| Basic Information | |
|---|---|
| Family ID | F011425 |
| Family Type | Metagenome |
| Number of Sequences | 291 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MPMVQTRRRFLTTLSMAGAAGLLRAPPPLAAEGALETT |
| Number of Associated Samples | 163 |
| Number of Associated Scaffolds | 291 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 97.86 % |
| % of genes near scaffold ends (potentially truncated) | 94.85 % |
| % of genes from short scaffolds (< 2000 bps) | 90.03 % |
| Associated GOLD sequencing projects | 149 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.199 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (39.862 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.234 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.890 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 291 Family Scaffolds |
|---|---|---|
| PF13379 | NMT1_2 | 29.55 |
| PF09084 | NMT1 | 15.46 |
| PF13577 | SnoaL_4 | 1.37 |
| PF03306 | AAL_decarboxy | 1.03 |
| PF07969 | Amidohydro_3 | 0.69 |
| PF10387 | DUF2442 | 0.69 |
| PF01850 | PIN | 0.34 |
| PF13193 | AMP-binding_C | 0.34 |
| PF01590 | GAF | 0.34 |
| PF03631 | Virul_fac_BrkB | 0.34 |
| PF07589 | PEP-CTERM | 0.34 |
| PF00916 | Sulfate_transp | 0.34 |
| PF13358 | DDE_3 | 0.34 |
| PF02518 | HATPase_c | 0.34 |
| PF12974 | Phosphonate-bd | 0.34 |
| PF07690 | MFS_1 | 0.34 |
| PF01568 | Molydop_binding | 0.34 |
| PF00211 | Guanylate_cyc | 0.34 |
| PF06912 | DUF1275 | 0.34 |
| PF00486 | Trans_reg_C | 0.34 |
| PF13586 | DDE_Tnp_1_2 | 0.34 |
| PF01402 | RHH_1 | 0.34 |
| PF00521 | DNA_topoisoIV | 0.34 |
| PF12695 | Abhydrolase_5 | 0.34 |
| PF14417 | MEDS | 0.34 |
| PF00078 | RVT_1 | 0.34 |
| PF04392 | ABC_sub_bind | 0.34 |
| PF02604 | PhdYeFM_antitox | 0.34 |
| COG ID | Name | Functional Category | % Frequency in 291 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 15.46 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 15.46 |
| COG3527 | Alpha-acetolactate decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.03 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.34 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.34 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.34 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.34 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.34 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.34 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.34 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.34 |
| COG3619 | Uncharacterized membrane protein YoaK, UPF0700 family | Function unknown [S] | 0.34 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.34 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.20 % |
| All Organisms | root | All Organisms | 37.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000477|SL_5KL_010_SEDDRAFT_10000930 | All Organisms → cellular organisms → Bacteria | 18339 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101209647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 645 | Open in IMG/M |
| 3300003368|JGI26340J50214_10155468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 571 | Open in IMG/M |
| 3300004092|Ga0062389_103156239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 617 | Open in IMG/M |
| 3300005175|Ga0066673_10697566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM2561 | 585 | Open in IMG/M |
| 3300005186|Ga0066676_11064238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 535 | Open in IMG/M |
| 3300005332|Ga0066388_102443827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM2561 | 948 | Open in IMG/M |
| 3300005435|Ga0070714_100402096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1295 | Open in IMG/M |
| 3300005436|Ga0070713_102401455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 510 | Open in IMG/M |
| 3300005437|Ga0070710_10125910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM2561 | 1556 | Open in IMG/M |
| 3300005454|Ga0066687_10510696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 711 | Open in IMG/M |
| 3300005454|Ga0066687_10819271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM2561 | 554 | Open in IMG/M |
| 3300005468|Ga0070707_101147551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 743 | Open in IMG/M |
| 3300005468|Ga0070707_102210720 | Not Available | 518 | Open in IMG/M |
| 3300005471|Ga0070698_101455519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM2561 | 636 | Open in IMG/M |
| 3300005471|Ga0070698_101813989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 563 | Open in IMG/M |
| 3300005559|Ga0066700_10636946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 740 | Open in IMG/M |
| 3300005569|Ga0066705_10928714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 516 | Open in IMG/M |
| 3300005576|Ga0066708_10826457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM2561 | 580 | Open in IMG/M |
| 3300005598|Ga0066706_10749146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 774 | Open in IMG/M |
| 3300005610|Ga0070763_10046637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 2046 | Open in IMG/M |
| 3300005764|Ga0066903_103773116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 814 | Open in IMG/M |
| 3300005764|Ga0066903_104567498 | Not Available | 738 | Open in IMG/M |
| 3300005764|Ga0066903_106753411 | Not Available | 596 | Open in IMG/M |
| 3300005764|Ga0066903_106805784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM2561 | 594 | Open in IMG/M |
| 3300005764|Ga0066903_107942489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM2561 | 545 | Open in IMG/M |
| 3300006028|Ga0070717_12017848 | Not Available | 520 | Open in IMG/M |
| 3300006173|Ga0070716_101117470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM2561 | 629 | Open in IMG/M |
| 3300006175|Ga0070712_100342237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 1221 | Open in IMG/M |
| 3300006175|Ga0070712_101156473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300006800|Ga0066660_11264463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM2561 | 578 | Open in IMG/M |
| 3300006806|Ga0079220_11453387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM2561 | 585 | Open in IMG/M |
| 3300007255|Ga0099791_10498383 | Not Available | 591 | Open in IMG/M |
| 3300007258|Ga0099793_10487726 | Not Available | 612 | Open in IMG/M |
| 3300009012|Ga0066710_101909456 | Not Available | 888 | Open in IMG/M |
| 3300009012|Ga0066710_104495688 | Not Available | 521 | Open in IMG/M |
| 3300009088|Ga0099830_11609672 | Not Available | 541 | Open in IMG/M |
| 3300009137|Ga0066709_104097560 | Not Available | 530 | Open in IMG/M |
| 3300009162|Ga0075423_12580707 | Not Available | 555 | Open in IMG/M |
| 3300009792|Ga0126374_10460916 | Not Available | 906 | Open in IMG/M |
| 3300009792|Ga0126374_11230990 | Not Available | 601 | Open in IMG/M |
| 3300010046|Ga0126384_10155537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1765 | Open in IMG/M |
| 3300010046|Ga0126384_12121836 | Not Available | 539 | Open in IMG/M |
| 3300010048|Ga0126373_10222158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1843 | Open in IMG/M |
| 3300010048|Ga0126373_10695260 | Not Available | 1075 | Open in IMG/M |
| 3300010048|Ga0126373_11565504 | Not Available | 724 | Open in IMG/M |
| 3300010048|Ga0126373_11711867 | Not Available | 693 | Open in IMG/M |
| 3300010359|Ga0126376_10309854 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300010359|Ga0126376_10554678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1076 | Open in IMG/M |
| 3300010360|Ga0126372_12969362 | Not Available | 526 | Open in IMG/M |
| 3300010361|Ga0126378_10580213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Hypericibacter → Hypericibacter terrae | 1236 | Open in IMG/M |
| 3300010361|Ga0126378_12482039 | Not Available | 592 | Open in IMG/M |
| 3300010361|Ga0126378_13471497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300010366|Ga0126379_11349986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 819 | Open in IMG/M |
| 3300010366|Ga0126379_11800800 | Not Available | 716 | Open in IMG/M |
| 3300010376|Ga0126381_103620276 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300010398|Ga0126383_13355877 | Not Available | 523 | Open in IMG/M |
| 3300010398|Ga0126383_13511060 | Not Available | 512 | Open in IMG/M |
| 3300011269|Ga0137392_11238697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 605 | Open in IMG/M |
| 3300011269|Ga0137392_11645954 | Not Available | 500 | Open in IMG/M |
| 3300011270|Ga0137391_11452281 | Not Available | 531 | Open in IMG/M |
| 3300012202|Ga0137363_10173623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1711 | Open in IMG/M |
| 3300012202|Ga0137363_11299054 | Not Available | 616 | Open in IMG/M |
| 3300012203|Ga0137399_10513450 | Not Available | 1005 | Open in IMG/M |
| 3300012205|Ga0137362_11243840 | Not Available | 629 | Open in IMG/M |
| 3300012285|Ga0137370_10427029 | Not Available | 805 | Open in IMG/M |
| 3300012285|Ga0137370_10540061 | Not Available | 716 | Open in IMG/M |
| 3300012361|Ga0137360_10510465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 1024 | Open in IMG/M |
| 3300012363|Ga0137390_10468079 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300012685|Ga0137397_10083770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2322 | Open in IMG/M |
| 3300012685|Ga0137397_11331567 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012917|Ga0137395_11038988 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012922|Ga0137394_10078031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2768 | Open in IMG/M |
| 3300012922|Ga0137394_10966985 | Not Available | 709 | Open in IMG/M |
| 3300012948|Ga0126375_10872723 | Not Available | 720 | Open in IMG/M |
| 3300012971|Ga0126369_10378248 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300012971|Ga0126369_12622570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300016270|Ga0182036_10194351 | Not Available | 1482 | Open in IMG/M |
| 3300016270|Ga0182036_10345992 | Not Available | 1144 | Open in IMG/M |
| 3300016270|Ga0182036_10392054 | Not Available | 1080 | Open in IMG/M |
| 3300016270|Ga0182036_11739312 | Not Available | 527 | Open in IMG/M |
| 3300016294|Ga0182041_10724089 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300016294|Ga0182041_11103370 | Not Available | 721 | Open in IMG/M |
| 3300016294|Ga0182041_11233201 | Not Available | 683 | Open in IMG/M |
| 3300016294|Ga0182041_11408725 | Not Available | 640 | Open in IMG/M |
| 3300016319|Ga0182033_10057224 | All Organisms → cellular organisms → Bacteria | 2677 | Open in IMG/M |
| 3300016319|Ga0182033_11410699 | Not Available | 627 | Open in IMG/M |
| 3300016319|Ga0182033_11863654 | Not Available | 546 | Open in IMG/M |
| 3300016341|Ga0182035_10044294 | Not Available | 2975 | Open in IMG/M |
| 3300016341|Ga0182035_10083105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2293 | Open in IMG/M |
| 3300016341|Ga0182035_10713370 | Not Available | 875 | Open in IMG/M |
| 3300016341|Ga0182035_11428770 | Not Available | 621 | Open in IMG/M |
| 3300016357|Ga0182032_11918299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300016371|Ga0182034_11358552 | Not Available | 621 | Open in IMG/M |
| 3300016371|Ga0182034_11783754 | Not Available | 542 | Open in IMG/M |
| 3300016371|Ga0182034_12085564 | Not Available | 500 | Open in IMG/M |
| 3300016387|Ga0182040_10577039 | Not Available | 908 | Open in IMG/M |
| 3300016387|Ga0182040_10646203 | Not Available | 860 | Open in IMG/M |
| 3300016387|Ga0182040_11078927 | Not Available | 672 | Open in IMG/M |
| 3300016404|Ga0182037_10561134 | Not Available | 965 | Open in IMG/M |
| 3300016404|Ga0182037_10825366 | Not Available | 800 | Open in IMG/M |
| 3300016422|Ga0182039_12154160 | Not Available | 514 | Open in IMG/M |
| 3300016445|Ga0182038_10825838 | Not Available | 813 | Open in IMG/M |
| 3300016445|Ga0182038_11220864 | Not Available | 671 | Open in IMG/M |
| 3300016445|Ga0182038_12102614 | Not Available | 512 | Open in IMG/M |
| 3300016445|Ga0182038_12110516 | Not Available | 511 | Open in IMG/M |
| 3300017970|Ga0187783_10148138 | Not Available | 1729 | Open in IMG/M |
| 3300018006|Ga0187804_10241856 | Not Available | 778 | Open in IMG/M |
| 3300018058|Ga0187766_11005476 | Not Available | 594 | Open in IMG/M |
| 3300018062|Ga0187784_10903651 | Not Available | 703 | Open in IMG/M |
| 3300018468|Ga0066662_12907647 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300020579|Ga0210407_10518733 | Not Available | 931 | Open in IMG/M |
| 3300020580|Ga0210403_10779240 | Not Available | 761 | Open in IMG/M |
| 3300020580|Ga0210403_11201961 | Not Available | 584 | Open in IMG/M |
| 3300020581|Ga0210399_11296367 | Not Available | 574 | Open in IMG/M |
| 3300020582|Ga0210395_11221270 | Not Available | 552 | Open in IMG/M |
| 3300021170|Ga0210400_10266192 | Not Available | 1404 | Open in IMG/M |
| 3300021170|Ga0210400_10488105 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300021170|Ga0210400_10895143 | Not Available | 725 | Open in IMG/M |
| 3300021170|Ga0210400_11363873 | Not Available | 566 | Open in IMG/M |
| 3300021178|Ga0210408_10165784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1753 | Open in IMG/M |
| 3300021178|Ga0210408_10776659 | Not Available | 751 | Open in IMG/M |
| 3300021180|Ga0210396_10352462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1298 | Open in IMG/M |
| 3300021180|Ga0210396_10693670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 880 | Open in IMG/M |
| 3300021403|Ga0210397_10884617 | Not Available | 691 | Open in IMG/M |
| 3300021405|Ga0210387_10817943 | Not Available | 823 | Open in IMG/M |
| 3300021405|Ga0210387_10916805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 770 | Open in IMG/M |
| 3300021405|Ga0210387_11430029 | Not Available | 594 | Open in IMG/M |
| 3300021405|Ga0210387_11628075 | Not Available | 549 | Open in IMG/M |
| 3300021407|Ga0210383_11129878 | Not Available | 661 | Open in IMG/M |
| 3300021432|Ga0210384_10802761 | Not Available | 839 | Open in IMG/M |
| 3300021478|Ga0210402_10128044 | Not Available | 2299 | Open in IMG/M |
| 3300021478|Ga0210402_10619063 | Not Available | 1003 | Open in IMG/M |
| 3300021478|Ga0210402_11444976 | Not Available | 615 | Open in IMG/M |
| 3300021478|Ga0210402_11818252 | Not Available | 535 | Open in IMG/M |
| 3300021559|Ga0210409_10399504 | Not Available | 1230 | Open in IMG/M |
| 3300021559|Ga0210409_10591934 | Not Available | 977 | Open in IMG/M |
| 3300021559|Ga0210409_10998862 | Not Available | 711 | Open in IMG/M |
| 3300021560|Ga0126371_10897254 | Not Available | 1030 | Open in IMG/M |
| 3300021560|Ga0126371_11035090 | Not Available | 962 | Open in IMG/M |
| 3300021560|Ga0126371_13194065 | Not Available | 554 | Open in IMG/M |
| 3300025906|Ga0207699_10524167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 857 | Open in IMG/M |
| 3300025910|Ga0207684_10493839 | Not Available | 1049 | Open in IMG/M |
| 3300025910|Ga0207684_10739133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 834 | Open in IMG/M |
| 3300025916|Ga0207663_10212722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1402 | Open in IMG/M |
| 3300025922|Ga0207646_11718929 | Not Available | 538 | Open in IMG/M |
| 3300025928|Ga0207700_11398858 | Not Available | 622 | Open in IMG/M |
| 3300025928|Ga0207700_11822256 | Not Available | 534 | Open in IMG/M |
| 3300025929|Ga0207664_10251394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM2561 | 1543 | Open in IMG/M |
| 3300025929|Ga0207664_11219173 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300026538|Ga0209056_10278279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1171 | Open in IMG/M |
| 3300026555|Ga0179593_1040060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 3694 | Open in IMG/M |
| 3300027738|Ga0208989_10228937 | Not Available | 610 | Open in IMG/M |
| 3300027783|Ga0209448_10049920 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300027783|Ga0209448_10141451 | Not Available | 804 | Open in IMG/M |
| 3300027825|Ga0209039_10418508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300027874|Ga0209465_10171976 | Not Available | 1079 | Open in IMG/M |
| 3300028047|Ga0209526_10091796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 2138 | Open in IMG/M |
| 3300028047|Ga0209526_10614215 | Not Available | 695 | Open in IMG/M |
| 3300028047|Ga0209526_10864101 | Not Available | 554 | Open in IMG/M |
| 3300028536|Ga0137415_10421431 | Not Available | 1140 | Open in IMG/M |
| 3300028536|Ga0137415_11495514 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031231|Ga0170824_106173002 | Not Available | 556 | Open in IMG/M |
| 3300031474|Ga0170818_111985021 | Not Available | 567 | Open in IMG/M |
| 3300031474|Ga0170818_114499252 | Not Available | 548 | Open in IMG/M |
| 3300031543|Ga0318516_10168651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1259 | Open in IMG/M |
| 3300031543|Ga0318516_10683124 | Not Available | 583 | Open in IMG/M |
| 3300031543|Ga0318516_10701514 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300031544|Ga0318534_10837730 | Not Available | 516 | Open in IMG/M |
| 3300031545|Ga0318541_10167457 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300031546|Ga0318538_10656775 | Not Available | 569 | Open in IMG/M |
| 3300031546|Ga0318538_10767670 | Not Available | 523 | Open in IMG/M |
| 3300031561|Ga0318528_10279502 | Not Available | 896 | Open in IMG/M |
| 3300031561|Ga0318528_10345939 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300031561|Ga0318528_10439161 | Not Available | 701 | Open in IMG/M |
| 3300031572|Ga0318515_10203505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1061 | Open in IMG/M |
| 3300031573|Ga0310915_10434238 | Not Available | 933 | Open in IMG/M |
| 3300031573|Ga0310915_11117953 | Not Available | 547 | Open in IMG/M |
| 3300031640|Ga0318555_10258201 | Not Available | 942 | Open in IMG/M |
| 3300031640|Ga0318555_10666424 | Not Available | 563 | Open in IMG/M |
| 3300031679|Ga0318561_10292084 | Not Available | 891 | Open in IMG/M |
| 3300031679|Ga0318561_10646549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300031679|Ga0318561_10681287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 565 | Open in IMG/M |
| 3300031680|Ga0318574_10086061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1722 | Open in IMG/M |
| 3300031680|Ga0318574_10516931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300031681|Ga0318572_10816816 | Not Available | 554 | Open in IMG/M |
| 3300031682|Ga0318560_10211611 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300031682|Ga0318560_10686822 | Not Available | 553 | Open in IMG/M |
| 3300031719|Ga0306917_10008300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5829 | Open in IMG/M |
| 3300031724|Ga0318500_10414104 | Not Available | 671 | Open in IMG/M |
| 3300031744|Ga0306918_10002907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8814 | Open in IMG/M |
| 3300031744|Ga0306918_10033254 | All Organisms → cellular organisms → Bacteria | 3284 | Open in IMG/M |
| 3300031748|Ga0318492_10658096 | Not Available | 560 | Open in IMG/M |
| 3300031751|Ga0318494_10278615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 962 | Open in IMG/M |
| 3300031751|Ga0318494_10831472 | Not Available | 541 | Open in IMG/M |
| 3300031763|Ga0318537_10045342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1587 | Open in IMG/M |
| 3300031763|Ga0318537_10066383 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300031763|Ga0318537_10186624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 772 | Open in IMG/M |
| 3300031764|Ga0318535_10449472 | Not Available | 574 | Open in IMG/M |
| 3300031765|Ga0318554_10817193 | Not Available | 521 | Open in IMG/M |
| 3300031768|Ga0318509_10186401 | Not Available | 1152 | Open in IMG/M |
| 3300031768|Ga0318509_10205065 | Not Available | 1097 | Open in IMG/M |
| 3300031768|Ga0318509_10401570 | Not Available | 766 | Open in IMG/M |
| 3300031771|Ga0318546_10505597 | Not Available | 848 | Open in IMG/M |
| 3300031779|Ga0318566_10631093 | Not Available | 521 | Open in IMG/M |
| 3300031781|Ga0318547_10140855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1412 | Open in IMG/M |
| 3300031781|Ga0318547_10347169 | Not Available | 906 | Open in IMG/M |
| 3300031793|Ga0318548_10245677 | Not Available | 880 | Open in IMG/M |
| 3300031793|Ga0318548_10586473 | Not Available | 542 | Open in IMG/M |
| 3300031796|Ga0318576_10255498 | Not Available | 827 | Open in IMG/M |
| 3300031797|Ga0318550_10106254 | Not Available | 1327 | Open in IMG/M |
| 3300031797|Ga0318550_10538067 | Not Available | 563 | Open in IMG/M |
| 3300031798|Ga0318523_10220439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 948 | Open in IMG/M |
| 3300031799|Ga0318565_10336401 | Not Available | 733 | Open in IMG/M |
| 3300031832|Ga0318499_10052069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium | 1533 | Open in IMG/M |
| 3300031833|Ga0310917_10263298 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300031845|Ga0318511_10093421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1272 | Open in IMG/M |
| 3300031846|Ga0318512_10309890 | Not Available | 785 | Open in IMG/M |
| 3300031879|Ga0306919_10168656 | Not Available | 1609 | Open in IMG/M |
| 3300031879|Ga0306919_10656719 | Not Available | 808 | Open in IMG/M |
| 3300031890|Ga0306925_11612463 | Not Available | 630 | Open in IMG/M |
| 3300031890|Ga0306925_11817140 | Not Available | 583 | Open in IMG/M |
| 3300031890|Ga0306925_11873126 | Not Available | 571 | Open in IMG/M |
| 3300031897|Ga0318520_10955665 | Not Available | 540 | Open in IMG/M |
| 3300031910|Ga0306923_11395015 | Not Available | 738 | Open in IMG/M |
| 3300031910|Ga0306923_11762245 | Not Available | 637 | Open in IMG/M |
| 3300031912|Ga0306921_10820445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1061 | Open in IMG/M |
| 3300031912|Ga0306921_11464846 | Not Available | 748 | Open in IMG/M |
| 3300031912|Ga0306921_11730016 | Not Available | 675 | Open in IMG/M |
| 3300031912|Ga0306921_12268779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 570 | Open in IMG/M |
| 3300031942|Ga0310916_10683096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 869 | Open in IMG/M |
| 3300031942|Ga0310916_10963918 | Not Available | 713 | Open in IMG/M |
| 3300031942|Ga0310916_11119102 | Not Available | 654 | Open in IMG/M |
| 3300031945|Ga0310913_11176530 | Not Available | 534 | Open in IMG/M |
| 3300031947|Ga0310909_11088416 | Not Available | 650 | Open in IMG/M |
| 3300031947|Ga0310909_11349407 | Not Available | 572 | Open in IMG/M |
| 3300031947|Ga0310909_11498534 | Not Available | 537 | Open in IMG/M |
| 3300031954|Ga0306926_10879412 | Not Available | 1074 | Open in IMG/M |
| 3300031954|Ga0306926_11524127 | Not Available | 770 | Open in IMG/M |
| 3300032001|Ga0306922_10111922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 2897 | Open in IMG/M |
| 3300032001|Ga0306922_10379613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1515 | Open in IMG/M |
| 3300032001|Ga0306922_10619948 | Not Available | 1145 | Open in IMG/M |
| 3300032010|Ga0318569_10178326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 982 | Open in IMG/M |
| 3300032025|Ga0318507_10233783 | Not Available | 796 | Open in IMG/M |
| 3300032035|Ga0310911_10504084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 702 | Open in IMG/M |
| 3300032039|Ga0318559_10304688 | Not Available | 740 | Open in IMG/M |
| 3300032041|Ga0318549_10148121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 1044 | Open in IMG/M |
| 3300032044|Ga0318558_10297464 | Not Available | 798 | Open in IMG/M |
| 3300032051|Ga0318532_10028191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1857 | Open in IMG/M |
| 3300032052|Ga0318506_10144427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1039 | Open in IMG/M |
| 3300032054|Ga0318570_10311113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 716 | Open in IMG/M |
| 3300032059|Ga0318533_10163397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1581 | Open in IMG/M |
| 3300032059|Ga0318533_10303235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1159 | Open in IMG/M |
| 3300032060|Ga0318505_10027819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium sullae | 2276 | Open in IMG/M |
| 3300032060|Ga0318505_10056699 | Not Available | 1693 | Open in IMG/M |
| 3300032063|Ga0318504_10016079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2733 | Open in IMG/M |
| 3300032063|Ga0318504_10418855 | Not Available | 639 | Open in IMG/M |
| 3300032068|Ga0318553_10238264 | Not Available | 950 | Open in IMG/M |
| 3300032076|Ga0306924_11282663 | Not Available | 788 | Open in IMG/M |
| 3300032076|Ga0306924_12106641 | Not Available | 578 | Open in IMG/M |
| 3300032076|Ga0306924_12470620 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032091|Ga0318577_10151767 | Not Available | 1102 | Open in IMG/M |
| 3300032091|Ga0318577_10319240 | Not Available | 743 | Open in IMG/M |
| 3300032094|Ga0318540_10023924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2581 | Open in IMG/M |
| 3300032205|Ga0307472_102260502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 550 | Open in IMG/M |
| 3300032205|Ga0307472_102662884 | Not Available | 510 | Open in IMG/M |
| 3300032261|Ga0306920_100277077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2500 | Open in IMG/M |
| 3300032261|Ga0306920_100738111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1449 | Open in IMG/M |
| 3300032261|Ga0306920_101101759 | Not Available | 1152 | Open in IMG/M |
| 3300032261|Ga0306920_101567801 | Not Available | 938 | Open in IMG/M |
| 3300032261|Ga0306920_103688004 | Not Available | 562 | Open in IMG/M |
| 3300032261|Ga0306920_103762032 | Not Available | 556 | Open in IMG/M |
| 3300032261|Ga0306920_103776505 | Not Available | 554 | Open in IMG/M |
| 3300032261|Ga0306920_103836932 | Not Available | 549 | Open in IMG/M |
| 3300032261|Ga0306920_103876111 | Not Available | 545 | Open in IMG/M |
| 3300033289|Ga0310914_10214428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 1722 | Open in IMG/M |
| 3300033289|Ga0310914_11407135 | Not Available | 600 | Open in IMG/M |
| 3300033289|Ga0310914_11694112 | Not Available | 536 | Open in IMG/M |
| 3300033290|Ga0318519_10595406 | Not Available | 671 | Open in IMG/M |
| 3300033290|Ga0318519_10937308 | Not Available | 536 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 39.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.59% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.41% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.03% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.34% |
| Alkaline Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment | 0.34% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.34% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.34% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000477 | Alkaline sediment microbial communities from Lake Bitter, Kulunda Steppe, Russia - 5KL_010_SED | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SL_5KL_010_SEDDRAFT_1000093017 | 3300000477 | Alkaline Sediment | MPDRRHFLSTLAGASLAGAAGLVRPPSLSAAPTAWL |
| JGIcombinedJ26739_1012096472 | 3300002245 | Forest Soil | MPTMQTRRRFLTSLSLAGAAGLLHAPAVAGEQPPETTSVRFMRTPSIC |
| JGI26340J50214_101554682 | 3300003368 | Bog Forest Soil | MATIQTRRRFLTNLSLAGAAGLLRIPRVLAGEGHPETTAVR |
| Ga0062389_1031562392 | 3300004092 | Bog Forest Soil | MTMTQTRRRFLTNLSLAGTAAFMGAPRTLAAEGPLETTAI |
| Ga0066673_106975661 | 3300005175 | Soil | MLPRQTRRRFLTTVSLAGAAGLLRPPAVFAAEERLETTTIRLGGG |
| Ga0066676_110642381 | 3300005186 | Soil | MQMIHTRRRFLNTMALASAAALVRPPRALAAEGALETTTVRL |
| Ga0066388_1024438271 | 3300005332 | Tropical Forest Soil | MAIVPNRRQFLTTLSLAGAAALVRAPPSTAAEGSLETTTVR |
| Ga0070714_1004020962 | 3300005435 | Agricultural Soil | MAAMETRRRFLTMVSVAGAAGFIRAPRALAAEGALETTSAHYLA* |
| Ga0070713_1024014552 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMMQTRRRFLTTLSLAGAAGLVHARPALAGEGAPEITSVRIQ |
| Ga0070710_101259102 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMMQSRRRFLTTLSMAGAAGFLRAPPSLAAQGALEQRRSALQSSGP |
| Ga0066687_105106961 | 3300005454 | Soil | MTQTRRRFLTTLSLAGAAGLLRPPPALAAEERLETTSLRL |
| Ga0066687_108192711 | 3300005454 | Soil | MSMTQTRRRFLTTLSLAGAAGLIRVPRAPAAGEALETTTVRLAKIGSICI |
| Ga0070707_1011475511 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMMQTRRRFIGALALSGAAGLIRAPGALAAEGRLETTTLRLYRI |
| Ga0070707_1022107202 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMMQTRRRFLTTTLSLAGAAGLVRPAAGAEVLETTTVRL |
| Ga0070698_1014555191 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMTQTRRSFLTTLSLAGAASLLRPAPALAAEEALETTTVRLAKI |
| Ga0070698_1018139891 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIMQTRRRFLATLSLGGAAGYLRPRPSLAVDGRLETTAIRLWKG |
| Ga0066700_106369461 | 3300005559 | Soil | MPMMQTRRRFLSTLSLTGAASLVRPSLALAAEGALETTTVRLTK |
| Ga0066705_109287141 | 3300005569 | Soil | MTTMQTRRRFLTTLSLAGAAGLVRARPALAAEGEPEITSV |
| Ga0066708_108264571 | 3300005576 | Soil | MPITQSRRQFLTTLSLAGAAGLVRAPPAPAAEGALETTT |
| Ga0066706_107491462 | 3300005598 | Soil | MTQTRRRFLTTLSLAGAAGLLRPPPALAAEERLETTSLRLAKLVD |
| Ga0070763_100466371 | 3300005610 | Soil | MPMRQTRRRFLATLALGGTTGLVRPRPALAGEGAPEITSVRIQKS |
| Ga0066903_1037731161 | 3300005764 | Tropical Forest Soil | MSIMPTRRRFLTTLSLAGAAGLVHPPRGLAEEGALETTTVRLPKI |
| Ga0066903_1045674982 | 3300005764 | Tropical Forest Soil | MPITHSLRRFLATASAAGAAALLRPSHVFATEGALETTTVRIAKVGAV |
| Ga0066903_1067534112 | 3300005764 | Tropical Forest Soil | RFLTTTLSLAGAAGLVRARPALAGDGAPEITSVRIQVI* |
| Ga0066903_1068057842 | 3300005764 | Tropical Forest Soil | MMQTRRRFLTTMSLAGAAGLLHVPPAPAAEGALETPTVRLQKV |
| Ga0066903_1079424891 | 3300005764 | Tropical Forest Soil | MSLIQTRRRFLTTLSLAGAAGLFHAPPSQAAEGVLETTTVRIG |
| Ga0070717_120178481 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIRQTRRRFLTTLSLAGAAGLARAPRVRAGEGVLE |
| Ga0070716_1011174701 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIMQTRRRFLSTLSLAGAAGLVRPPAVFAAEGRLET |
| Ga0070712_1003422373 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIRQTRRRFLTTLSLAGATGLVRAPRVRAAEGVLE |
| Ga0070712_1011564733 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIRHTRRRFLTTLTLAGAAGLVRAPRVRAAEGVLET |
| Ga0066660_112644632 | 3300006800 | Soil | MAMMQTRRRFLTSLSLTSAASLFRAPRVMAAEGALETNTVRFM |
| Ga0079220_114533872 | 3300006806 | Agricultural Soil | MMLSRRQFLTTLALAGTAGLPRLAPALAAEGTLETTTVRLVNDGSTC |
| Ga0099791_104983831 | 3300007255 | Vadose Zone Soil | MAIMQTRRQFLTTLSLAAAAGFLRSPPALAAEGALETMTV |
| Ga0099793_104877262 | 3300007258 | Vadose Zone Soil | MPLTQTRRRFLTTTLSLAGAAGLVRAPQALAGDGEPETTSVRISRSPSICN |
| Ga0066710_1019094562 | 3300009012 | Grasslands Soil | MPMMQTRRRFLTALSMAAAAALLPRAPPLAAEGPLEPTTVRCRT |
| Ga0066710_1044956881 | 3300009012 | Grasslands Soil | MPITQSRRHFLTTLSLAGAAGLLRASSAPAAEGREA |
| Ga0099830_116096721 | 3300009088 | Vadose Zone Soil | MAMMQTRRRFLTTLSLAGAAGLARVPRAPAAEEPLETTT |
| Ga0066709_1040975601 | 3300009137 | Grasslands Soil | MSIIQSRRRFPTMLSMAGAASLVLPPRALAATGGLETTTVRL |
| Ga0075423_125807071 | 3300009162 | Populus Rhizosphere | MPIIQNRRQFLTTLSLAGAASLVRAPPSPAAEGSLETTTVRLAKNEK |
| Ga0126374_104609161 | 3300009792 | Tropical Forest Soil | MLITQTRRRFLTTLSLAGAGSLVRAPRVAAAEKDLETTA |
| Ga0126374_112309901 | 3300009792 | Tropical Forest Soil | MTTTRRHFLTTLSLAGACLVRAPTVLASEGPPENTTVRL |
| Ga0126384_101555373 | 3300010046 | Tropical Forest Soil | MPMMQTRRRLLTTLSLAGAAGVLGARQPLAAPAGLETTA |
| Ga0126384_121218362 | 3300010046 | Tropical Forest Soil | MPMMQTRRRFMTSLSVAGAAGLLHAPPSRAAEGAL |
| Ga0126373_102221581 | 3300010048 | Tropical Forest Soil | MPNMQTRRRFLTTLSLAGAAGLLGAPAPAAAEGLPE |
| Ga0126373_106952601 | 3300010048 | Tropical Forest Soil | MTPSQTRRQFLTILSLGGAAALGRMPPAHAAEERLETTVLR |
| Ga0126373_115655041 | 3300010048 | Tropical Forest Soil | MRITQSRRQFLTTLSLAGAARLVAAPVALAEERPLETPSVRLAK |
| Ga0126373_117118672 | 3300010048 | Tropical Forest Soil | MSTTQTRRRFLKTLSLAGTASLVRAPRVLAAEGALETTTVRFA |
| Ga0126376_103098541 | 3300010359 | Tropical Forest Soil | MSMIQTRRRFLTTLSLAGAAGLIYTPQAPAAEGALETATVRILKNP |
| Ga0126376_105546781 | 3300010359 | Tropical Forest Soil | MAIIQNRRQFLTTLSLAGAASFVRAPPSAAAEGSL |
| Ga0126372_129693622 | 3300010360 | Tropical Forest Soil | MPMMQTRRRLLTTLSLAGAAGLLGVPSAPAAERDLETTTVRF* |
| Ga0126378_105802131 | 3300010361 | Tropical Forest Soil | MSTIQTRRRFLTRISLAGASLACPPPLLAAEGPLETTTVRLQKPAL |
| Ga0126378_124820391 | 3300010361 | Tropical Forest Soil | MLQTRREFLTVLSLAGAAGLLRAPLSQAAEGALETTT |
| Ga0126378_134714971 | 3300010361 | Tropical Forest Soil | MPLIQTRRRFLTTLSLAGAAGLFHAPPSQAAEGVLETTTVRIG |
| Ga0126379_113499863 | 3300010366 | Tropical Forest Soil | MEIGQTRRRFLTTLSLVGAASLPRLPRALAAEGPLETTSVRLVNDHSICIAP |
| Ga0126379_118008002 | 3300010366 | Tropical Forest Soil | MPTTQTRRRFLTMTALAGAAGLVHGPPALAAGGGSLET |
| Ga0126381_1036202762 | 3300010376 | Tropical Forest Soil | MRTRRQFLTLLSAGAAGLLGMPSARAGEERLETTTLRLMR |
| Ga0126383_133558772 | 3300010398 | Tropical Forest Soil | MTQTRRRFITTLSLAGAASFVRTPSSLAAAEAPLETTSVRLAYDGT |
| Ga0126383_135110602 | 3300010398 | Tropical Forest Soil | MQMTQTRRRFLTTALSLAGAVGLVRARPALAGDGAPE |
| Ga0137392_112386972 | 3300011269 | Vadose Zone Soil | MPTMQTRRRFLTNLSLAGAVSFARIPSPLAAEGPLETTTVRLSK |
| Ga0137392_116459542 | 3300011269 | Vadose Zone Soil | MRQTRRRFLTTLSLAGAASFLRGGPSLAAEGALETTRVRI |
| Ga0137391_114522812 | 3300011270 | Vadose Zone Soil | MTMTQTRRRFLTTLSLAGAAGLVGVPSALAAEGPLET |
| Ga0137363_101736231 | 3300012202 | Vadose Zone Soil | MRITQNRRQFLTTLSLASATALVRGPPALAAEGSLETTTIRL |
| Ga0137363_112990541 | 3300012202 | Vadose Zone Soil | MPMMQTRRRFLTTLSLAGAAGLLRAQPALAGEGAPEITSVRIQKSPSICN |
| Ga0137399_105134502 | 3300012203 | Vadose Zone Soil | MRITQNRRQFLTTLSLASATALVRGPPAPAAEGSL |
| Ga0137362_112438402 | 3300012205 | Vadose Zone Soil | MAMTQTRRRFLTTLSLAGTAGLLRVPQALAAEGALETTT |
| Ga0137370_104270291 | 3300012285 | Vadose Zone Soil | MRVTQNRRQFLTTLSSAGASALVRGPPALAAEGALETT |
| Ga0137370_105400611 | 3300012285 | Vadose Zone Soil | MPITQTRRRFLSTLSLAGAAGLVRPPAVFAAEGRLETTSVR |
| Ga0137360_105104651 | 3300012361 | Vadose Zone Soil | MAIMQTRRQFLTTLSLAGASALVRGPPALAAEGSLETTTVRL |
| Ga0137390_104680793 | 3300012363 | Vadose Zone Soil | MRFPMSTTQTRRRFLTTLSLAGAAGIVRAPRVLAAEGALE |
| Ga0137397_100837701 | 3300012685 | Vadose Zone Soil | MPITQTRRQFLTTLSLAGAAGLLHAPPSRAAEGALETTTV |
| Ga0137397_113315672 | 3300012685 | Vadose Zone Soil | MPIMQSRRRFLTTLSLAGAAGLLRAPAALAVEGSLETT |
| Ga0137395_110389882 | 3300012917 | Vadose Zone Soil | MPTTQSRRRFLTTLSLAGAAGLVRGPPARAVEGSLETT |
| Ga0137394_100780313 | 3300012922 | Vadose Zone Soil | MRITQNRRQFLTTLSLASATALVRGPPALAAEGSLETTTIRLAKE* |
| Ga0137394_109669851 | 3300012922 | Vadose Zone Soil | MSMMQTRRRFLTTLSLAGAAGLVLPPRARGGEGALETT |
| Ga0126375_108727232 | 3300012948 | Tropical Forest Soil | MPMIQTRRRFLATTAVAGTAGLVGMPALQAAEGAL |
| Ga0126369_103782481 | 3300012971 | Tropical Forest Soil | MPMTQTRRRFLTTALSLVSATGLVRARRALAAEGAPEITTVRIGK |
| Ga0126369_126225702 | 3300012971 | Tropical Forest Soil | MRITQSRRQFLTTLSLAGAAGFVHAPPLQAAEEPPETTT |
| Ga0182036_101943513 | 3300016270 | Soil | MVQTRRRFLTTLSLAGAAGLVGASPSPAAEGPLET |
| Ga0182036_103459922 | 3300016270 | Soil | MPVMQTRRRFLTGLSMAAAASLVRAPAAAGEDALETTT |
| Ga0182036_103920542 | 3300016270 | Soil | MYTRRRFLTTLSLTGAAGLLGARPGLAEKGGLETTSVRF |
| Ga0182036_112282841 | 3300016270 | Soil | MPITQTRRRFLTTFSLGGAVGLLLHSPRAPAAEGSLETAAVRL |
| Ga0182036_117393122 | 3300016270 | Soil | MTTTQTRRRFLTTLLLGAAGLLRAPQSLAAEAAPE |
| Ga0182041_107240892 | 3300016294 | Soil | MAIIQNRRQFLTALSLAGAASLVRAAPSAAAEGSLETT |
| Ga0182041_111033701 | 3300016294 | Soil | MPMTQTRRRFLTTTLSLASASGFVRARPAFAGEGAPEITSVRIQKSSSI |
| Ga0182041_112332011 | 3300016294 | Soil | MTPSQTRRQFLTILSLGGAAALGRMPPAHAAEERLETTVLRLLHKPS |
| Ga0182041_114087252 | 3300016294 | Soil | MSTVQTRRRFLTTLSLAGAVGPLRTPRALAAEGALETT |
| Ga0182033_100572241 | 3300016319 | Soil | MPIMQTRRQFLTGLSLAGAAGALRAPMALATEGALETTKVRF |
| Ga0182033_114106992 | 3300016319 | Soil | MVSMHTRRRFLAGLSLAGAAGRVRAPPALAADGALETTTVRIAKIG |
| Ga0182033_118636542 | 3300016319 | Soil | MVNMHTRRRFLAGLSLAGAAGLVRAPPLLAADGAIET |
| Ga0182035_100442945 | 3300016341 | Soil | MRTIQTRRRFLTTLSMASAAGFLRARPALAAEGTLETTAVRLAKNQGI |
| Ga0182035_100831051 | 3300016341 | Soil | MSTMQTRRRFLMALSLASAARFVPARPGLAAEALP |
| Ga0182035_107133702 | 3300016341 | Soil | MSTLQTRREFITSLALGGAAGLVRVPHALAAEGAL |
| Ga0182035_114287702 | 3300016341 | Soil | MPTTQTRRRFLATASLASAGGLLRPPRAGAADGALETTSVR |
| Ga0182032_119182991 | 3300016357 | Soil | MPRTQTRRRFLTTLSLAGAAGVVRAPALFAAERSLETTSVCLGRKSL |
| Ga0182034_113585521 | 3300016371 | Soil | MPRTQTRRRFLTTLSLAGAAGVVRAPALFAAERSLETTSVRLGRKSL |
| Ga0182034_117837541 | 3300016371 | Soil | MSEAQTRRLFLTTLSLAGAASLIRAPPLLAREEPLETTTVRIAKSSAICIA |
| Ga0182034_120855642 | 3300016371 | Soil | MSTVQTRRRFLTTLSLAGAVGPLRTPRALAAEGALE |
| Ga0182040_105770391 | 3300016387 | Soil | MRITQSRRQFLTILSLAGSTNLLRLPRALAGDGALETTTVRLASDPGV |
| Ga0182040_106462032 | 3300016387 | Soil | MLTQTRRRLLTTMSLGGAGSLLHTPRLLAAEGALET |
| Ga0182040_110789271 | 3300016387 | Soil | MITTLTRRGFLTTLSLTGAASLLRLPRALAAEDALETTTVRLVNDGVICEAPLMAA |
| Ga0182040_118220001 | 3300016387 | Soil | MSQTQSRRRFLTTLSAAGAASLVRTSPAIAEDGLETKTVRIAHLPGI |
| Ga0182037_105611341 | 3300016404 | Soil | MVSMHTRRRFLAGLSLAGAAGRVRAPPALAADGALET |
| Ga0182037_108253661 | 3300016404 | Soil | MPIMQTRRRFLTAAALAGAADLIRPPRTLAAEGPL |
| Ga0182039_121541602 | 3300016422 | Soil | MTILQTRRRFLTTISMAGVAGLVGVPRVSAAEGVLET |
| Ga0182038_108258382 | 3300016445 | Soil | MTTQTRRRFLTTLSLAGAAGFVGAPRVRAAEGPPET |
| Ga0182038_112208642 | 3300016445 | Soil | MPMLQTRRRFLTGLSLAGAAGLLKARPVRAARDSL |
| Ga0182038_121026141 | 3300016445 | Soil | MSLIQTRRRFLTTLSMAGTAGFVGAPCLAAAEGSLETTSI |
| Ga0182038_121105162 | 3300016445 | Soil | MTMTQTRRQLLTALSLAGAAGLVRASPALAAEGPLETP |
| Ga0187783_101481383 | 3300017970 | Tropical Peatland | MAMTHTRRRFLTGLSLAGAASLVRAPYSLAAEGALETTTVLIGKT |
| Ga0187804_102418562 | 3300018006 | Freshwater Sediment | MPITQTRRRFLTVLSLAGAVGLLRPLSSLAAEGAPE |
| Ga0187766_110054761 | 3300018058 | Tropical Peatland | MATVQTRRRFLTTTLSLASASAFVRPQPALAGEGAPE |
| Ga0187784_109036511 | 3300018062 | Tropical Peatland | MSIVQTRRNFLTTLSAAGTAGLVRAPASLAAEGALETTTVR |
| Ga0066662_129076471 | 3300018468 | Grasslands Soil | MRIAQTRRRFLTTLSLAGAASLVRSPLSLAPEEPPEGNAL |
| Ga0210407_105187332 | 3300020579 | Soil | MPIMQNRRQFLTTLSVAGAASLVRAPPSPAAEGSLEMTTVRLMRALPGI |
| Ga0210403_107792401 | 3300020580 | Soil | MSLMQTRRRFLTTLSLAGAAGLVRAGPALAGEGAPEITSVRLHKSPSV |
| Ga0210403_112019612 | 3300020580 | Soil | MGMMQTRRSFLTTLSLAGASRFVPTAPVLAAEGALETTILRIANRHSLC |
| Ga0210399_112963671 | 3300020581 | Soil | MPLMQTRRRFLTTLSLAGAAGLVRARPALAREGAPEITSVRIQKSSS |
| Ga0210395_112212702 | 3300020582 | Soil | MPSMQTRRRFLTTLSLAGAAGLVRPPLASAAEGALET |
| Ga0210400_102661922 | 3300021170 | Soil | MPMTQTRRRFLSTLSLAGAAGLGIAQRAYAAEGPLEITTVRLLRAPAI |
| Ga0210400_104881051 | 3300021170 | Soil | MPMTLSRRQFLTTLSLAGAAGLPRLAPALAAEGAL |
| Ga0210400_108951432 | 3300021170 | Soil | MSPMQTRRRFLTTLSLAGAAGLIQPRPTAAEGTLETTTVRL |
| Ga0210400_113638731 | 3300021170 | Soil | MTTMQTRRRFLMRLSLAGAAGLVRAPQVRAAEGVPE |
| Ga0210408_101657841 | 3300021178 | Soil | MPTAQTRRRFLATASLAGAAGLLRPPPLLAAEAPLETTA |
| Ga0210408_107766592 | 3300021178 | Soil | MPMTLSRRQFLTTLSLAGAAGLPRLAPALVAEGALETTTVRL |
| Ga0210396_103524621 | 3300021180 | Soil | MTMMQTRRRFLTTLSLAGAAGFLGAPAVHGAEGAIETTAIRL |
| Ga0210396_106936702 | 3300021180 | Soil | MQPICTRRRLLTIALSMAGAPGLVRAPLVLAAEGALETTTVRIFA |
| Ga0210397_108846171 | 3300021403 | Soil | MPMTQTRRRFLTTLSLTGAASLFRLPLSQAAEGPLETTT |
| Ga0210387_108179431 | 3300021405 | Soil | MPVMQTRRRFLTTLSLAGAAGLVRAGPALAGEGAPEITSVRLHKS |
| Ga0210387_109168053 | 3300021405 | Soil | MPMMQTRRRFLTSLSLAGAAGLLHAPAVAGEEPPEITPPR |
| Ga0210387_114300292 | 3300021405 | Soil | MPIVRTRRQFLTTAALAGAAGLARIPRALAAEGALETTTVS |
| Ga0210387_116280752 | 3300021405 | Soil | MPRTQTRRRFLAILALAGGAGAVRTPRAVAAEETLETTSVRFVKNPAIC |
| Ga0210383_111298782 | 3300021407 | Soil | MPMKQSRRRFLTTLSIAGAAGLVRMPPAWAAEGALETR |
| Ga0210384_108027612 | 3300021432 | Soil | MPIMQTRRRFLTTLSLAGAAGLVRARPALAGEGAPEITSVRIQKSPSICN |
| Ga0210402_101280444 | 3300021478 | Soil | MTIMQTRRRFLTTMSLAGAAGLALPPRSLAAEGPLETTT |
| Ga0210402_106190631 | 3300021478 | Soil | MTILQTRRRFLTTISMAGAAGLVGVPQVRAAEAALETTTV |
| Ga0210402_114449762 | 3300021478 | Soil | MPMMQTRRRFLTTLSLAGAPGLLHASPTVAAEGPLETTTVP |
| Ga0210402_118182521 | 3300021478 | Soil | MPMLQTRRRFLATLALAGAAGVLRAPGALAAEGLLETT |
| Ga0210409_103995041 | 3300021559 | Soil | MPMKQTRRRFLSTLSLAGAAGLGIAQRAYAAEGPLEITTVRL |
| Ga0210409_105919342 | 3300021559 | Soil | MPMMQTRRRFLTTLSLAGAAGLVRARPALAAEGAPEITSVRIQKSPS |
| Ga0210409_109988622 | 3300021559 | Soil | MTTGHTRRRFLTTLSLAGAAGLIRAPRALAAEGSSK |
| Ga0126371_108972541 | 3300021560 | Tropical Forest Soil | MATKQTRRRFLTTLPLAGAANLLRPPRARAADGAL |
| Ga0126371_110350901 | 3300021560 | Tropical Forest Soil | MSIMPTRRHFLTTLSLAGAAGLVHPPRGLAEEGALE |
| Ga0126371_131940652 | 3300021560 | Tropical Forest Soil | MPMQQSRRRFLTTLSMAGAAGLLRVPLAQAAEGALETTNVR |
| Ga0207699_105241671 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MVQTRRRFLTSLAAAGAAGLAHASRVLAAEGPLETTA |
| Ga0207684_104938392 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMMQTRRRFLTTLSLAGAAGVVLPPRALAGEGALEATTL |
| Ga0207684_107391332 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPITQSRRHFLTTLSLAGAAGSMPAPSALAAEGLLETTTV |
| Ga0207663_102127221 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLMQTRRRFLTTLSLAGAAGFMHARPALAGDGAPEITSVRIQKSPSICN |
| Ga0207646_117189291 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLMQTRRRFLTTLSSAGAAGLVHARPALAGEGAPEITSVRIQ |
| Ga0207700_113988581 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMKQSRRRFLTTLSIAGAAGLVRMPPAWAAEGALETT |
| Ga0207700_118222561 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTRRRFLTTLSLASAAGLVRPPLASAAEGALETTTVRIAKLGAA |
| Ga0207664_102513941 | 3300025929 | Agricultural Soil | VSRTQTRRRFLTTLSLAGAASLMRAPRTLAAEGAL |
| Ga0207664_112191731 | 3300025929 | Agricultural Soil | MTMMQTRRRFLTTLSLAGAAGFLGAPAVHGAEGALE |
| Ga0209056_102782791 | 3300026538 | Soil | MPMMQTRRRFLATLSLAGTAGLVRVQSALAGEGAPEITSVRIQKSPSIC |
| Ga0179593_10400602 | 3300026555 | Vadose Zone Soil | MPMRQTRRRFLATLALGGTTGLVRPRPALAAEGVPEITSVRIQKSPSTMFPK |
| Ga0208989_102289371 | 3300027738 | Forest Soil | MSIMQTRRRFLGMLSLAGAAGLLHPPAVFAADGPLETTSLRL |
| Ga0209448_100499203 | 3300027783 | Bog Forest Soil | MEIVHTRRRFLTTLSLAGAAGFLHAPRASAADGPLETTA |
| Ga0209448_101414511 | 3300027783 | Bog Forest Soil | MIRTQTRRRFLTTLSLAGAAGFLHAPRASAADGPLETTA |
| Ga0209039_104185082 | 3300027825 | Bog Forest Soil | MPNMPTRRRFVATLSLAGAAGLVRIPPALAAEGPLETT |
| Ga0209465_101719763 | 3300027874 | Tropical Forest Soil | MPITQTRRRFLATTVSAGAAGLLRPSPVAADDERLETT |
| Ga0209526_100917963 | 3300028047 | Forest Soil | MLPRQTRRRFLATMSLAGAAGLLRPPAVFAAEERLE |
| Ga0209526_106142152 | 3300028047 | Forest Soil | MTMMQTRRRFLTMLSLAGAEGLLRPAPALAAERPLETTTVRLA |
| Ga0209526_108641012 | 3300028047 | Forest Soil | MPVTQTRRRFLTTTLSLAGTAGLVRARPALAGEGAPEITSVRIQKSPSI |
| Ga0137415_104214311 | 3300028536 | Vadose Zone Soil | MPIMQTRRRFLTTTLSLAGAAGLVRARPALAGEGAPEITSVRIQKSPSICNAP |
| Ga0137415_114955142 | 3300028536 | Vadose Zone Soil | MRITQNRREFLTTLSLAGAASLVRSPPALPAEGALETTTVRLAKTD |
| Ga0170824_1061730022 | 3300031231 | Forest Soil | MPNTQTRRRFLTTAALAGAAGLVRTPRALAAEGSL |
| Ga0170818_1119850211 | 3300031474 | Forest Soil | MPLTQTRRRFLATLSLAGAAGFAPAPRVLAAEGALETTTVRLVNDG |
| Ga0170818_1144992522 | 3300031474 | Forest Soil | MPMMQTRRRFLATLSLAGAAGLVQGPPALAAEGVLETT |
| Ga0318516_101686513 | 3300031543 | Soil | MPIKQTRRRFLATLSFAGAAGLLGGWRALAAKDGLE |
| Ga0318516_106831241 | 3300031543 | Soil | MPVMQTRRRFLTGLSMAATANLVRAHSAAAGEGALETTTVRLSKIAG |
| Ga0318516_107015141 | 3300031543 | Soil | MQTMQTRRRFLTTLSLAGAAGLLGASPARATEGALETTAIRLYKIAN |
| Ga0318516_107326601 | 3300031543 | Soil | MALMQTRRQVLTALSLAGSAGLLGAPVVLAAEGVLETPTV |
| Ga0318534_108377301 | 3300031544 | Soil | MMYTRRRFLTTVSLAGAAGLLRPPPALAAEETLETTAIRMAK |
| Ga0318541_101674571 | 3300031545 | Soil | MPIMQTRRRFLTTATLAAAGLTRIQRVMAEEGPLETTTIRIGKN |
| Ga0318538_106567751 | 3300031546 | Soil | MPIVQTRRRFLTTLSLASVAGLVGAQPSLAAEGELETT |
| Ga0318538_107676702 | 3300031546 | Soil | MPNTQTRRRFLTTLSLAGAAGLLGAPPARAAEGALETTGIRLYK |
| Ga0318528_102795022 | 3300031561 | Soil | MKTMQTRRRFLTTLSLAGATGLMWAPRVLATEAALETTTVRLTKEG |
| Ga0318528_103459391 | 3300031561 | Soil | MRITQSRRQFLTTLSLAGAARLVAAPAALAEEGPLET |
| Ga0318528_104391611 | 3300031561 | Soil | MPLTQTRRRFLTTLSLAGAAGVVRAPALFAAERSLETTSVRLGR |
| Ga0318515_102035051 | 3300031572 | Soil | MPLMQSRRRFLTTLSMAGAAGFLRTPPALAGEGPLE |
| Ga0310915_104342381 | 3300031573 | Soil | MPTRQTRRRFLATLSMTGAAGFLCAPRVLAADGALETTTVRLVADYSIC |
| Ga0310915_111179531 | 3300031573 | Soil | MLMMQTRRRFLTTLSLAGTAGFRRASPTRATEAAL |
| Ga0318555_102582011 | 3300031640 | Soil | MTLMQTRRQVLTTLSLAGAAALFRAPYALASEGALETPTVRLAK |
| Ga0318555_106664241 | 3300031640 | Soil | MPITQTRRRFLTTFSVAGVASLLHAQCVPAAEEALETTTI |
| Ga0318542_106000002 | 3300031668 | Soil | MPTMQTRRRFLTALSLAGTTSLLRAPLAFAGEGALETTAVRLLKFPGIC |
| Ga0318561_102920842 | 3300031679 | Soil | MPTRQTRRRFLATLSMTGAAGFLCAPRVLAAEGALETTTVRLVADYSIC |
| Ga0318561_106465491 | 3300031679 | Soil | MSIMPTRRRFLTTLSLAGAAGLVHPPRGLAEEGALETTTVRL |
| Ga0318561_106812871 | 3300031679 | Soil | MMRITQSRRQFLTMASLAAACRFAGARPALAAEGPLETTTVRFAK |
| Ga0318574_100860614 | 3300031680 | Soil | MMYTRRRFLTTVSLAGAAGLLRPPSALAAEETLETT |
| Ga0318574_105169311 | 3300031680 | Soil | MPMVQTRRRFLTTLSMAGAAGLLRAPPPLAAEGALETT |
| Ga0318574_105412132 | 3300031680 | Soil | MTMLQTRRRFLARLSLAGAACLAHPPLAVAEEPPETTSVRF |
| Ga0318572_108168162 | 3300031681 | Soil | MPIIQTRRRFLTTMSLAGAAGLLHMPPAPAAEEALE |
| Ga0318560_102116112 | 3300031682 | Soil | MRSTQSRRQFLTMLSLAGVARLVAAPAARAGEGPLETTTVRL |
| Ga0318560_106868222 | 3300031682 | Soil | MVSMHTRRRFLAGLSLAGAGGLVRAPPLMAADGALETTT |
| Ga0306917_100083006 | 3300031719 | Soil | MPLTQTRRHFLTGLSLAGATAFIRSPRSLAAEGTLE |
| Ga0318500_104141042 | 3300031724 | Soil | MPMRQSRRRFLTTLSMAGAAGLVRVPLAQAAEGTPETT |
| Ga0306918_100029071 | 3300031744 | Soil | MPTRQTRRRFLATLSMTGAAGFLCAPRVLAAEGALETTTVRLVADYSICSPVL |
| Ga0306918_100332541 | 3300031744 | Soil | MPMVQTRRRFLTTLSMAGAAGLLRAPPPLAAEGALETTTVRI |
| Ga0318492_106580961 | 3300031748 | Soil | MPMPQSRRRFLTTLSMAGAAGLIRVPLAQAAEGTLETTTV |
| Ga0318494_102786151 | 3300031751 | Soil | MPITQSRRQFLTALSLAGAARLAGAPAALAAEGPLETTTVR |
| Ga0318494_108314721 | 3300031751 | Soil | MSEAQTRRLFLTTLSLAGAASLIRAPPLLAREEPLETTTVRIAKSSAI |
| Ga0318537_100453424 | 3300031763 | Soil | MSAGNGEDAMEIGQTRRRFLTTFSLAVGASLLRLPRALAAEGELDTTT |
| Ga0318537_100663832 | 3300031763 | Soil | VRTTQTRRRFLTTLSLAGAAGSLRARPSFAAEGPPETTV |
| Ga0318537_101866241 | 3300031763 | Soil | MMTQTRRRFLATLSAASAAGFVRQPPSLAAQGTLETTAVRIAKLGAVC |
| Ga0318535_104494722 | 3300031764 | Soil | MPMTQIRRRFLTTLSVAGGAALARTQPTLAEEGAPEITTVRIQKSPSIC |
| Ga0318554_108171933 | 3300031765 | Soil | MMYTRRRFLTSFSLAGAAWWLRVPAIAAEERLETTSVR |
| Ga0318509_101864011 | 3300031768 | Soil | MMYTRRRFLTTVSLAGAAGLLRPPPALAAEETLETTAIR |
| Ga0318509_102050651 | 3300031768 | Soil | MPMRQTRRRFLTTLSLAGAAGFLRAPRVLASKGALET |
| Ga0318509_104015702 | 3300031768 | Soil | MTTIQTRRRFLTTASLAGAAALIRAPPSPATEGLET |
| Ga0318546_105055972 | 3300031771 | Soil | MSMVQTRRGFLTTLSLAGAAGLAFPPLSLGAEGTLETTTVRIHKAPVIC |
| Ga0318566_106310932 | 3300031779 | Soil | MPMQQSRRRFLTTLSMAGAAGLVRVPLAQTAEGTLE |
| Ga0318547_101408553 | 3300031781 | Soil | MPTRQTRRRFLATLSMTGAAGFLCAPRVLAAEGALETTTV |
| Ga0318547_103471693 | 3300031781 | Soil | MTTMQTRRQFLTTLSLASAAGLAHPSRLWAAEGSLETTTVRL |
| Ga0318548_101496212 | 3300031793 | Soil | MTAVQTRRRFLIAMSLGGAAGLLHVPPAPAAEGALETPTVR |
| Ga0318548_102456772 | 3300031793 | Soil | MTLMQTRRRFLATLSLAGAVGLRAPRVLAAEGALETTTVRL |
| Ga0318548_105864732 | 3300031793 | Soil | MLIMQTRRRFLTTLSLAGAAGLLRAPPSLAAEGALETTRI |
| Ga0318576_102554982 | 3300031796 | Soil | VMPMRQTRRRFLTTLSLAGAAGFLRAPRVLASKGALETTTVRLVADYS |
| Ga0318550_101062541 | 3300031797 | Soil | MPIMQTRRRFLTTLSMAGAAGVVGARPGRVDEGSLETTAVR |
| Ga0318550_102904521 | 3300031797 | Soil | MPMIQTRRRFLTTLSLAGAACVFRAARPLAAEQPPET |
| Ga0318550_105380671 | 3300031797 | Soil | VYAGLPMPLIQTRRRFLTGLSMAGAAGLFHTPPSQAAEGVLE |
| Ga0318523_102204391 | 3300031798 | Soil | MPITQSRRQFLTALSLAGAARRVGAPTAFAAEGALETTT |
| Ga0318565_103364011 | 3300031799 | Soil | MRITQSRRQFLTMLSLTGAAGLVAAPAALAEEGPLETR |
| Ga0318499_100520691 | 3300031832 | Soil | MPIMQTRRRFLTTLSMAGAAGVVGARPGRADEGSLETTAVRIAST |
| Ga0310917_102632981 | 3300031833 | Soil | VYAGLPMPLIQTRRRFLTGLSMAGAAGLFHTPPSQAAEG |
| Ga0318511_100934211 | 3300031845 | Soil | MMQTRRRFLTTLALTGAAGFARAPRVLSAEGRLETT |
| Ga0318512_103098902 | 3300031846 | Soil | MPIAQTRRRFLTELSLAGVAGLLRARPSFAAEGPPETT |
| Ga0306919_101686561 | 3300031879 | Soil | MPTMQTRRRFLAAVSLAGAASLLRPPRASAAEGTLETTSVRIAST |
| Ga0306919_106567191 | 3300031879 | Soil | MSLPHTRRHFLGGLSAAGAASLVRSPGTVAAEGALETASVRLPKIP |
| Ga0306925_116124631 | 3300031890 | Soil | MTTMQTRRQFLTTLSLASAAGLAHPSRLWAAEGSLETTTVRLPRTAAIC |
| Ga0306925_118171402 | 3300031890 | Soil | MQIAQSRRRFLTTLSLAGAASVLRPPRALAAEDVL |
| Ga0306925_118731261 | 3300031890 | Soil | MPVQSRRRFLTNAAMAGAAGLLRAPPSAAAEGALETTTVRI |
| Ga0318520_109556651 | 3300031897 | Soil | MPTRQTRRRFLATLSMTGAAGFLCAPRVLAAEGALETTTVRLVADYS |
| Ga0306923_113950151 | 3300031910 | Soil | MLITQTRRRFLSTLSLAGTAALGLAQRAFAAEGPLEIT |
| Ga0306923_117622452 | 3300031910 | Soil | MPLAQTRRRFLTLASAAGAASLVRAPRVLGAEGAL |
| Ga0306921_108204452 | 3300031912 | Soil | VTGILTRRRFLTTLSVAGAAGLVHVPRTLAAEGALETTTVRLPKSPSI |
| Ga0306921_114648462 | 3300031912 | Soil | MTMEQTRRRFLTTLSVAGAAGLLGGKPALAARDPLETTSVR |
| Ga0306921_117300162 | 3300031912 | Soil | MGTMQTRRKFLTTLSLAGAAGLVRAPPSLAAEGTLE |
| Ga0306921_122687792 | 3300031912 | Soil | MAIVQTRRQFLTTLSAAGAAGMVRAPPSQAADGALETTTVRIV |
| Ga0306921_125376931 | 3300031912 | Soil | VPTMQSRRRFLTTLSLTGAAGLVRAPRVLAAEETLETTTVRLQMPRLCVA |
| Ga0310912_114942511 | 3300031941 | Soil | MMTMQSRRRFLTALSLAGAAGLIRAPVSRAAEGALETTTVRLG |
| Ga0310916_106830962 | 3300031942 | Soil | MPVTQSRRQFLATLSLAAAARLAGAPAALAAEGPLETTT |
| Ga0310916_109639181 | 3300031942 | Soil | MLIQQTRRRFLTTLSLAGAAGLLGVPPARAAEGALET |
| Ga0310916_111191022 | 3300031942 | Soil | MTMMQTRRRFLTTMSLAGAAGLLHLPPAPAAEGVLETTAVRLNKN |
| Ga0310913_111765302 | 3300031945 | Soil | MSTVQTRRRFLTTLSLAGAVGPLRTPRALAAEGALETTTVRIAKG |
| Ga0310909_110884161 | 3300031947 | Soil | MKTMQTRRRFLTTLSLAGATGLMWAPRVLATEAALETTTVRLTK |
| Ga0310909_113494072 | 3300031947 | Soil | MTMLQTRRRFLTTMPLTCTAELLRVPPTPAAAEALETPNVRLQKVSL |
| Ga0310909_114985342 | 3300031947 | Soil | MMPVTQTRRRFLATMSLAGAARLLHSPRAFAVEGALE |
| Ga0306926_108794122 | 3300031954 | Soil | MPTTQTRRRFLATASLASAGGLLRPPRAGAADGALETT |
| Ga0306926_115241271 | 3300031954 | Soil | MPMTHTRRQFLTTVSLAGAASLLRHPCTWAAEPALETTTVRLAKLPV |
| Ga0306922_101119221 | 3300032001 | Soil | MPRTQTRRRFLTTLSLAGAAGVVRAPALFAAERSLETTSVRL |
| Ga0306922_103796131 | 3300032001 | Soil | MISKQTRRRFLTSLSMAGAAGLLRPRRALAAEGTLETTT |
| Ga0306922_106199481 | 3300032001 | Soil | MRLKQTRRRFLTTLSMASAAGLARAPLSQAAEGGLE |
| Ga0318569_101783263 | 3300032010 | Soil | MQTMQTRRRFLTTLSLAGAAGLLGASPARATEGALETTAIRLY |
| Ga0318507_102337832 | 3300032025 | Soil | MRITQSRRQFLTTLSLAATVRLAGAPPALASDGPLETTTVRLPK |
| Ga0310911_105040842 | 3300032035 | Soil | MPIAQTRRRFLTTLSLAGIAGSLRARPSFAAEGPPE |
| Ga0318559_103046881 | 3300032039 | Soil | MAMAQTRRRFLTALSLAGAAGLVRAPPSPAAEGALE |
| Ga0318549_101481211 | 3300032041 | Soil | MPVTQSRRQFLATLSLAAAARLGGAPAALAAEGPLETT |
| Ga0318558_102974641 | 3300032044 | Soil | MPIMQTRRRFLTTLSMAGAAGVVGARPGRADEGSLETTAV |
| Ga0318532_100281911 | 3300032051 | Soil | MPTMQTRRRFLTALSLAGTTSLLRAPLAFAGEGALET |
| Ga0318506_101444273 | 3300032052 | Soil | MMYTRRRFLTTVSLAGAAGLLRPPSALAAEETLETTTIR |
| Ga0318570_103111131 | 3300032054 | Soil | MMYTRRRFLTTVSLAGAAGLLRPPSALAAEETLETTTIRMAK |
| Ga0318533_101633973 | 3300032059 | Soil | MKTMQTRRRFLTTLSLAGATGLMWAPRVLATEAALETTTVRLTKE |
| Ga0318533_103032353 | 3300032059 | Soil | MRITQSRRQFLTILSLAGSTNLLRLPRALAGDGALETTTVRLASD |
| Ga0318505_100278193 | 3300032060 | Soil | MPIMQTRRRFLTTLSMAGAAGVVGARPGRADEGSLETA |
| Ga0318505_100566991 | 3300032060 | Soil | MRSTQSRRQFLTMLSLAGVARLVAAPAARAGEGPLETTTVRLGY |
| Ga0318505_100659523 | 3300032060 | Soil | MPVMQTRRRFLTGLSMAAAASLVRAPAAAGEDALETTTIRLS |
| Ga0318504_100160791 | 3300032063 | Soil | MPIIQTRRRFLTTMSLAGAAGLLHMPPAPAAEEALETPT |
| Ga0318504_104188551 | 3300032063 | Soil | MTLNQTRRRFLTTLSMAGAAGLLRPPRALAAEGALETTTV |
| Ga0318553_102382641 | 3300032068 | Soil | MAMLPTRRRFLTTLVAGAAGLAHGPRALAAEGPLETTVV |
| Ga0306924_112826631 | 3300032076 | Soil | MPMLQTRRRFLTALSMAGAAGLARVPPALAREGVL |
| Ga0306924_121066411 | 3300032076 | Soil | MPIVQIRRRFLTTLSLASVAGLVGAQPSLAAEGELETTTMRI |
| Ga0306924_124706202 | 3300032076 | Soil | MAMAQTRRRFLTALSLAGAAGLVRAPPSPAAEGALETTT |
| Ga0318577_101517672 | 3300032091 | Soil | MPLMQSRRRFLTTLSMAGAVGFLRTPPALAGEGPLETTT |
| Ga0318577_103192402 | 3300032091 | Soil | MAMTQTRRGFLTALSLAGVAGLVRAPPSPAAEGALETT |
| Ga0318540_100239241 | 3300032094 | Soil | MPIMQTRRRFLTTLSMAGAAGVVGARPGRADEGSLETAAVRIASTSGI |
| Ga0307471_1039698572 | 3300032180 | Hardwood Forest Soil | MRIGQNRRQFLATLSLAGTAALVRGPPALAAEGSLETTTVRLAKNEGIC |
| Ga0307472_1022605022 | 3300032205 | Hardwood Forest Soil | MPITQTRRRFLSTLSLAGAAGLVRPPAVFAAEGRLETTSVRLAKMPDMCMA |
| Ga0307472_1026628842 | 3300032205 | Hardwood Forest Soil | MTMTQTRRRFLTTLSLAGAASLGRIPPALAAESPLETTTVRL |
| Ga0306920_1002770774 | 3300032261 | Soil | MTTIQTRRRFLTTASLAGAAALIRAPPSPATEGLETT |
| Ga0306920_1007381111 | 3300032261 | Soil | MTHTRRSFLTALPAAGAASLVRAPPALAVEGAVET |
| Ga0306920_1011017592 | 3300032261 | Soil | MPMMQTRRRFLTTLSLAGTAGFLRTPTALAAEGALETTTVRFSSDAA |
| Ga0306920_1015678012 | 3300032261 | Soil | MSMMQTRRRFMTSLSVAGAAGLLHAPPSQAAEGALETTTVRIGKLS |
| Ga0306920_1036880042 | 3300032261 | Soil | MAMTQTRRRFLTTLSLAGVAGLVRAPPVQAAEGPPEITS |
| Ga0306920_1037620322 | 3300032261 | Soil | MPIMQTRRRFLATTALAGGGGLITIPRALAAEPPLET |
| Ga0306920_1037765051 | 3300032261 | Soil | MPQTQTRRRFLTGLSVAGAASLIRVPPGLAAEGALETTTVRLSK |
| Ga0306920_1038369322 | 3300032261 | Soil | MQTKQTRRRFLTTTLSLAGAAGLVRARPALAGDEASEIT |
| Ga0306920_1038761112 | 3300032261 | Soil | MTTPQTRRHFLTTLSMASAAGVLSVPRAPAAEERLETTAL |
| Ga0310914_102144281 | 3300033289 | Soil | MLQITQSRRQFLTTLSLAAAAPLAGVPTARAAERPLETTTV |
| Ga0310914_114071352 | 3300033289 | Soil | MPIMQTRRRFLTTLSLAGAAGLLHAPPTLAAEGRLETTSVRIGKLGA |
| Ga0310914_116941122 | 3300033289 | Soil | MQTKQTRRRFLTTTLSLAGAAGLVRARPALAGDEASEITSVRIQKSSSICNAPR |
| Ga0318519_105954061 | 3300033290 | Soil | MYTRRRFLTTASMAGAASLVCPRQPIAAEELLETTTVRLGKILASCDAPI |
| Ga0318519_109373081 | 3300033290 | Soil | MSMMQTRRRFMTSLSVAGAAGLLHAPPSQAAEGALETTTVRI |
| ⦗Top⦘ |