPGDRYDKKKDRTARIDSVATELRLTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0207643_109265132 | 3300025908 | Miscanthus Rhizosphere | IDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAT |
| Ga0207654_104318251 | 3300025911 | Corn Rhizosphere | KKDRTSRIDFVAQEMGLTRKQAKRRIRNFEAWQRNIKKGLVSP |
| Ga0207654_105729642 | 3300025911 | Corn Rhizosphere | DRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0207654_110634042 | 3300025911 | Corn Rhizosphere | KAPGDRYDKKKDRTARIDTVANELRLTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0207654_111184782 | 3300025911 | Corn Rhizosphere | LAYKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0207649_102595432 | 3300025920 | Corn Rhizosphere | KAPGDRYDKKKDRTSRIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGIVSP |
| Ga0207650_107160781 | 3300025925 | Switchgrass Rhizosphere | YLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0207687_116062042 | 3300025927 | Miscanthus Rhizosphere | RFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0207701_117069321 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AEWSFAYKVYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAT |
| Ga0207706_116526201 | 3300025933 | Corn Rhizosphere | TQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0207686_103405093 | 3300025934 | Miscanthus Rhizosphere | IDSVANELRLTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0207686_116212151 | 3300025934 | Miscanthus Rhizosphere | KAPGDRYDKKKDRTSRIDFVAQEMKLTRKQAKRRIRNFEAWQRNIKKGIASP |
| Ga0207709_118707502 | 3300025935 | Miscanthus Rhizosphere | PGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0207670_118860822 | 3300025936 | Switchgrass Rhizosphere | YKHYQRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLAEP |
| Ga0207669_113681961 | 3300025937 | Miscanthus Rhizosphere | NAPGDRYDKKKDRTSRIDFVAQEMKLTRKQAKRRIRNFEAWQRNIKKGLVTP |
| Ga0207669_118975912 | 3300025937 | Miscanthus Rhizosphere | TRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTT |
| Ga0207711_104408131 | 3300025941 | Switchgrass Rhizosphere | RIDYVAQEMKLTRKQAKRSIRNYEAWQRNIKKGIVRP |
| Ga0207689_103139711 | 3300025942 | Miscanthus Rhizosphere | YKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0207712_113799901 | 3300025961 | Switchgrass Rhizosphere | DYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLAEP |
| Ga0207640_119813142 | 3300025981 | Corn Rhizosphere | KKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0207640_121900332 | 3300025981 | Corn Rhizosphere | KKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAAP |
| Ga0207702_114672312 | 3300026078 | Corn Rhizosphere | KKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0207641_101898513 | 3300026088 | Switchgrass Rhizosphere | QRIDYVAREMKLTRKQAKRRIRNYEAWQRNIKKGLVRP |
| Ga0207648_118012151 | 3300026089 | Miscanthus Rhizosphere | FDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0207676_122733702 | 3300026095 | Switchgrass Rhizosphere | TAYKFYQRAPGDRYDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAT |
| Ga0207675_1008512042 | 3300026118 | Switchgrass Rhizosphere | WTRAYQIYLRAPGDRYDKKKDRTARIDSVAQELKLTRKQAKRRVRNYEAWQRNIKKGLVE |
| Ga0207675_1010499591 | 3300026118 | Switchgrass Rhizosphere | KKKDRTTRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLVTP |
| Ga0209438_12229672 | 3300026285 | Grasslands Soil | KKKDRTARIDFVAQEMNLTRKQAKRRIRNYEAWQRNIKKGLVSP |
| Ga0209153_11529041 | 3300026312 | Soil | KKNDRTERITYVAQKLNLTRKQAKRRVRNYEAWQRNIKSGLVPP |
| Ga0209073_104475781 | 3300027765 | Agricultural Soil | DKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIANP |
| Ga0209683_102726272 | 3300027840 | Wetland Sediment | GDRYDKKKDRTARIDSVAEELELTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0209486_110117952 | 3300027886 | Agricultural Soil | RIDSVAQELRLTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0268265_108713351 | 3300028380 | Switchgrass Rhizosphere | RAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGLAEP |
| Ga0268264_101473961 | 3300028381 | Switchgrass Rhizosphere | LKAPGDRFDKKKDRTARIDFVAQEMRLTRKQAKRRIRNYEAWQRNIKKGIANPLD |
| Ga0268264_125771102 | 3300028381 | Switchgrass Rhizosphere | DRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVTP |
| Ga0272482_100638272 | 3300028578 | Soil | DKKKDRTERINHVARMMNLTRKQAKRRIKNYEQWQRNIKKGLVEP |
| Ga0307302_104235032 | 3300028814 | Soil | TRAYQIYLRAPGDRYDKKKDRTARIDSVANELRLTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0268240_101796042 | 3300030496 | Soil | GDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0307408_1011081832 | 3300031548 | Rhizosphere | PHNKKLDRTERINYVADKMRLTRKQAKRRVKNFEAWQRNIKKGLITP |
| Ga0310813_104589541 | 3300031716 | Soil | RTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0310813_107889862 | 3300031716 | Soil | LRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVRP |
| Ga0307473_109384231 | 3300031820 | Hardwood Forest Soil | TARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIVSP |
| Ga0310900_106121643 | 3300031908 | Soil | RYDKKKDRTTRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGVVTP |
| Ga0307409_1022459181 | 3300031995 | Rhizosphere | SYVAREMNLTHKQAKRRIRNYESWQRNIKKRLVEP |
| Ga0307416_1017861442 | 3300032002 | Rhizosphere | DRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIISP |
| Ga0310890_109452461 | 3300032075 | Soil | KKDRTTRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGVVTP |
| Ga0310895_103709471 | 3300032122 | Soil | THAYKLYLKAPGDRYDKKKDRTTRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGVVTP |
| Ga0307415_1017879342 | 3300032126 | Rhizosphere | INFVAARMNITRKQAKRRIKNFEAWQRNIKKGLVEP |
| Ga0310810_108761051 | 3300033412 | Soil | KDRTSRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIASP |
| Ga0310810_111340161 | 3300033412 | Soil | LRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIAT |
| Ga0334919_010977_2_181 | 3300034001 | Hypolithic Biocrust | RAYAIYKQAPGVQYDQKQDRTERINYVARVMRLTRKQAKRRIRNYEAWQRNIKKGLVSA |
| Ga0334922_033847_3_152 | 3300034003 | Hypolithic Biocrust | GAPHDKKLDRTERISYVAEKMNLTRKQAKRRIRNYEAWQRNIKKGLVSR |
| Ga0334930_001934_3146_3310 | 3300034005 | Sub-Biocrust Soil | YQAAPGVPHNKKLDRTERINYVADKMHLTRKQAKRRVKNFEAWQRNIKKGLITP |
| Ga0334944_097961_2_181 | 3300034009 | Sub-Biocrust Soil | TAYDHYLSAPGVPHNKKLDRTERINYVADKMHLTRKQAKRRVKNFEAWQRNIKKGLVTP |
| Ga0334950_071358_3_164 | 3300034028 | Biocrust | LAAPGVPHNKKLDRTERINYVADKMRLTRKQAKRRVKNFEAWQRNIKKGLVTP |
| Ga0364942_0101601_3_119 | 3300034165 | Sediment | ARIDSVAQELRLTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0364934_0165724_653_835 | 3300034178 | Sediment | TRAYQIYLQAPGDRYDKKKDRTARIDSVAQQLRLTRKQAKRRVRNYEAWQRNIKKGLVEP |
| Ga0334937_014499_1808_1990 | 3300034221 | Biocrust | VRAYQFYMAAPGVPHNKKLDRTERINYVAEKMHLTRKQAKRRVKNYEAWQRNIKKGLVTP |
| Ga0334945_039712_1_138 | 3300034779 | Sub-Biocrust Soil | DKKNDRTERINFVAEKMRLTRKQAKRRIRNYEAWQRNIKKGLVTR |
| Ga0334945_069493_1_147 | 3300034779 | Sub-Biocrust Soil | VPYDKKKDRTERIAYVARRLNLTHKQAKRRIRNYEAWQRNLQKGLVDA |
| Ga0373959_0114479_509_652 | 3300034820 | Rhizosphere Soil | RYDKKKDRTSRIDFVAQEMKLTRKQAKRRIRNYEAWQRNIKKGIASP |
| ⦗Top⦘ |