NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F011815

Metagenome / Metatranscriptome Family F011815

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F011815
Family Type Metagenome / Metatranscriptome
Number of Sequences 287
Average Sequence Length 114 residues
Representative Sequence ISKDLSFGVSYSQSSRNDHARTLCTKVATAITDYATNLLATVEAGPNETLTEQNAHNIAAIIFYDVQLQDNMSGLGMGEDGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Number of Associated Samples 206
Number of Associated Scaffolds 287

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 7.58 %
% of genes near scaffold ends (potentially truncated) 81.88 %
% of genes from short scaffolds (< 2000 bps) 96.52 %
Associated GOLD sequencing projects 191
AlphaFold2 3D model prediction Yes
3D model pTM-score0.72

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.516 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(38.328 % of family members)
Environment Ontology (ENVO) Unclassified
(68.641 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.714 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 56.20%    β-sheet: 0.00%    Coil/Unstructured: 43.80%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.72
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.47.1.1: STATd1bg1a11bg10.81486
a.7.1.1: Spectrin repeatd7a8ta17a8t0.70742
a.7.8.2: Phosphoinositide-binding clathrin adaptor, domain 2d1hf8a11hf80.70026
a.191.1.1: Methenyltetrahydrofolate cyclohydrolase-liked1o5ha_1o5h0.68057
a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domaind1egua11egu0.68014


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.52 %
UnclassifiedrootN/A3.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2149837002|Baltic_Sea__contig05359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300000947|BBAY92_10151102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300003294|Ga0006245J48900_103326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300004097|Ga0055584_102361350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300005043|Ga0071100_1056615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum942Open in IMG/M
3300005599|Ga0066841_10091683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300006383|Ga0075504_1310912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300006384|Ga0075516_1401210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300006400|Ga0075503_1453485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300006402|Ga0075511_1720066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300006425|Ga0075486_1848605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300006917|Ga0075472_10689623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum514Open in IMG/M
3300007681|Ga0102824_1153592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300008832|Ga0103951_10478756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum671Open in IMG/M
3300008936|Ga0103739_1008553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1175Open in IMG/M
3300008993|Ga0104258_1082192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300009025|Ga0103707_10076780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300009071|Ga0115566_10570731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300009077|Ga0115552_1323756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300009263|Ga0103872_1079950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300009436|Ga0115008_11515381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300009441|Ga0115007_10671587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300009441|Ga0115007_10792603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300009442|Ga0115563_1327538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300009445|Ga0115553_1319338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300009445|Ga0115553_1366681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300009495|Ga0115571_1319390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300009543|Ga0115099_10227420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300009593|Ga0115011_10844787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum762Open in IMG/M
3300009599|Ga0115103_1158398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300009599|Ga0115103_1308839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300009599|Ga0115103_1458800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300009606|Ga0115102_10444612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum862Open in IMG/M
3300009677|Ga0115104_10208878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300009677|Ga0115104_10501492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300009677|Ga0115104_10793922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300009677|Ga0115104_11177437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300009679|Ga0115105_10614571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300009679|Ga0115105_10902363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300009679|Ga0115105_11115912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum568Open in IMG/M
3300009705|Ga0115000_10854175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300009738|Ga0123379_1084640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300009785|Ga0115001_10476593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum773Open in IMG/M
3300009790|Ga0115012_10953421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300010981|Ga0138316_10290010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300010981|Ga0138316_10833904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300010981|Ga0138316_11396081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum911Open in IMG/M
3300010985|Ga0138326_11017968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300010985|Ga0138326_11449168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300010987|Ga0138324_10440791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300010987|Ga0138324_10622538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300012415|Ga0138263_1935426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300012418|Ga0138261_1618957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300012419|Ga0138260_10319184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300012965|Ga0129346_1025154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300016723|Ga0182085_1197802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300016729|Ga0182056_1021562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300016731|Ga0182094_1196875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300016740|Ga0182096_1250195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300016882|Ga0186577_106863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
3300017697|Ga0180120_10261686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum700Open in IMG/M
3300017725|Ga0181398_1092045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum724Open in IMG/M
3300017731|Ga0181416_1132064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300017756|Ga0181382_1149414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300017776|Ga0181394_1205114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300017783|Ga0181379_1257643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300017951|Ga0181577_10598353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300017964|Ga0181589_10454755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum835Open in IMG/M
3300017986|Ga0181569_10598446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum737Open in IMG/M
3300018418|Ga0181567_10773844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300018420|Ga0181563_10622488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300018424|Ga0181591_11109879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300018524|Ga0193057_110488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300018625|Ga0192842_1036350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300018628|Ga0193355_1023589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300018644|Ga0193352_1047347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300018670|Ga0192819_1037530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum607Open in IMG/M
3300018670|Ga0192819_1046941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300018670|Ga0192819_1051778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300018692|Ga0192944_1029526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum792Open in IMG/M
3300018701|Ga0193405_1044523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300018716|Ga0193324_1050445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300018725|Ga0193517_1042763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum830Open in IMG/M
3300018742|Ga0193138_1044847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300018746|Ga0193468_1049432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300018749|Ga0193392_1051664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300018765|Ga0193031_1042655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum743Open in IMG/M
3300018765|Ga0193031_1061632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300018765|Ga0193031_1080076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300018765|Ga0193031_1081400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300018765|Ga0193031_1086905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300018776|Ga0193407_1062250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300018779|Ga0193149_1023509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum861Open in IMG/M
3300018779|Ga0193149_1067573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300018787|Ga0193124_1049926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300018787|Ga0193124_1067099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300018823|Ga0193053_1083609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300018825|Ga0193048_1049106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300018827|Ga0193366_1067829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300018830|Ga0193191_1084426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300018832|Ga0194240_1029001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300018836|Ga0192870_1070034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300018842|Ga0193219_1074289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300018846|Ga0193253_1120708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300018862|Ga0193308_1067558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300018870|Ga0193533_1118531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300018870|Ga0193533_1118563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300018874|Ga0192977_1112787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300018874|Ga0192977_1116691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300018886|Ga0193185_1107391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300018922|Ga0193420_10080231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300018922|Ga0193420_10105366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300018928|Ga0193260_10139612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300018932|Ga0192820_10127981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300018932|Ga0192820_10137142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300018967|Ga0193178_10076442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300018974|Ga0192873_10430028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300018975|Ga0193006_10108520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum832Open in IMG/M
3300018977|Ga0193353_10169535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300018977|Ga0193353_10216540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300018977|Ga0193353_10218630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300018980|Ga0192961_10246472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300018989|Ga0193030_10104082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum876Open in IMG/M
3300018989|Ga0193030_10228821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300018989|Ga0193030_10274535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300018989|Ga0193030_10281200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300018989|Ga0193030_10307133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300018989|Ga0193030_10316664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300019001|Ga0193034_10140419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300019003|Ga0193033_10174845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300019010|Ga0193044_10230586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300019010|Ga0193044_10276597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300019021|Ga0192982_10285849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300019022|Ga0192951_10381368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300019025|Ga0193545_10130792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300019025|Ga0193545_10144451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300019027|Ga0192909_10185548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300019027|Ga0192909_10196648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300019027|Ga0192909_10262403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300019031|Ga0193516_10109074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum942Open in IMG/M
3300019031|Ga0193516_10159865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum759Open in IMG/M
3300019031|Ga0193516_10215302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300019033|Ga0193037_10272400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300019036|Ga0192945_10183123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300019036|Ga0192945_10263865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300019045|Ga0193336_10278230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum723Open in IMG/M
3300019045|Ga0193336_10382219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300019045|Ga0193336_10523994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300019081|Ga0188838_112795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300019097|Ga0193153_1033964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300019100|Ga0193045_1069271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300019102|Ga0194243_1007800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300019103|Ga0192946_1057583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300019116|Ga0193243_1051308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300019116|Ga0193243_1055266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300019117|Ga0193054_1066272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300019118|Ga0193157_1029158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300019120|Ga0193256_1088312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300019133|Ga0193089_1103295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300019133|Ga0193089_1128470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300019139|Ga0193047_1111155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300019141|Ga0193364_10110378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300019150|Ga0194244_10113212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300019150|Ga0194244_10115751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300019253|Ga0182064_1183528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300020382|Ga0211686_10164201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum916Open in IMG/M
3300021345|Ga0206688_10026536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum807Open in IMG/M
3300021345|Ga0206688_11099012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300021348|Ga0206695_1698007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300021350|Ga0206692_1697577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300021353|Ga0206693_1860958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1001Open in IMG/M
3300021355|Ga0206690_10050564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300021355|Ga0206690_11002110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum679Open in IMG/M
3300021359|Ga0206689_11202482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300021389|Ga0213868_10583755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300021872|Ga0063132_103101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300021872|Ga0063132_106862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum676Open in IMG/M
3300021879|Ga0063113_109658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum767Open in IMG/M
3300021881|Ga0063117_1022959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300021886|Ga0063114_1061835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300021886|Ga0063114_1074856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300021897|Ga0063873_1040902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300021906|Ga0063087_1046962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300021913|Ga0063104_1040242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300021922|Ga0063869_1012491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300021922|Ga0063869_1027000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300021923|Ga0063091_1136285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300021930|Ga0063145_1103370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300021941|Ga0063102_1028971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300021958|Ga0222718_10491033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300021959|Ga0222716_10384576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum820Open in IMG/M
3300023110|Ga0255743_10359436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum731Open in IMG/M
3300023178|Ga0255759_10461619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum754Open in IMG/M
3300023555|Ga0232120_108046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300023679|Ga0232113_1038002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300023683|Ga0228681_1037758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300023685|Ga0228686_1062612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300023704|Ga0228684_1080475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300024334|Ga0228671_1115004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300025886|Ga0209632_10442190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300025897|Ga0209425_10370468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300025897|Ga0209425_10371329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300025897|Ga0209425_10541332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300026420|Ga0247581_1078888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300026449|Ga0247593_1098966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300026465|Ga0247588_1098638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300026465|Ga0247588_1100572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300026465|Ga0247588_1110291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300026465|Ga0247588_1125521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300026468|Ga0247603_1113956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300026468|Ga0247603_1118499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300026470|Ga0247599_1116723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300026470|Ga0247599_1130055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300026495|Ga0247571_1170998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300026503|Ga0247605_1158965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300027752|Ga0209192_10295129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300027791|Ga0209830_10265784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum773Open in IMG/M
3300027791|Ga0209830_10347741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300027810|Ga0209302_10368210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300027849|Ga0209712_10606583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300028106|Ga0247596_1109143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300028106|Ga0247596_1115333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300028109|Ga0247582_1122954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum673Open in IMG/M
3300028109|Ga0247582_1137822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300028110|Ga0247584_1167685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300028124|Ga0228621_1039561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300028134|Ga0256411_1231149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300028137|Ga0256412_1072291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1229Open in IMG/M
3300028137|Ga0256412_1241394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium666Open in IMG/M
3300028137|Ga0256412_1252748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300028137|Ga0256412_1299737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300028137|Ga0256412_1344763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300028233|Ga0256417_1181311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300028282|Ga0256413_1242815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300028290|Ga0247572_1176553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300028333|Ga0247595_1047317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300028334|Ga0247597_1039725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300028595|Ga0272440_1102715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1018Open in IMG/M
3300028595|Ga0272440_1128594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum858Open in IMG/M
3300028595|Ga0272440_1146599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum776Open in IMG/M
3300030671|Ga0307403_10700837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300030699|Ga0307398_10819926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300030709|Ga0307400_11017020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300030724|Ga0308138_1052788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300030724|Ga0308138_1057895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300030724|Ga0308138_1064788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300030724|Ga0308138_1065175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300030780|Ga0073988_10002660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300030780|Ga0073988_12264889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300030780|Ga0073988_12331645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum648Open in IMG/M
3300030788|Ga0073964_11758954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300030856|Ga0073990_10010764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300030857|Ga0073981_11591615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum714Open in IMG/M
3300030912|Ga0073987_10008093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300030912|Ga0073987_10008268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300030912|Ga0073987_11209683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300030956|Ga0073944_11388744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300031036|Ga0073978_1010590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300031037|Ga0073979_12290684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300031062|Ga0073989_13608981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300031570|Ga0308144_1050829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300031622|Ga0302126_10275255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300031622|Ga0302126_10289868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300031674|Ga0307393_1154805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300031710|Ga0307386_10539967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300031735|Ga0307394_10186483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum812Open in IMG/M
3300031735|Ga0307394_10445985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300031742|Ga0307395_10191317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum868Open in IMG/M
3300031743|Ga0307382_10577492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300032011|Ga0315316_11285665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300032047|Ga0315330_10863035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300032519|Ga0314676_10863220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300032615|Ga0314674_10690571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300032666|Ga0314678_10566943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300032711|Ga0314681_10828596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300032749|Ga0314691_10462307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300032820|Ga0310342_101402377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum830Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine38.33%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.65%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater13.94%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.53%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.14%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.44%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.44%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.09%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.74%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.74%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment1.05%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.05%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.70%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.70%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.70%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.35%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.35%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.35%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.35%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.35%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.35%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.35%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.35%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2149837002Marine microbial communities from the Baltic SeaEnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300003294Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C27A4_35 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005599Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91AEnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006425Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009738Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_244_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016729Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016731Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016882Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with 33 psu seawater, 19 C, 33 psu salinity and 331 ?mol photons light - Strombidium rassoulzadegani ras09 (MMETSP0449_2)Host-AssociatedOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018524Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002422 (ERX1782099-ERR1711883)EnvironmentalOpen in IMG/M
3300018625Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000598 (ERX1782204-ERR1712199)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018644Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782112-ERR1712144)EnvironmentalOpen in IMG/M
3300018670Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782175-ERR1712065)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018701Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789579-ERR1719459)EnvironmentalOpen in IMG/M
3300018716Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001728 (ERX1789726-ERR1719299)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018746Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002179 (ERX1789625-ERR1719155)EnvironmentalOpen in IMG/M
3300018749Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789662-ERR1719448)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018827Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001938 (ERX1782415-ERR1712182)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018886Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000029 (ERX1782302-ERR1711968)EnvironmentalOpen in IMG/M
3300018922Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789394-ERR1719405)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018932Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782293-ERR1711916)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019081Metatranscriptome of marine microbial communities from Baltic Sea - GS676_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019100Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839)EnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019120Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789686-ERR1719360)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019141Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001937 (ERX1789668-ERR1719463)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021879Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021886Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021897Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 20m ARK-7M ARK-7-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021906Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021923Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-8M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300023110Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaGEnvironmentalOpen in IMG/M
3300023178Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaGEnvironmentalOpen in IMG/M
3300023555Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 89R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024334Seawater microbial communities from Monterey Bay, California, United States - 89DEnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028124Seawater microbial communities from Monterey Bay, California, United States - 25DEnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030956Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031570Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Baltic_Sea_002006102149837002MarineDLDQISKDLSFGVSYSQQKRNDHARALCNKVGDAILGYADGITAQVEAKTNESMTEMNAHNISAMIFYDVQLQEFMNGLGMAANDALILAVNRLKSLQKLYLFEQKGGENYLG
BBAY92_1015110213300000947Macroalgal SurfaceLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0006245J48900_10332623300003294SeawaterMSFGVSYSQNKRNDHGQALVTKVSNAIIDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQVEDAAAALAMPKNEDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0055584_10236135013300004097Pelagic MarineMSFGISYSQNKRNDHGQALVTKVSNAIIDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQAEDAAAALAMPKNEDLVLAVNRLKSL*
Ga0071100_105661513300005043Marine Subseafloor AquiferLEQINKDLSFGISFSQTKRNDHARELCTKVSSAIKDYSSKILQKIEAGPSETLTEQNEHNLAAIIYYDVQVQDAMKRLGVADDGELVLAVNRLKSLQKLYLFEQKGGENYLD*
Ga0066841_1009168313300005599MarineFGVSYSQNKRNDHGQALVTKVSNAIIDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQAEDAAAALAMPKNEDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0075504_131091213300006383AqueousQNAMFETVRKNLDQINKDMSFGISYSQTGRNEHARGLCADTAALLLAYANAIIAKTESGPNESLTEQNAHNIARAIFYDVQLQDAMAGLGVAENTALSLSVNRLKSLQKLYLFEQKGGENYLG*
Ga0075516_140121013300006384AqueousSVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0075503_145348513300006400AqueousAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDFMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0075511_172006613300006402AqueousKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*VS*
Ga0075486_184860513300006425AqueousINKDLSFGVSFSQTARNDHARELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANSDLNLAINRLKSLQKLYLFEQKGGENYLG*T**
Ga0075472_1068962313300006917AqueousKRNPQKENLDTLRGILEAINRDMSFGVSYAQRKRNNQARANCTLAATKIKDYANALIARIESGPNETLTEQNAHNMAAYIFFDVQLQDAMSGLGMAEDGDLTLAINRLKSLQKLYLFEQKGGENYLG*
Ga0102824_115359213300007681EstuarineEQINKDLSFGVSFSQTSRNEHAKELVTKAGNAILDYASKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0103951_1047875613300008832MarineTSLRAEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGSDDELVLAVNRLKSL*
Ga0103739_100855333300008936Ice Edge, Mcmurdo Sound, AntarcticaMSFGISYSQTKRNDTARDTCTKVAGSILDYANKLIGKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL*
Ga0104258_108219213300008993Ocean WaterVKKNPQLETMTTIKLDLDQISKDLSFGVSYSQQKRNDHARTLCTKVAAAIQAYADGVTAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMTGLGMAMDDTLILAVNRLKSLQKLYLFEQKGGENYLS*
Ga0103707_1007678013300009025Ocean WaterVSQEAINTDMSFGVSYSQTKRNDTARDLCTKVGASILDYATKLIAKVEGGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQKGGENYLG*
Ga0115566_1057073113300009071Pelagic MarineINKDMSFGISYSQRARNEHARETATTTSGLIKTYADEMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF*
Ga0115552_132375623300009077Pelagic MarineSFGISFSQSKRNDHARELCTKVATGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0103872_107995013300009263Surface Ocean WaterQAALLASIKVDLEAINTNMSFGVSYSQTKRNDTARDLCTKVGVSILGYANNLIAKVESGPNETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQQGGENYLG*
Ga0115008_1151538113300009436MarineVSFSQGARNEHAKELVTKAGASILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMSANGDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115007_1067158713300009441MarineNLDQISKDLSFGVSYSQSSRNDHARALTTTVATAITSYADTLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQTAPDTLILAVNRLKTLQKLYLFEQKGGENYLG*
Ga0115007_1079260313300009441MarineKRNDHARELCTKVGAAIEDYSTKLLGKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMAANGDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115563_132753813300009442Pelagic MarineMSFGVSYSQSKRNDSGRDLCNKVSTAILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115553_131933813300009445Pelagic MarineVSFSQGKRNDHAKELCTKVSNSIVGYSKKLITKVEGNSNETLTEQNAHNIAAMIFYDVQLEDAMKALGMSSDEERTLYVNRLKSLQKLYLFEQKGGENYLG*
Ga0115553_136668113300009445Pelagic MarineHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSTKLLGKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMAANGDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115571_131939013300009495Pelagic MarineLSFGISFSQTKRNDHARELCTKVASSIMDYSSNLLTTTEAGPEETLTEQNAANLASIMFYDVQLQDAMKGLGMPENGELVLAVNRMKSLQKLYLFEQKGGENYLG*
Ga0115099_1022742013300009543MarineKALKNPQNTVLVTIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0115011_1084478723300009593MarineAARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYAANLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0115103_115839823300009599MarineRANLDQINKDMSFGISYSQRARNEHARELATTTSGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLGF*
Ga0115103_130883913300009599MarineDLEQINKDLSFGVSFSQGARNEHAKELVTKAGSSILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAPNGDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115103_145880013300009599MarineLETMTTIKLDLDQISKDLSFGVSYSQQKRNDHARTLCTKVAAAIQAYADGVTAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMTGLGMAMDDTLILAVNRLKSLQKLYLFEQKGGENYLS*
Ga0115102_1044461213300009606MarineLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGGDDELVLAVNRLKSL*
Ga0115104_1012781123300009677MarineSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMTSDDELVLAVNRLKSL*
Ga0115104_1020887813300009677MarineAAKVKKNPQAALLQTIKADLEGINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMSGLGMSSDDELVLAVNRLKSL*
Ga0115104_1050149213300009677MarineKVSVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEHARDLATATSTLIKDYSQQMIDKTESGPNETLTEQNAHNIAATIFFDVQLQDFMAGLGMAADEDLVLAMNRMKSLQKLYLFEQKGGEDYLG*
Ga0115104_1079392213300009677MarineALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0115104_1117743713300009677MarineANDYFSQVRSNLDQINKDMSFGISYSQKTRNEHARDLCTATATLIKDYADDMIDKTETGPNETLTEQNAHNIAASIFFDVQLQDFMAGLGMAADDDLILAVNRLKSLQKLYLFEQKGGEDYLG*
Ga0115105_1061457113300009679MarineSFSQTKRNDHARETCLKVAKAIKDYTGKLLAKVEGAPNEVLTEQNAHNIAAVIFYDVQLQDNMAGLGMGGDADLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115105_1090236313300009679MarineVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCTKVGGSVLDYANKLIAKVESGPNETLTEQNAHNIAAVIFYDVQLQDAMAGLGMTENSDLVLAINRLKSLQKLYLFEQQGGENYLG*
Ga0115105_1111591213300009679MarineAKTLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0115000_1085417513300009705MarineSGVSFSQTKQNDHARETCTKVATTVKDYASKLLSKVEAKPNEVLTEQNAHNLAAIIFYDVQLQENMKELGMKVDGELILAINRMKSLQKLYLFEQKGGENYLE*
Ga0123379_108464013300009738MarineNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDTARDLCTKVGVSILGYANNLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG*
Ga0115001_1047659313300009785MarineALLQTIKADLEGINGDLSFGISFSQTKKNDHARELCQKISKAIKDYTSKLLSKVEAAPNEVLTEQNAHNIAAVIFYDVQLQDNMSGLGMGSDDELVLAVNRLKSL*
Ga0115012_1095342113300009790MarineISKDLSFGVSYSQSSRNDHARTLCTKVATAITDYATNLLATVEAGPNETLTEQNAHNIAAIIFYDVQLQDNMSGLGMGEDGDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0138316_1029001023300010981MarineMSFGVSYSQNKRNDHGQALVTKVSNAIIDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQAEDAAAALAMPKNEDLVLAVNRLKSLQKLYLFEQKG
Ga0138316_1083390413300010981MarineMSFGVSYSQTKRNDSARELCTKVGTAISDYSTKLISKVESSPNETLTEQNAHNIAAVIFYDVQLQDYMAGLGMPANADLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0138316_1139608113300010981MarineMKADLEQINKDMSFGVSFSQSKRNDHARELCTKVSNAIQDYAGKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEQAELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0138326_1101796813300010985MarineQTALLQAIKADLETINADLSFGISFSQTKRNDHARELCTKVGTAIQDYASKLLAKVESGPNETLTEQNAHNIASVIFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0138326_1144916813300010985MarineMSFGISYSQNKRNDHGQALVTKVSNAIIDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQAEDAAAALAMPKNEDLVLAVNRLKSLQKLYLFEQKG
Ga0138324_1044079113300010987MarineMSFGISYSQNKRNDHGQALVTKVSNAIIDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQAEDAAAALAMPKNEDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0138324_1062253813300010987MarineVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCTKVGSAILDYATKLITKVEGGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQQGGENYLG*
Ga0138263_193542613300012415Polar MarineAREEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSSILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAADGKLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0138261_161895713300012418Polar MarineMKTDLEQINKDMSFGVSFSQTKRNDHARELSTKVGEAIKDYSSKLLAKIEVSPSEVLTEQNAHNIAAVIFYDVQLQDASKGLGAPEDGELVLAVNRLKSL*
Ga0138260_1031918413300012419Polar MarineINKDLSFGISFSQTKRNDHARELCTKVASSVMDYSSNLLTTTEAGPEETLTEQNAANLASVIFYDVQLQDSMKGLGMPENGELVLAVNRMKSL*
Ga0129346_102515413300012965AqueousARAEAAKVKKNPQESLFTTVSANLDQINKDMSFGISYSQTSRNEHARGLCADTAALLLAYANAIIAKTEGGPNESLTEQNAHNIAKAIFYDVQLQDAMAGLGVAENTALSLSVNRLKSLQKLYLFEQKGGENYLG*
Ga0182085_119780213300016723Salt MarshAEAAKVKKNPQNDMFETVRKNLDQINKDMSFGISYSQTGRNEHARGLCADTAALLLAYANAIITKTESGPNESLTEQNAHNIAKAIFYDVQLQDAMAGLGAPENTALSLSVNRLKSLQKLYLFEQKGGENYLG
Ga0182056_102156213300016729Salt MarshFETVRKNLDQINKDMSFGISYSQTGRNEHARGLCADTAALLLAYANAIITKTESGPNESLTEQNAHNIAKAIFYDVQLQDAMAGLGAPENTALSLSVNRLKSLQKLYLFEQKGGENYLG
Ga0182094_119687513300016731Salt MarshEAAKVKKNPQNDMFETVRKNLDQINKDMSFGISYSQTGRNEHARGLCADTAALLLAYANAIITKTESGPNESLTEQNAHNIAKAIFYDVQLQDAMAGLGAPENTALSLSVNRLKSLQKLYLFEQKGGENYLG
Ga0182096_125019523300016740Salt MarshARAEAAKVRKNPQASLLASVKADLEQINKDLSFGVSFSQAKRNDHARELSLKVSNAIVDYAKKLIAKVETKPDEALTEQNAHNIASMIFYDVQLEDAQKSLGVTPDAERTLAVNRLKSLQKLYLFEQKGGENYLG
Ga0186577_10686323300016882Host-AssociatedMSFGVSFSQTKRNDHARELSTKVSTAIKEYSAKLLTKVESQAVETLTEQNAHNIAAVIFYDVQLQDAMKGLGMTEDADLVLAVNRLKSLQKLYLFEQRGGENYLG
Ga0180120_1026168613300017697Freshwater To Marine Saline GradientADAAKVLKNPQSQLLASIKTDLDQINKDLSFGISFSQTKRNDHARELCTKVASSIMDYSSNLLTTTEAGPEETLTEQNAANLASIMFYDVQLQDAMKGLGMPENGELVLAVNRMKSLQKLYLFEQKGGENYLG
Ga0181398_109204523300017725SeawaterKTDLDQISKDLSFGVSYSQSSRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0181416_113206423300017731SeawaterAAKVKKNPQAALLTSIRADLEQINKDLSFGVSFSQGKRNDHAKELVNKVSSAILDYAGKLIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAAAALGMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLGXALX
Ga0181382_114941413300017756SeawaterRDALLATIKADLEAINTNMSFGVSYSQTKRNSSARELCEKVSTAIETYAGNLIEKVEGGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0181394_120511413300017776SeawaterEEAAKVAVNPANEFFGSVRSNLDQINKDMSFGISYSQRARNEHARELATTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAEDEDLVLAVNRLKSLQKLYLFEQKGGEDYLG
Ga0181379_125764313300017783SeawaterVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDSARDTCKKVASSILDYSNKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLAVN
Ga0181577_1059835313300017951Salt MarshSVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0181589_1045475513300017964Salt MarshMSFGVSYSQSARNTEAKTLCAKVATSIKSYANGLIGKIEGSPVSALTEQNAHNMAAIIFYDVLLEDAMKGLGVEEDADLVLATNRLKSLQKLYLFEQKGGENYLS
Ga0181569_1059844613300017986Salt MarshAAKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0181567_1077384413300018418Salt MarshVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYATKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLGXAKSILVMQEL
Ga0181563_1062248813300018420Salt MarshTGRNEHARGLCSDTAALLLAYANAIIAKTESGPNESLTEQNAHNIATAIFYDVQLQDAASGLGMAALDDLTLSVNRLKSLQKLYLFEQKGGENYLG
Ga0181591_1110987923300018424Salt MarshDKINTNMSFGVSYSQSARNTEAKTLCAKVATSIKSYANGLIGKIEGSPVSALTEQNAHNMAAIIFYDVLLEDAMKGLGVEEDADLVLATNRLKSLQKLYLFEQKGGENYLS
Ga0193057_11048823300018524MarineVSFSQSKRNDHARELCTKVSNAIQDYAGKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEQAELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192842_103635013300018625MarineSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193355_102358913300018628MarineGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVFNEGRNSLDVSLXNQ
Ga0193352_104734713300018644MarineKADLEGINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMSGLGMASDDELVLAVNRLKSL
Ga0192819_103753013300018670MarineNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0192819_104694113300018670MarineGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0192819_105177813300018670MarineMGDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVINEGXNSLTVSLXNQXE
Ga0192944_102952623300018692MarineMSFGISYSQTKRNDTARDTCTKVAGSILDYANKLIGKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0193405_104452313300018701MarineAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193324_105044513300018716MarineMSFGVSYSQNKRNDHGQALVTKVSNAIIDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQVEDAAAALAMPKNEDLVLAVNRLKSLQ
Ga0193517_104276313300018725MarineMKADLEQINKDMSFGVSFSQSKRNDHARELCTKVSNAIQDYAAKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEQAELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193138_104484713300018742MarineLQSIKADLEQINADLSFGISFSQTNRNDHARQLCSKVAKAIKDYSAKLLTKVEAGPNETLTEQNAHNIAAIIFYDVQLQDNMAGLGMGEDGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193468_104943213300018746MarineKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193392_105166413300018749MarinePANEFFASVRENLDQINKDMSFGISYSQRTRNEAARDLCTTTADLIKTYADRMIQKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADEDLILAMNRLKSLQKLYLFEQKGGEDYLG
Ga0193031_104265513300018765MarineLSFGISFSQTKRNDHARETCLKVAKAIKDYSDKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMGADEDLVLAVNRLKSL
Ga0193031_106163213300018765MarineESARAEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGADDELVLAVNRLKS
Ga0193031_108007613300018765MarineAALLASIKADLEAINTNMSFGVSYSQTKRNDSARDLSTKVAGAILDYATKLIAKVEGGPNETLTEQNAHNIAAVIFYDVQLQDAMSGLGMSENSELVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193031_108140013300018765MarineLASIKADLEAVNTDMSFGVSYSQTKRNDTARDLCTKVGASVLDYATKLIAKVEGGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193031_108690513300018765MarineEAVNTDMSFGVSYSQTKRNDTARDLCTKVGTSILDYATKLIAKVESGANETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENSDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193407_106225013300018776MarineMSFGVSYSQTKRNDTARDLCTKVGSSILDYATKLIAKVEGGPNETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193149_102350913300018779MarineMKADLEQINKDMSFGVSFSQSKRNDHARELCTKVSNAIQDYAGKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEQAELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193149_106757313300018779MarineQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193124_104992613300018787MarineSEAAKVKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193124_106709913300018787MarineFGVSYSQSTRNDHARTLCTKVATAITHYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193053_108360913300018823MarineNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDNARDLCTKVGTSILDYADKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENADLVLAINRLKSLQKLYLFEQKGGENYLG
Ga0193048_104910613300018825MarineAHEAARSEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVL
Ga0193366_106782913300018827MarineSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193191_108442613300018830MarineAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0194240_102900113300018832MarineKTDLDQISKDLSFGISFSQTKRNDHARELATKVAGSIQDYCSNLLTTTEAGPEETLTEQNAANIASIIFYDVQLQDAMKGLGMPENGELVLAINRMKSLQKLYLFEQKGGENYLGXKINEDLKSSQ
Ga0192870_107003413300018836MarineLATIKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGVAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLGXESXGVLATLLVTEMLTM
Ga0193219_107428913300018842MarineLEAINTNMSFGVSYSQSKRNDSARDLCSKVSTAILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193253_112070813300018846MarineNPQDTLFTTVKENLEKINTDMSFGVSYSQKARNEHARGVITETSAALLAYANSMIAKTESGPNESLTEQNAHNIAKAIFYDVQLQDAAKGLGMADDTALGLSINRLKSLQKLYLFEQKGGENYLG
Ga0193308_106755813300018862MarineAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0193533_111853113300018870MarinePQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193533_111856313300018870MarinePQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0192977_111278713300018874MarineMKTDLEQINKDMSFGVSFSQTKRNDHARELSTKVGEAIKDYSSKLLAKIEVSPSEVLTEQNAHNIAAVIFYDVQLQDASKGLGAPEDGELVLAVNRLKSL
Ga0192977_111669113300018874MarineSQSKRNDHARELCTKVSGSIQDYASNLLTTTEAGPEETLTEQNAANIASVLFYDVQLQDAIKGLGMPEQGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193185_110739113300018886MarineAAHEAARSEAAKVKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193420_1008023113300018922MarineQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193420_1010536613300018922MarineLDKISKDLSFGVSYSQRTRNEHARGICTATAKVLKDYGDAMIKKTEGSPNESLTEQNAHNIATAIFYDVQLQDFMAGLGMAADGDLTLSINRLKSLQKLYLFEQKGGENYLG
Ga0193260_1013961213300018928MarineLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQIQDAGNALGMAPNGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192820_1012798113300018932MarineRNDHARELCTKVANSIMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVINEGXNSLTVSLXNQXE
Ga0192820_1013714223300018932MarineDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193178_1007644213300018967MarineFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMHGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0192873_1043002813300018974MarineMGKRNDHARDLCRKVETAIEGYASNLLTTIEAGPNETLTEQNAHNIAAMIFYDVQLQDFMTGLGMSATDDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193006_1010852023300018975MarineLSFGISFSQTKRNDHARETCLKVAKAIKDYSDKLLSKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEDLVLAVNRLKSL
Ga0193353_1016953513300018977MarineARAEAAKVKKNPQSALLQTIKADLETINAELSFGISFSQTKRNDHARETCLKVAKAIKDYTGKLLAKVEGAPNEVLTEQNAHNIAAVIFYDVQLQDNMSGLGMGGDADLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193353_1021654013300018977MarineAEAAKVKKNPQSALLQSIKADLEQINADLSFGISFSQTKRNDHARSLCLKVAKAIKDYSAKLLTKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMGEDGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193353_1021863013300018977MarineLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0192961_1024647213300018980MarineHARELCTKVANGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVL
Ga0193030_1010408213300018989MarineMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSDKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMGADEDLVLAVNRLKSL
Ga0193030_1022882113300018989MarineNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193030_1027453513300018989MarineGVSFSQSKRNDHARDLVKKVATAIKDYSTKLLEKVEAGANESLTEQNAHNIAAIIFYDVQLQDAQAGLGMPADGDLVLAVNRLKSLQKLYLFEQKGGENYLS
Ga0193030_1028120013300018989MarineNADLSFGISFSQTKRNDHARETSLKVAKAIKDYSDKLLKKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEDLVLAVNRLKSL
Ga0193030_1030713313300018989MarineSFSQSKRNDHARELCTKVANSLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193030_1031666413300018989MarineEYFASVRENLDQINKDMSFGISYSQRTRNEHARDLCTSTATLIKDYADEMIAKTEGGPNETLTEQNAHNIAASIFFDVQLQDFMAGLGMAADDDLILAVNRLKSLQKLYLFEQKGGEDYL
Ga0193034_1014041913300019001MarineKRNDHARELCTKVSNAIQDYAAKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEAAELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193033_1017484513300019003MarineALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193044_1023058613300019010MarineAEAAKALKNPQSQVLATIKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGVAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193044_1027659713300019010MarineQSKRNDHARELCTKVANGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0192982_1028584913300019021MarineASIKTDLDQISKDLSFGISFSQSKRNDHARELCTKVSGSIQDYASNLLTTTEAGPEETLTEQNAANIASVLFYDVQLQDAIKGLGMPEQGELVLAMNRMKSLQKLYLFEQKGGENYLGXMINEDXKSSQ
Ga0192951_1038136813300019022MarineHGGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193545_1013079213300019025MarineGSNLDQINKDMSFGISYSQKTRNEHARDLCTATATLIKDYADDMIDKTETGPNETLTEQNAHNIAASIFFDVQLQDFMAGLGMAADDDLILAVNRLKSLQKLYLFEQKGGEDYLG
Ga0193545_1014445113300019025MarineGNLDQINKDMSFGISYSQRTRNEAARDLCTTTADLIKTYADRMIQKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAMNRLKSLQKLYLFEQKGGEDYLG
Ga0192909_1018554813300019027MarineHGEAAKVKKNPQQPLLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNALGMAPNGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192909_1019664813300019027MarineTWVNADLSFGISFSQTKRNDHARETCQKVAKAIKDYTSKLLAKIETGPNEVLTEQNAHNIAAVIFYDVQLQDNMAGLGMGADDELVLAVNRLKSL
Ga0192909_1022820623300019027MarineMGVKKNPQAALLASIKADLEAINNDMSFGVSYSQTKRNDTARDLCSKVATAILDYSTKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMTENSDLVLNVNRLKSLQKLYLFEQKGGENYLG
Ga0192909_1026240313300019027MarineDQINKDMSFGISYSQKTRNEHARDLCTATATLIKDYADDMIDKTETGPNETLTEQNAHNIAASIFFDVQLQDFMAGLGMAADDDLILAVNRLKSLQKLYLFEQKGGEDYLG
Ga0193516_1010907423300019031MarineMKADLETINADLSFGISFSQTKRNDHARELCQKVGKAIKDYTSKLLSKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMPSDDELVLAVNRLKSL
Ga0193516_1015986513300019031MarineMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSDKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEDLVLAVNRLKSL
Ga0193516_1021530213300019031MarineLETINADLSFGISFSQTKRNDHARELCQKVAKAIKDYTSKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMASDDELVLAVNRLKSL
Ga0193516_1027857013300019031MarineTKRNDHARELCQKVAKAIEDYSDKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMPSDAKLVLSVNRLKSLQKLYLFEQKGGENYLG
Ga0193516_1028813213300019031MarineVTKVSNAIIDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQVEDAAAALAMPKNEDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193037_1027240013300019033MarineDLEQINKDLSFGVSFSQSARNAHAKELVTKAGNTVLDYATKLIAKVESGSDETLTEQNAHNIAAMIFYDVQIEDAAAALAMPPNADLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192945_1018312313300019036MarineTIKADLEGINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMTSDDELVLAVNRLKSL
Ga0192945_1026386513300019036MarineNPANEFFASVRANLDQINKDMSFGISYSQRTRNEAARDMCTDTSTLIKTYADRMIEKTETGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADDDLVLAMNRLKSLQKLYLFEQKGGDDYLGF
Ga0193336_1027823023300019045MarineAARAEAAKTLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193336_1038221913300019045MarineHGISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193336_1052399413300019045MarineAREEAAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEHARDLATSTSTLIKDYAQQMIDKTESGPNETLTEQNAHNIAATIFFDVQLQDFMAGLGMAADEDLVLAMNRMKSLQKLYLFEQKGGEDYLG
Ga0192826_1017269813300019051MarineARSNAAKVTKNPQASLLASIKADLDQINKDVSFGVSFSQNPRNTHAKELCVKIANAIQDYSDALVKKTDSNPNETLTEQNAHNMAQVIFYDVQLQDNMALLGMPANAELNLSVNRLKSLQKLYLFEQKGGENYLD
Ga0188838_11279513300019081Freshwater LakeSKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDFMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193153_103396413300019097MarineKRNDHARELCTKVANSMMDYTSNLLSTTESGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193045_106927113300019100MarineQVLATIKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGVAAPDDLVLAVNRLKSLQKLYLFEQKGGENYL
Ga0194243_100780013300019102MarineIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0192946_105758313300019103MarineGISFSQSKRNDHARELCTKVANGLQDYTSNLLSTTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVL
Ga0193243_105130813300019116MarineQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193243_105526613300019116MarineQISKDLSFGISFSQSKRNDHARELCTKVANSMMDYTSNLLSTTESGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193054_106627213300019117MarineTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193157_102915813300019118MarineKDVSFGISYSQKTRNGNAKTLCTDTATLLKTYADAVIAKTEGGPNESLTEQNAHNIAMAIFFDVQLQDFMSGLGMAADDALSLSVNRLKSLQKLYLFEQKGGENYLG
Ga0193256_108831213300019120MarineQAALLASIKADLEAVNNDMSFGVSYSQTKRNDTARDLCSKVATSILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMTENSELVLAVNRLKSLQKLYLFEQRGGENYLG
Ga0193089_110329513300019133MarineMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0193089_112847013300019133MarinePQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSSKLLAKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMAGNGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193047_111115513300019139MarineDLDQISKDLSFGVSYSQAKRNDHARDLCRKVETAIEGYASNLLTTIEAGPNETLTEQNAHNIAAMIFYDVQLQDFMTGLGMSATDDLVLAVNRLKSLQKLYLFEQKGGENYLGXVR
Ga0193364_1011037813300019141MarineKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0194244_1011321213300019150MarineHGKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0194244_1011575113300019150MarineTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0182064_118352813300019253Salt MarshNPQTALLDSIRADLEQINKDLSFGVSFSQSARNDHARELVTKASTAILGYANALIAKVDSASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANADLNLAINRLKSLQKLYLFEQKGGENYLG
Ga0211686_1016420113300020382MarineMSFGISYSQTKRNDTARDTCTKVAGSILDYANKLIGKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENGELVLAVNRMKSL
Ga0206688_1002653623300021345SeawaterMKADLEQINADLSFGISFSQTKRNDHARELCTKVAAAIKEYSTKLLTKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMGGLGMGEDGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206688_1109901213300021345SeawaterAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0206695_169800713300021348SeawaterAKALKNPQSQVLATIKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGVAAPDDLVLSVHRHNSGQVVYLFEQKGGENYLG
Ga0206692_169757713300021350SeawaterKKNPQTSFFEDIRANLNQISKDLSFGVSFSQKTRNDHARGLVTDTAKSLKKYADGMIAKTEATPNESLTEQNTHNIATAIFYDVQLQDAASGLGMAALDDLTLSVNRLKSLQKLYLFEQKGGENYLG
Ga0206693_186095813300021353SeawaterMKADLEQINKDMSFGVSFSQSKRNDHARELCTKVSNAIQDYASKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEQAELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206690_1005056413300021355SeawaterSFSQTNRNDHARELCLKVAKAIKDYSAKLLTKVEAGPNETLTEQNAHNIAAIIFYDVQLQDNMGGLGMGEDGELILAVNRLKSLQKLYLFE
Ga0206690_1100211023300021355SeawaterMKADLEQINKDMSFGVSFSQSKRNDHARELCTKVSNAIQDYATKLLTKVESGANESLTEQNAHNIGAVIFYYVQLQDAMKGLGMPEQAELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206689_1120248213300021359SeawaterRNDHARQLCLKVAKAIKDYSAKLLTKVEAGPNETLTEQNAHNIAAIIFYDVQLQDNMGGLGMGEDGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0213868_1058375513300021389SeawaterKRNDHARELCTKVASSIMDYSSNLLTTTEAGPEETLTEQNAANLASIMFYDVQLQDAMKGLGMPENGELVLAVNRMKSLQKLYLFEQKGGENYLG
Ga0063132_10310113300021872MarineKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANSMMDYTSNLLSTTESGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0063132_10686223300021872MarineVKADLESVNADLSFGISFSQTKRNDHARETCQKVGKAIKDYTSKLLAKIESAPNEVLTEQNAHNIAAIIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063113_10965823300021879MarineMKADLEQINKDMSFGVSFSQSKRNDHARELCTKVANAIEDYAGKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEASELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063117_102295913300021881MarineALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLCTKVATAITDYATNLLATVEAGPXETMTEQNAHNIAAMIXYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0063114_106183513300021886MarineDLEQINKDMSFGVSFSQSKRNDHARELCTKVSNAIQDYAGKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEQAELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063114_107485623300021886MarineMSFGVSYSQTKRNDSARELCTKVGTAISDYSTKLISKVESSPNETLTEQNAHNIAAVIFYDVQLQDYMAGLGMPANADLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063873_104090213300021897MarineQISKDLSFGVSYSQSSRNDHARALTTTVATAITSYADTLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQTAPDTLILAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0063087_104696213300021906MarineAEAAKAMKNPQNSVLATIKENLDQISKDLSFGVSYSQSSRNDHARALTTTVATAITSYADTLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQTAPDTLILAVNRLKTLQKLYLFEQKGGENYLG
Ga0063104_104024213300021913MarineGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063869_101249113300021922MarineARAEAAKALKNPQQSVLATIKTDLDQISKDLSFGVSYSQAKRNDHARELCTKVQTAIEGYASNLLTTIEAGPNETLTEQNAHNIAAMIFYDVQLQDFMTGLGVSASDDLVLAVNRLKSLQKLYLFEQKGGENYLGXVR
Ga0063869_102700013300021922MarineKALKNPQSQVLATIKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGVAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063091_113628513300021923MarineSEAAKVTKNPQSQLLASIKSDLDQISKDLSFGISFSQSKRNDHARELATKVSGSIQDYCSNLLTTTEAGPEETLTEQNAANIASVIFYDVQLQDAMKGLGMPEQGELVLAINRMKSLQKLYLFEQKGGENYLG
Ga0063145_110337013300021930MarineKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVATGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0063102_102897113300021941MarineLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSSILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMSANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0222718_1049103313300021958Estuarine WaterADLEQINKDLSFGVSFSQGARNEHAKELVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLGXAKTFLXNKNYKRISEKHYHFDLLT
Ga0222716_1038457623300021959Estuarine WaterAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGGDDELVLAVNRLKSL
Ga0255743_1035943623300023110Salt MarshKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0255759_1046161913300023178Salt MarshEAARAEAAKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0232120_10804613300023555SeawaterSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGVAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLGXESXGVLATLLETEMLTM
Ga0232113_103800213300023679SeawaterFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0228681_103775813300023683SeawaterTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVL
Ga0228686_106261213300023685SeawaterLDLDQISKDLSFGVSYSQQKRNDHARALCTKVAAAIQAYADGVTAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMTGLGMAMDDTLILAVNRLKSLQKLYLFEQKGGENYLS
Ga0228684_108047513300023704SeawaterRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTSILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAPNGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0228671_111500423300024334SeawaterRNDHARDLCRKVETAIEGYASNLLTTIEAGPNETLTEQNAHNIAAMIFYDVQLQDFMTGLGMSATDDLVLAVNRLKSLQKLYLFEQKGGENYLGXESXGVLATLLETEMLTM
Ga0209198_119946213300025640Pelagic MarineGRDLCNKVSTAILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0209632_1044219023300025886Pelagic MarineQAALLASIKADLEAINTNMSFGVSYSQSKRNDSGRDLCNKVSTAILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0209425_1037046813300025897Pelagic MarineVAVNPANEFFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0209425_1037132913300025897Pelagic MarineQTARNDHARELVTKASGAILGYANALIAKVDTASDETLTEQNAHNIAQMIFYDVQVQDAGAALAMAPNTDLNLAINRLKSLQKLYLFEQKGGENYLGXAAXCFSRKKHQIAEK
Ga0209425_1054133213300025897Pelagic MarineNDMSFGISYSQNKRNDHGQALVTKVSNAIIDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQAEDAAAALAMPKNEDLVLAVNRLKSL
Ga0247581_107888813300026420SeawaterLDQISKDLSFGVSYSQQKRNDHARTLCTKVAAAIQAYADGVTAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMTGLGMAMDDTLILAVNRLKSLQKLYLFEQTGGENYLS
Ga0247593_109896613300026449SeawaterKNPQLETMTTIKLDLDQISKDLSFGVSYSQQKRNDHARTLCTKVAAAIQAYADGVTAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMTGLGMAMDDTLILAVNRLKSLQKLYLFEQKGGENYLS
Ga0247588_109863813300026465SeawaterVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0247588_110057213300026465SeawaterAEAAKVKKNPQLETMTTIKLDLDQISKDLSFGVSHSQQKRNDHARTLCTKVAAAIQAYADGVTAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMTGLGMAMDDTLILAVNRLKSLQKLYLFEQKGGENYLS
Ga0247588_111029113300026465SeawaterKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0247588_112552113300026465SeawaterWSFGISYSQKSRNEEAKTLCSDTATLLKTYADAVIAKTEGGPNESLTEQNAHNIAMAIFFDVQLQDFMSGLGMAANDGLSLSVNRLKSLQKLYLFEQKGGENYLG
Ga0247603_110028013300026468SeawaterADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0247603_111395613300026468SeawaterMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLAKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMPGNGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0247603_111849913300026468SeawaterKDLSFGVSYSQAKRNDHARDLCRKVETAIEGYASNLLTTIEAGPNETLTEQNAHNIAAMIFYDVQLQDFMTGLGMSATDDLVLAVNRLKSLQKLYLFEQKGGENYLGXVR
Ga0247599_111672313300026470SeawaterQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0247599_113005523300026470SeawaterFFGSVRANLDQINKDMSFGISYSQRARNEHARETATTTAGLIKTYADQMIAKTEAGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADTDLVLAVNRLKSLQKLYLFEQKGGEDYLG
Ga0247571_117099813300026495SeawaterRNDHARELCTKVANGLQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVL
Ga0247605_115896513300026503SeawaterSKDLSFGVSYSQQKRNDHARTLCTKVAAAIQAYADGVTAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMTGLGMAMDDTLILAVNRLKSLQKLYLFEQKGGENYLS
Ga0247605_116067613300026503SeawaterFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0209192_1029512913300027752MarineKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0209830_1026578413300027791MarineALLQTIKADLEGINGDLSFGISFSQTKKNDHARELCQKISKAIKDYTSKLLSKVEAAPNEVLTEQNAHNIAAVIFYDVQLQDNMSGLGMGSDDELVLAVNRLKSL
Ga0209830_1034774113300027791MarineNADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0209302_1036821013300027810MarineSYSQSSRNDHARALTTTVATAITSYADTLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQTAPDTLILAVNRLKTLQKLYLFEQKGGENYLG
Ga0209712_1060658313300027849MarineRADLDQINKDLSFGVSFSQGARNEHAKELVTKAGSSILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMSANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0247586_110266623300028102SeawaterSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0247596_110914313300028106SeawaterAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0247596_111533313300028106SeawaterIATAIKDYADSMIAKVDTTNASALAEASLTDQNAHNIAALIFYDVQLQDNMAQLGMPSDSKLVLAVNRLKSLQKLYLFEQPGGENYLD
Ga0247582_112295413300028109SeawaterKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0247582_113782213300028109SeawaterLESINADLSFGISFSQTKMNDHARDTCKKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMAGDDELVLAVNRLKSL
Ga0247584_116768513300028110SeawaterLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0228621_103956113300028124SeawaterNKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLAKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMPGNGDLVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVES
Ga0256411_123114913300028134SeawaterNADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0256412_107229133300028137SeawaterQLLATIKTDLDQVSKDLSFGISFSQTKRNDHARELCTKVATSIQDYSSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYL
Ga0256412_124139423300028137SeawaterMSFGVSYSQNKRNDHGQALVTKVSNAIIDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQVEDAAAALAMPKNEDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0256412_125274813300028137SeawaterHEAARAEAAKVKKNPQSALLQTIKADLESINADLSFGISFSQTKRNDHARETCQKVAKAIKDYTSKLLAKIETGPNEVLTEQNAHNIAAVIFYDVQLQDNMAGLGMGADDELVLAVNRLKSL
Ga0256412_129973723300028137SeawaterVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDSARDTCKKVASSILDYSNKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLAVNRLKSLQKLYLFEQ
Ga0256412_134476313300028137SeawaterAKVAVNPANEFFASVRANLDQINKDMSFGISYSQRTRNEHARDLATSTSTLIKDYAQQLSNKTETGPNETLTEQNAHNIAASIFFDVQLQDFMAGLGMAADDDLILAVNRLKSLQKLYLFEQKGGEDYLG
Ga0256417_118131113300028233SeawaterTTIKLDLDQISKDLSFGVSYSQQKRNDHARTLCTKVAAAIQAYADGVTAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMTGLGMAMDDTLILAVNRLKSLQKLYLFEQKGGENYLS
Ga0256413_124281513300028282SeawaterDLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVILYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0247572_117655313300028290SeawaterFGISFSQSKRNDHARELCTKVANGLQDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVL
Ga0247595_104731713300028333SeawaterAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKMNDHARDTCKKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMAGDDELVLAVNRLKSL
Ga0247595_106846113300028333SeawaterCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0247597_103972513300028334SeawaterTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVETGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0272440_110271523300028595Marine SedimentMSFGVSFSQNSRNDHARQLCTKVATAIKDYSGALLAKIESGPNETLTEQNAHNIAAMIFYDVQLQDAMKALGMAPDGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0272440_112859423300028595Marine SedimentMSFGVSFSQNARNDHARQLCTKVATAIKDYSGALLAKIESGPNETLTEQNAHNIAAMIFYDVQLQDAMKALGMAPDGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0272440_114659913300028595Marine SedimentMSFGVSFSQNARNDHARQLCTKVATAIKDYSGALLAKIESGPNETLTEQNAHNIAAMIFYDVQLQDGMKALGMAPDGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307403_1070083713300030671MarineQTLATIKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGVAAPDDLVLAVNRLKSLQKLYLFEQKGGENYL
Ga0307398_1081992613300030699MarineFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307400_1101702023300030709MarineMKTDLEQINKDMSFGVSFSQTKRNDHARELSTKVGEAIKDYSSKLLAKIEVSPSEVLTEQNAHNIAAVIFYDVQLQDASKGLGAPEDGELVLAVNRLK
Ga0308138_105278813300030724MarineDMSFGISFSQTKRNDHARELCTKVGAAIEDYSAKLLGKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMASNGDLVLAVNRLKSLQKLYLFEQKGGENYLGXTXLSFVLKHGAESQQ
Ga0308138_105789513300030724MarineALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGASILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMSANGDLNLAVNRLKSLQKLYLFEQKGGENYL
Ga0308138_106478823300030724MarineMSFGVSYSQNKRNDHGQALVTKVSNAIVDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQAEDAGAALAMPKNEDLVLAVNRLKSL
Ga0308138_106517513300030724MarineVKKNPQAALLASIKADLEAINTNMSFGVSYSQSKRNDSGRDLCNKVSTAILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0073988_1000266013300030780MarineQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0073988_1226488913300030780MarineSKDVSFGISYSQKTRNDAAKTLATETATLLKTYATAVIAKTEGGPNESLTEQNAHNIAMAIFYDVQLQDFMGGLGMAADDALSLSVNRLKSLQKLYLFEQKGGENYLG
Ga0073988_1233164513300030780MarineAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0073964_1175895413300030788MarineMSFGISYSQRTRNEAARDLCTTTATLIKTYADRMIEKTEAGPNETLTEQNAHNIAATIFFDVQLQDQMAGLGMAPDDDLILAINRLKSLQKLYLFEQKGGEDYLG
Ga0073990_1001076413300030856MarineAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0073981_1159161513300030857MarineMKTDLEQINKDMSFGVSFSQTKRNDHARELCQKVATAIQDYTGKLLAKIESGPNEALTEQNAHNIAAVIFYDVQLQDAMKGLGMPGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0073987_1000809313300030912MarineAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTADLIKTYADKMIDKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDDDLVLAMNRLKSLQKLYLFEQKGGEDYLGF
Ga0073987_1000826813300030912MarineAKVAVNPANEFFASVRENLDQINKDMSFGISYSQRARNEHARELCTTTAGLIKTYADQMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDEDLVLAINRLKSLQKLYLFEQVGGEDYLGF
Ga0073987_1120968313300030912MarineQAALLQTIKADLEGINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSTDDELVLAVNRLKSL
Ga0073944_1138874413300030956MarineARDEAAKVKKNPQTAFFADVRENLNQISKDLSFGVSFSQKTRNDHARTLVTSTAKDLKKYADQMIAKTEATPNESLTEQNAHNIATAIFYDVQLQDAASGLGMAALDDLTLSVNRLKSLQKLYLFEQKGGENYLG
Ga0073978_101059023300031036MarineMEQINNDMSFGVSFSQNKRNEHGVALCNKVANAIITYTNKLVEVINRQSDESLTEQNAHNIAVLIFYDVQLENNMKELGMAENEDLKLSVNRLKSLQKLYLFEQKGGEN
Ga0073979_1229068413300031037MarineKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMHGLGMPENGELVLSMNRMKSLQKLYLFEQKGGENYLG
Ga0073989_1360898113300031062MarineNLDQINKDMSFGISYSQRARNEHARELCTTTADLIKTYADKMIDKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAGDDDLVLAMNRLKSLQKLYLFEQKGGEDYLGF
Ga0308144_105082913300031570MarineFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0302126_1027525513300031622MarineEAINTNMSFGVSYSQSKRNDSGRDLCNKVSTAILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0302126_1028986813300031622MarineQEKRNDHARELTTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGQAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLGXA
Ga0307393_115480513300031674MarineMKADLEQINKDMSFGVSFSQTKRNDHARELCTKVSNAVQDYAAKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEVGDLVLAVNRLKSLQKLYLFEQKGGENY
Ga0307386_1053996713300031710MarineRSEAAKVKKNPQSALLQTIKADLEGINNDLSFGISFSQTKRNDHARELCTKVGTAIKDYSKKLLSKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAGDGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307394_1018648313300031735MarineMKADLEQINKDMSFGVSFSQTKRNDHARELCTKVSNAVQDYAAKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEVGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307394_1044598513300031735MarineARAEAAKVKKNPQQDLLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSSILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMSANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307395_1019131733300031742MarineMKADLEQINKDMSFGVSFSQTKRNDHARELCTKVSNAVQDYAAKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEVGDLVLAVNRLKSLQKLYLFEQKGGENYLGXAPNVHPLHTAXRE
Ga0307382_1057749213300031743MarineKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0315316_1128566513300032011SeawaterKRNDHARELCTKVANGLQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVL
Ga0315330_1086303513300032047SeawaterQTKRNDTARDLCTKVGASILDYATKLIAKVESGPNESLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0314676_1086322013300032519SeawaterFATVRGNLDQINKDMSFGISYSQRARNEHARETATTTSGLIKTYADSMIAKTESGPNETLTEQNAHNIAATIFFDVQLQDAMAGLGMAADGDLVLAVNRLKSLQKLYLFEQKGGEDYLGF
Ga0314674_1069057113300032615SeawaterRAEAAMALKNPQSHVLDTIKTYLDQISKDLSFGVSYSQAKRNDHARELCTKVQTAIEGYASSLLTTIEAGPNETLTEQNAHNIAAMIFYDVQLQDFMTGLGVSASDDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0314678_1056694313300032666SeawaterDLDQISKDLSFGISFSQSKRNDHARELCTKVATGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0314681_1082859613300032711SeawaterDHARALTTTVATAITSYADTLLATVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGKSAPDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0314691_1046230713300032749SeawaterAARAEAAKALKNPQQSVLATIKTDLDQISKDLSFGVSYSQAKRNDHARELCDTVATAITGYATDLLTTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGKSAPDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0310342_10140237723300032820SeawaterMSFGISFSQEKRNAHAKDLCTKVSSAVKDYGSKLLAQIEKSPNEALTEQNAHNIAAMVFYDVQLQEGMKGLGMPLDGELVLAVNRLKSLQKLYLMEQKGGENYLD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.