| Basic Information | |
|---|---|
| Family ID | F011039 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 296 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LASIKQVAAKEFGVEHTTVQLERAGLPAQSGYVMPEPAKK |
| Number of Associated Samples | 226 |
| Number of Associated Scaffolds | 296 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.68 % |
| % of genes near scaffold ends (potentially truncated) | 97.30 % |
| % of genes from short scaffolds (< 2000 bps) | 88.51 % |
| Associated GOLD sequencing projects | 204 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.324 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.284 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.041 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.986 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.18% β-sheet: 0.00% Coil/Unstructured: 83.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 296 Family Scaffolds |
|---|---|---|
| PF01740 | STAS | 4.73 |
| PF07228 | SpoIIE | 3.04 |
| PF00069 | Pkinase | 2.03 |
| PF13231 | PMT_2 | 2.03 |
| PF13376 | OmdA | 1.35 |
| PF06245 | DUF1015 | 1.01 |
| PF04338 | DUF481 | 1.01 |
| PF08922 | DUF1905 | 1.01 |
| PF14031 | D-ser_dehydrat | 0.68 |
| PF00924 | MS_channel | 0.68 |
| PF11175 | DUF2961 | 0.68 |
| PF07732 | Cu-oxidase_3 | 0.34 |
| PF02769 | AIRS_C | 0.34 |
| PF04545 | Sigma70_r4 | 0.34 |
| PF13442 | Cytochrome_CBB3 | 0.34 |
| PF07883 | Cupin_2 | 0.34 |
| PF12704 | MacB_PCD | 0.34 |
| PF13560 | HTH_31 | 0.34 |
| PF13795 | HupE_UreJ_2 | 0.34 |
| PF00144 | Beta-lactamase | 0.34 |
| PF13604 | AAA_30 | 0.34 |
| PF04655 | APH_6_hur | 0.34 |
| PF04542 | Sigma70_r2 | 0.34 |
| PF13439 | Glyco_transf_4 | 0.34 |
| PF00953 | Glycos_transf_4 | 0.34 |
| PF03551 | PadR | 0.34 |
| PF00756 | Esterase | 0.34 |
| PF03320 | FBPase_glpX | 0.34 |
| COG ID | Name | Functional Category | % Frequency in 296 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 8.11 |
| COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 1.01 |
| COG3137 | Putative salt-induced outer membrane protein YdiY | Cell wall/membrane/envelope biogenesis [M] | 1.01 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.34 |
| COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 0.34 |
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.34 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.34 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.34 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.34 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.34 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.34 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.34 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.34 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.34 |
| COG1494 | Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein | Carbohydrate transport and metabolism [G] | 0.34 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.34 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.34 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.32 % |
| Unclassified | root | N/A | 0.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02HW7F1 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300001356|JGI12269J14319_10229719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101526505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300004092|Ga0062389_104424321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300004103|Ga0058903_1329758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300004120|Ga0058901_1509449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300004139|Ga0058897_11169010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300004156|Ga0062589_100806990 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300004267|Ga0066396_10059936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300004473|Ga0068919_1246085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300005167|Ga0066672_10120551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1621 | Open in IMG/M |
| 3300005175|Ga0066673_10232879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300005186|Ga0066676_11018541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300005435|Ga0070714_101689788 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005436|Ga0070713_101462605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300005445|Ga0070708_100607687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1031 | Open in IMG/M |
| 3300005446|Ga0066686_10000605 | All Organisms → cellular organisms → Bacteria | 12959 | Open in IMG/M |
| 3300005450|Ga0066682_10822716 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005454|Ga0066687_10316987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300005467|Ga0070706_100144386 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
| 3300005468|Ga0070707_100193842 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300005468|Ga0070707_100698562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300005540|Ga0066697_10665815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300005545|Ga0070695_101526052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300005555|Ga0066692_11039278 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005556|Ga0066707_10178623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1360 | Open in IMG/M |
| 3300005560|Ga0066670_10018283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3203 | Open in IMG/M |
| 3300005561|Ga0066699_10433748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300005576|Ga0066708_10065942 | All Organisms → cellular organisms → Bacteria | 2069 | Open in IMG/M |
| 3300005591|Ga0070761_10909915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300005764|Ga0066903_108023012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300005843|Ga0068860_101169924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 789 | Open in IMG/M |
| 3300005921|Ga0070766_10370951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300006028|Ga0070717_10438669 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300006034|Ga0066656_10237332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1169 | Open in IMG/M |
| 3300006050|Ga0075028_100715448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300006163|Ga0070715_10872111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300006173|Ga0070716_101033447 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006173|Ga0070716_101505721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300006176|Ga0070765_100257388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1602 | Open in IMG/M |
| 3300006791|Ga0066653_10386668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300006796|Ga0066665_11218817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300006797|Ga0066659_11154669 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006854|Ga0075425_102948109 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006861|Ga0063777_1387050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300006893|Ga0073928_11154198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300007788|Ga0099795_10561929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300009012|Ga0066710_100954460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1322 | Open in IMG/M |
| 3300009038|Ga0099829_10816758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300009088|Ga0099830_11283156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300009089|Ga0099828_10402244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
| 3300009089|Ga0099828_11510878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300009101|Ga0105247_10610821 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300009137|Ga0066709_101108872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1163 | Open in IMG/M |
| 3300009143|Ga0099792_10825410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300009665|Ga0116135_1434697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300010043|Ga0126380_11460785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300010048|Ga0126373_11207833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 822 | Open in IMG/M |
| 3300010048|Ga0126373_12987632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 527 | Open in IMG/M |
| 3300010117|Ga0127449_1053631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300010154|Ga0127503_10251754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300010304|Ga0134088_10057375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1795 | Open in IMG/M |
| 3300010323|Ga0134086_10145421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
| 3300010325|Ga0134064_10109973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300010335|Ga0134063_10119480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300010335|Ga0134063_10151513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1075 | Open in IMG/M |
| 3300010343|Ga0074044_10357360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300010358|Ga0126370_11183370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 710 | Open in IMG/M |
| 3300010358|Ga0126370_12348922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 528 | Open in IMG/M |
| 3300010359|Ga0126376_11452296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300010360|Ga0126372_10686812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
| 3300010361|Ga0126378_10694854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1129 | Open in IMG/M |
| 3300010361|Ga0126378_11186854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300010361|Ga0126378_11371174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300010855|Ga0126355_1129585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
| 3300010859|Ga0126352_1136322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300010860|Ga0126351_1219043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300011082|Ga0138526_1072536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300011120|Ga0150983_10747506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300011120|Ga0150983_11608532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1225 | Open in IMG/M |
| 3300011120|Ga0150983_13341144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
| 3300011120|Ga0150983_13693487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300011269|Ga0137392_10192137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1666 | Open in IMG/M |
| 3300011269|Ga0137392_10529520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300011270|Ga0137391_10096628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2557 | Open in IMG/M |
| 3300011270|Ga0137391_10557102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300011270|Ga0137391_11229515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300011271|Ga0137393_11100979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300012096|Ga0137389_10835916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300012189|Ga0137388_10333211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1396 | Open in IMG/M |
| 3300012198|Ga0137364_11442126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300012199|Ga0137383_10239281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300012201|Ga0137365_10112015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2053 | Open in IMG/M |
| 3300012202|Ga0137363_10331443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1256 | Open in IMG/M |
| 3300012202|Ga0137363_10920319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300012203|Ga0137399_10464415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
| 3300012203|Ga0137399_10933062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300012203|Ga0137399_11431679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300012205|Ga0137362_11422195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300012208|Ga0137376_11199320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300012211|Ga0137377_10766078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300012359|Ga0137385_11676045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300012361|Ga0137360_10246114 | Not Available | 1466 | Open in IMG/M |
| 3300012361|Ga0137360_10295012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1345 | Open in IMG/M |
| 3300012361|Ga0137360_10675697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300012361|Ga0137360_10976460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300012361|Ga0137360_11654609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300012362|Ga0137361_10558853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300012363|Ga0137390_10275859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1665 | Open in IMG/M |
| 3300012363|Ga0137390_10543731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300012363|Ga0137390_10863702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300012363|Ga0137390_11383320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300012363|Ga0137390_11980363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300012582|Ga0137358_10690165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300012918|Ga0137396_10821718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300012923|Ga0137359_10490805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300012924|Ga0137413_10780290 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300012929|Ga0137404_10221763 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300012930|Ga0137407_11543042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300012930|Ga0137407_11658928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300012944|Ga0137410_11599062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300012948|Ga0126375_11664059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300012972|Ga0134077_10166572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300012975|Ga0134110_10013199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3153 | Open in IMG/M |
| 3300013306|Ga0163162_13041504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300014151|Ga0181539_1214280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300015052|Ga0137411_1219820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4987 | Open in IMG/M |
| 3300015053|Ga0137405_1198418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300015264|Ga0137403_10467642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1135 | Open in IMG/M |
| 3300015371|Ga0132258_10350787 | All Organisms → cellular organisms → Bacteria | 3648 | Open in IMG/M |
| 3300015372|Ga0132256_100521850 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300016294|Ga0182041_10859020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300016387|Ga0182040_11003630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300016404|Ga0182037_10312166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1268 | Open in IMG/M |
| 3300016445|Ga0182038_11643689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300016730|Ga0181515_1528672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1449 | Open in IMG/M |
| 3300017823|Ga0187818_10024556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2580 | Open in IMG/M |
| 3300017943|Ga0187819_10377314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300017961|Ga0187778_10180327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1341 | Open in IMG/M |
| 3300018018|Ga0187886_1369043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300018019|Ga0187874_10000783 | All Organisms → cellular organisms → Bacteria | 35208 | Open in IMG/M |
| 3300018085|Ga0187772_10107772 | Not Available | 1802 | Open in IMG/M |
| 3300018090|Ga0187770_11730431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300018433|Ga0066667_10819650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300018433|Ga0066667_11422838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300019789|Ga0137408_1182687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300019877|Ga0193722_1147034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300020170|Ga0179594_10291943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300020170|Ga0179594_10345750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300020199|Ga0179592_10277002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300020199|Ga0179592_10512411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300020579|Ga0210407_10519486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300020579|Ga0210407_10596575 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300020579|Ga0210407_11130000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300020579|Ga0210407_11467485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300020583|Ga0210401_10859618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300020583|Ga0210401_11008557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300020583|Ga0210401_11619878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300021086|Ga0179596_10332357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300021088|Ga0210404_10043887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2072 | Open in IMG/M |
| 3300021088|Ga0210404_10288666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300021088|Ga0210404_10354822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300021168|Ga0210406_10716392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300021168|Ga0210406_10719720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300021170|Ga0210400_10084300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2500 | Open in IMG/M |
| 3300021170|Ga0210400_10427676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300021171|Ga0210405_10615927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300021178|Ga0210408_11231331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300021180|Ga0210396_10739721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300021181|Ga0210388_10311815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1383 | Open in IMG/M |
| 3300021401|Ga0210393_11284374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300021404|Ga0210389_11125846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300021405|Ga0210387_10463680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300021420|Ga0210394_11420264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300021432|Ga0210384_10011647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8871 | Open in IMG/M |
| 3300021432|Ga0210384_10130109 | All Organisms → cellular organisms → Bacteria | 2259 | Open in IMG/M |
| 3300021433|Ga0210391_10347080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1164 | Open in IMG/M |
| 3300021433|Ga0210391_10451058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
| 3300021475|Ga0210392_11309416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300021478|Ga0210402_10141131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2190 | Open in IMG/M |
| 3300021478|Ga0210402_11580403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300021478|Ga0210402_11878771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300021478|Ga0210402_12036565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300021479|Ga0210410_10244691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1608 | Open in IMG/M |
| 3300021479|Ga0210410_10371861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1281 | Open in IMG/M |
| 3300021479|Ga0210410_11126029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300021559|Ga0210409_10105572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2596 | Open in IMG/M |
| 3300021559|Ga0210409_10928599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300021560|Ga0126371_13814611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300022532|Ga0242655_10270053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300022533|Ga0242662_10063281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300023259|Ga0224551_1024949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
| 3300023672|Ga0247553_110921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300024182|Ga0247669_1009807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1770 | Open in IMG/M |
| 3300024249|Ga0247676_1002813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2566 | Open in IMG/M |
| 3300025899|Ga0207642_10374138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300025906|Ga0207699_10338055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
| 3300025906|Ga0207699_11027076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300025906|Ga0207699_11124704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300025910|Ga0207684_10029470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4674 | Open in IMG/M |
| 3300025928|Ga0207700_10993879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300025939|Ga0207665_10714966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300025942|Ga0207689_11264604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300026325|Ga0209152_10480511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300026333|Ga0209158_1030189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2352 | Open in IMG/M |
| 3300026335|Ga0209804_1148682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1048 | Open in IMG/M |
| 3300026342|Ga0209057_1177376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 617 | Open in IMG/M |
| 3300026490|Ga0257153_1001097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4926 | Open in IMG/M |
| 3300026515|Ga0257158_1051291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300026537|Ga0209157_1006264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8570 | Open in IMG/M |
| 3300026548|Ga0209161_10172810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
| 3300026550|Ga0209474_10027176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4337 | Open in IMG/M |
| 3300026551|Ga0209648_10111328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2225 | Open in IMG/M |
| 3300026551|Ga0209648_10753253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300026555|Ga0179593_1247692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2456 | Open in IMG/M |
| 3300026557|Ga0179587_10328317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300026557|Ga0179587_10929655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300026760|Ga0207630_107955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300026854|Ga0207727_125290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300027583|Ga0209527_1022195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1405 | Open in IMG/M |
| 3300027655|Ga0209388_1128827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300027674|Ga0209118_1075581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300027678|Ga0209011_1117222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300027703|Ga0207862_1243310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300027812|Ga0209656_10504301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300027862|Ga0209701_10166982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1333 | Open in IMG/M |
| 3300027862|Ga0209701_10300575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 922 | Open in IMG/M |
| 3300027867|Ga0209167_10263172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300027875|Ga0209283_10233419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
| 3300027903|Ga0209488_10028396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4074 | Open in IMG/M |
| 3300027905|Ga0209415_10578496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300028047|Ga0209526_10993863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300028381|Ga0268264_10360208 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300028536|Ga0137415_10385992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1204 | Open in IMG/M |
| 3300028906|Ga0308309_10783607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300029943|Ga0311340_10152620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2415 | Open in IMG/M |
| 3300030730|Ga0307482_1055964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300030974|Ga0075371_11662334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300030991|Ga0073994_12238906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300031049|Ga0074036_11215233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300031057|Ga0170834_111184068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300031057|Ga0170834_113669123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300031122|Ga0170822_16067607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300031128|Ga0170823_16778864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300031231|Ga0170824_107599453 | All Organisms → cellular organisms → Bacteria | 2882 | Open in IMG/M |
| 3300031231|Ga0170824_114455910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300031231|Ga0170824_115021237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1182 | Open in IMG/M |
| 3300031238|Ga0265332_10401276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300031474|Ga0170818_103842508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300031474|Ga0170818_115469270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2540 | Open in IMG/M |
| 3300031590|Ga0307483_1006802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300031668|Ga0318542_10168729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1094 | Open in IMG/M |
| 3300031680|Ga0318574_10804748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300031682|Ga0318560_10152748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1222 | Open in IMG/M |
| 3300031682|Ga0318560_10453718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300031720|Ga0307469_10131268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1835 | Open in IMG/M |
| 3300031720|Ga0307469_10567420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300031720|Ga0307469_12321275 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300031740|Ga0307468_100124702 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300031744|Ga0306918_10045719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2877 | Open in IMG/M |
| 3300031744|Ga0306918_10977524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300031753|Ga0307477_10012363 | All Organisms → cellular organisms → Bacteria | 5843 | Open in IMG/M |
| 3300031753|Ga0307477_11077371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300031753|Ga0307477_11169258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031754|Ga0307475_10156470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1811 | Open in IMG/M |
| 3300031754|Ga0307475_11005284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300031781|Ga0318547_10351458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300031820|Ga0307473_10189366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
| 3300031820|Ga0307473_11441044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300031823|Ga0307478_10144320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1884 | Open in IMG/M |
| 3300031823|Ga0307478_10550074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
| 3300031837|Ga0302315_10408667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300031879|Ga0306919_10020357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3996 | Open in IMG/M |
| 3300031879|Ga0306919_10691334 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300031912|Ga0306921_11215988 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300031941|Ga0310912_10977218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300031946|Ga0310910_11214812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300031947|Ga0310909_11689486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031962|Ga0307479_11164526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300031962|Ga0307479_12038341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300031981|Ga0318531_10084281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
| 3300032001|Ga0306922_10688490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300032010|Ga0318569_10483734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300032055|Ga0318575_10385559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300032119|Ga0316051_1023677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300032174|Ga0307470_10547507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300032180|Ga0307471_101001689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
| 3300032180|Ga0307471_101599515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300032180|Ga0307471_101769183 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300032205|Ga0307472_102223932 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300032205|Ga0307472_102441230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300032515|Ga0348332_10799085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300032515|Ga0348332_14568505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300032756|Ga0315742_10343697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300032828|Ga0335080_10021732 | All Organisms → cellular organisms → Bacteria | 6937 | Open in IMG/M |
| 3300033547|Ga0316212_1003495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2271 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.03% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.35% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.01% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.01% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.01% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.68% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.34% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.34% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.34% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.34% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.34% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.34% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.34% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.34% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.34% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.34% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.34% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.34% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.34% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.34% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.34% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004473 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006861 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010855 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026760 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-B (SPAdes) | Environmental | Open in IMG/M |
| 3300026854 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030974 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031049 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_03453900 | 2170459013 | Grass Soil | KAMLAKEFSIGHVTVQLERAGLPAQSGYVMPEPARK |
| JGI12269J14319_102297191 | 3300001356 | Peatlands Soil | SAIQKKVVEEFGIEHTTVQLERAGLPAVSGYVMPQPLRRG* |
| JGIcombinedJ26739_1015265052 | 3300002245 | Forest Soil | HMDECERILASIQEKAAQNFRIDHTTVQLERAGLPATSGYVMPEPVKK* |
| Ga0062389_1044243211 | 3300004092 | Bog Forest Soil | ILCAIQKKVADEFSIQHVTVQLERAGLPATSGYVMPEPVRKS* |
| Ga0058903_13297582 | 3300004103 | Forest Soil | ERILISIQEKAAKSFRINHTTVQLERAGLPATSGYVMPEPAKK* |
| Ga0058901_15094492 | 3300004120 | Forest Soil | LDQCEQLLRAIQEKAAKEFKIDHTTVQLERAGLPAVSGYVMPEPVKK* |
| Ga0058897_111690102 | 3300004139 | Forest Soil | PDMHLDQCERLLRAIQEIAAKEFKIDHTTVQLERAGLPAVSGYVMPEPVKR* |
| Ga0062589_1008069902 | 3300004156 | Soil | GGEIALSCHARVPDMHLDRCETILSGIKELLKSDFSINHVTVQLERAGLPAQSGYVMPEPAKQ* |
| Ga0066396_100599361 | 3300004267 | Tropical Forest Soil | AGIKELVRKEFSIGHVTVQLERAGLPAQSGYVMPEPVKR* |
| Ga0068919_12460852 | 3300004473 | Peatlands Soil | PDMHLDECERLLASIKEVASKEFGVEHTTVQLERAGLPATSGYVMPEPARQ* |
| Ga0066672_101205512 | 3300005167 | Soil | PDMHLDECELLLASIKQLASKEFGVEHTTVQLERAGLPAKSGYVMPEPAKS* |
| Ga0066673_102328791 | 3300005175 | Soil | ECERLLASIKQVASKEFAVEHTTVQLERAGLPAHSGYVMPEPAKN* |
| Ga0066676_110185412 | 3300005186 | Soil | RILGMIQDKAAKSFQIEHTTVQLERAGLPATSGYVMPEPIKK* |
| Ga0070714_1016897881 | 3300005435 | Agricultural Soil | DMHMDECEKLIQAIQRKVAAEFGIEHATVQLERAGLPATSGYVMPEPAPKP* |
| Ga0070713_1014626051 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ERILTSIQEKAARNFRIEHTTVQLERAGLPATSGYVMPEPAKK* |
| Ga0070708_1006076871 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GGGEIAMSCHARVPDMHLDRCESLLSAIKQLLAQEFSIGHVTVQLERAGLPAQSGYVMPEPARK* |
| Ga0066686_100006051 | 3300005446 | Soil | VPDMHLDECERLLASIKQLASKEFGVEHTTVQLERAGLPAQSGYVMPEPAKN* |
| Ga0066682_108227162 | 3300005450 | Soil | RVPDMHLDKCESVLSGIKELLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKH* |
| Ga0066687_103169872 | 3300005454 | Soil | LEAIRQIAAKQFQIEHTTVQLERAGLPAKSGYVMPEPAKK* |
| Ga0070706_1001443861 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PDMHLDKCESVLSGIKELLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKH* |
| Ga0070707_1001938424 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLDKCESLLSGIKAMLAKEFSIGHVTVQLERAGLPAQSGYVMPEPARK* |
| Ga0070707_1006985621 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AGVKELLKAEFSIGHVTVQLERAGLPAQSGYVMPQPAKR* |
| Ga0066697_106658151 | 3300005540 | Soil | VRRKFGIDHITVQFERAGLPARSGYVMPEPAPRSD* |
| Ga0070695_1015260522 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MDECERILLSIQERAAKDFGIGHTTVQLERAGLPATSGYVMPEPAKK* |
| Ga0066692_110392782 | 3300005555 | Soil | ECERILISIQEKAAKSFRINHTTVQLERAGLPATSGYVMPEPAKK* |
| Ga0066707_101786232 | 3300005556 | Soil | DECEHLLASIKRKASQDFGIEHTTVQLERAGLPAVSGYVMPEPAKK* |
| Ga0066670_100182834 | 3300005560 | Soil | AIRQIAAKQFQIEHTTVQLERAGLPAKSGYVMPEPAKK* |
| Ga0066699_104337482 | 3300005561 | Soil | LASIKQVASKEFAVEHTTVQLERAGLPAHSGYVMPEPAKN* |
| Ga0066708_100659426 | 3300005576 | Soil | MHLDQCESILSGIKQRLAQEFSIGHVTVQLERAGLPAQSGYVMPEPARK* |
| Ga0070761_109099152 | 3300005591 | Soil | CERLLRAIQEKAAQEFKIDHTTVQLERAGLPAHSGYVMPEPIKK* |
| Ga0066903_1080230121 | 3300005764 | Tropical Forest Soil | IQKKVAADFGIEHVTVQIERAGLPATSGYVMPVPMRKS* |
| Ga0068860_1011699242 | 3300005843 | Switchgrass Rhizosphere | RCETILSGIKELLRSDFSINHVTVQLERAGLPAQSGYVMPEPAKQ* |
| Ga0070766_103709512 | 3300005921 | Soil | LLRAIQEKAAKEFKIDHTTVQLERAGLPAVSGYVMPEPVKK* |
| Ga0070717_104386692 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RVPDMHLDRCESLLSAIKQLLAQEFSIGHVTVQLERAGLPAQSGYVMPEPARK* |
| Ga0066656_102373322 | 3300006034 | Soil | DECERLLSSIKQVAAKEFGVDHTTVQLERAGLPAQSGYVMPEPAKN* |
| Ga0075028_1007154482 | 3300006050 | Watersheds | EGILISIQERVAKEFGIDHTTVQLERAGLPATSGYVMPEPAKK* |
| Ga0070715_108721111 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | HAMSLHARVPDMHLDECEKILLSIQERAAKDFGIGHTTVQLERAGLPATSGYVMPEPAKK |
| Ga0070716_1010334471 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EIAMSCHARVPDMHLDKCESVLSGIKELLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKH* |
| Ga0070716_1015057211 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QEKAAKEFSIDHTTVQLERAGLPARSGYVMPEPAKK* |
| Ga0070765_1002573881 | 3300006176 | Soil | DAIRSKCAAEFNIGHATIQLERAGLPATSGYVMPAPAK* |
| Ga0066653_103866682 | 3300006791 | Soil | LASIKQLASKEFGVEHTTVQLERAGLPVQSGYVMPEPAKN* |
| Ga0066665_112188172 | 3300006796 | Soil | RLLASIQRVAAKEFGVEHTTVQLERAGLPATSGYVMPEPVKK* |
| Ga0066659_111546691 | 3300006797 | Soil | GEIAMSCHARVPDMHLDKCESVLVSIKQMLAQEFSIGHVTVQLERAGLPAQSGYVMPEAAKR* |
| Ga0075425_1029481091 | 3300006854 | Populus Rhizosphere | MSCHARVPDMHLDKCESVLSEIKNLLAEKFSIGHVTVQLERAGLPAHSGYVMPEPVKRGQ |
| Ga0063777_13870501 | 3300006861 | Peatlands Soil | GGNNALSLHARVPDMHLDECERLLASIKEVASKEFGVEHTTVQLERAGLPATSGYVMPEPARQ* |
| Ga0073928_111541982 | 3300006893 | Iron-Sulfur Acid Spring | ERILSDIQEKVADKFGIGHTTVQLERAGLPPQSGSVIPEPFRKIESV* |
| Ga0099795_105619292 | 3300007788 | Vadose Zone Soil | SIKELLAQDFSIGHVTVQLERAGLPAQSGYVMPEPARK* |
| Ga0066710_1009544601 | 3300009012 | Grasslands Soil | KELLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKH |
| Ga0099829_108167582 | 3300009038 | Vadose Zone Soil | ERLLASIKQVASKEFGVEHTTVQLERAGLPAKSGYVMPEPAKK* |
| Ga0099830_112831562 | 3300009088 | Vadose Zone Soil | HMDKCEHLLEAIRQVAEKEFRIEHTTVQLERAGLPAQSGYVMPAPAKK* |
| Ga0099828_104022442 | 3300009089 | Vadose Zone Soil | DECERLLASIQRVAAKEFGVEHTTVQLERAGLPASSGYVMPEPAKN* |
| Ga0099828_115108782 | 3300009089 | Vadose Zone Soil | DMHLDECERLLASIQRVAAKEFGVEHTTVQLERAGLPAQSGYVMPEPAKK* |
| Ga0105247_106108212 | 3300009101 | Switchgrass Rhizosphere | SIKDLLKNEFSIGHVTIQLERAGLPAHSGYVMPEPAKR* |
| Ga0066709_1011088722 | 3300009137 | Grasslands Soil | LDECERLLEAIRQIAAEQFQIEHTTVQLERAGLPAKSGYVMPEPAKK* |
| Ga0099792_108254101 | 3300009143 | Vadose Zone Soil | MDECERILLCIQEKAAKDFQIDHTTVQLERAGLPARSGYVMPEPAKSG* |
| Ga0116135_14346972 | 3300009665 | Peatland | AASEFGIKHTTVQFERAGLPAISGYVMPEPAKPQV* |
| Ga0126380_114607851 | 3300010043 | Tropical Forest Soil | KKVAADFGIEHVTVQIERAGLPATSGYVMPVPMRKS* |
| Ga0126373_112078332 | 3300010048 | Tropical Forest Soil | CERLLAGIKELASKRFHIEHTTVQLERAGLPAQSGYVMPEPAKK* |
| Ga0126373_129876321 | 3300010048 | Tropical Forest Soil | QVAAKQFHIEHTTVQLERAGLPAKSGYVMPEPAKKENC* |
| Ga0127449_10536312 | 3300010117 | Grasslands Soil | SIKQVASKEFAVEHTTVQLERAGLPAHSGYVMPEPTKN* |
| Ga0127503_102517542 | 3300010154 | Soil | LGGGHNALSLHARVPDMHLDECERLLDSIKQVAAKEFSIEHTTVQLERAGLPAQSGYVMPEPVKK* |
| Ga0134088_100573751 | 3300010304 | Grasslands Soil | LDECERLLSSIKQVAAKEFGVDHTTVQLERAGLPAQSGYVMPEPAKN* |
| Ga0134086_101454212 | 3300010323 | Grasslands Soil | MHLDECERLLVAIQQLAAKQFGIGHTTVQLERAGLPAKSGYVMPEPAKK* |
| Ga0134064_101099731 | 3300010325 | Grasslands Soil | ERLLASIQRVAAKEFGVEHTTVQLERAGLPATSGYVMPEPVKK* |
| Ga0134063_101194802 | 3300010335 | Grasslands Soil | MHLDECERLLASIKQLASKEFGVEHTTVQLERAGLPAQSGYVMPEPAKN* |
| Ga0134063_101515132 | 3300010335 | Grasslands Soil | LLEAIRQIAAEQFQIEHTTVQLERAGLPAKSGYVMPEPAKK* |
| Ga0074044_103573601 | 3300010343 | Bog Forest Soil | QEKAAKDFGIEHTTVQLERAGLPAHSGYVMPEPAKN* |
| Ga0126370_111833702 | 3300010358 | Tropical Forest Soil | PDMHLDECERLLAAIKELASKRFHIEHTTVQLERAGLPAQSGYVMPEPAKK* |
| Ga0126370_123489221 | 3300010358 | Tropical Forest Soil | MHLDECERLLAAIKELASKRFHIEHTTVQLERAGLPAQSGYVMPEPAKK* |
| Ga0126376_114522961 | 3300010359 | Tropical Forest Soil | IQRKVAAEFGIEHATVQLERAGLPATSGYVMPEPAPRP* |
| Ga0126372_106868122 | 3300010360 | Tropical Forest Soil | VLASIKQVAARQFQIEHTTVQLARAGLPAQSGYVMPEPAKK* |
| Ga0126378_106948541 | 3300010361 | Tropical Forest Soil | GGGHNALSLHARIPDRHMDECERLMEAIRQVAAEQFHIEHTTVQLERAGLPAKSGYVMPEPAKK* |
| Ga0126378_111868541 | 3300010361 | Tropical Forest Soil | LRAIQKKVAADFGIEHVTVQIERAGLPATSGYVMPVPMRKS* |
| Ga0126378_113711742 | 3300010361 | Tropical Forest Soil | DECERLLDSIKRVAAEQFRIEHTTVQLERAGLPAQSGYVMPEPAKK* |
| Ga0126355_11295852 | 3300010855 | Boreal Forest Soil | LSDIQGKVADKFGIGHTTVQLERAGLPAQSGYVMPEPFKKVESV* |
| Ga0126352_11363221 | 3300010859 | Boreal Forest Soil | DMHMDECERILSAIQQKAAKEFGISHTTVQLERAGLPAQSGYVMPEPAKPISKA* |
| Ga0126351_12190432 | 3300010860 | Boreal Forest Soil | QEKAAKSFQIEHTTVQLERAGLPATSGYVMPEPAKK* |
| Ga0138526_10725361 | 3300011082 | Peatlands Soil | DMHLDECERLLASIKEVASKEFGVEHTTVQLERAGLPATSGYVMPEPARQ* |
| Ga0150983_107475061 | 3300011120 | Forest Soil | PDMHLDQCEALLISIREKARKEFQIEHTTVQLERAGLPAKSGYVMPAPIQK* |
| Ga0150983_116085322 | 3300011120 | Forest Soil | GGDHHALSLHARVPDMHLDECEQLLASIKQKASQDFGIEHTTVQLERAGLPAQSGYVMPEPVKK* |
| Ga0150983_133411441 | 3300011120 | Forest Soil | CEHLLRAIQEKAAKEFKIDHTTVQLERAGLPAVSGYVMPEPVKK* |
| Ga0150983_136934871 | 3300011120 | Forest Soil | QERAAKDFGIGHTTVQLERAGLPATSGYVMPEPAKK* |
| Ga0137392_101921373 | 3300011269 | Vadose Zone Soil | CERLLASIQRVAAKEFGVEHTTVQLERAGLPATSGYVMPEPAKK* |
| Ga0137392_105295201 | 3300011269 | Vadose Zone Soil | MHLDECERLLSSIKQVAAKEFGVDHTTVQLERAGLPAQSGYVMPEPAKN* |
| Ga0137391_100966284 | 3300011270 | Vadose Zone Soil | LLSSIKQVAAKEFGVDHTTVQLERAGLPAQSGYVMPEPVKN* |
| Ga0137391_105571021 | 3300011270 | Vadose Zone Soil | IQRVAAKEFGVEHTTVQLERAGLPASSGYVMPEPAKK* |
| Ga0137391_112295151 | 3300011270 | Vadose Zone Soil | SIQRVAAKEFGVEHTTVQLERAGLPATSGYVMPEPAKK* |
| Ga0137393_111009792 | 3300011271 | Vadose Zone Soil | LDECERLLASIKQVAMKEFSVEHTTVQLERAGLPAQSGYVMPEPVKK* |
| Ga0137389_108359161 | 3300012096 | Vadose Zone Soil | EKAAKSFRIDHTTVQLERAGLPATSGYVMPEPAKK* |
| Ga0137388_103332111 | 3300012189 | Vadose Zone Soil | TLIQDKAAKNFGIDHTTVQLERAGLPAQSGYVMPEPAKP* |
| Ga0137364_114421261 | 3300012198 | Vadose Zone Soil | CERILLSIQERAAKDFGIGHTTVQLERAGLPATSGYVMPEPAKK* |
| Ga0137383_102392812 | 3300012199 | Vadose Zone Soil | ERLLVAIQQLAAKQFGIGHTTVQLERAGLPAKSGYVMPEPAKK* |
| Ga0137365_101120153 | 3300012201 | Vadose Zone Soil | LVAIQQLAAKQFGIGHTTVQLERAGLPAKSGYVMPEPAKK* |
| Ga0137363_103314432 | 3300012202 | Vadose Zone Soil | IKQIAAKEFGVEHTTVQLERAGLPAKSGYVMPEPAKN* |
| Ga0137363_109203193 | 3300012202 | Vadose Zone Soil | HARVPDMHLDKCESLLSGIKVVLAKEFSIGHVTVQLERAGLPAQSGYVMPEPVKR* |
| Ga0137399_104644151 | 3300012203 | Vadose Zone Soil | KKLAEDFQIEHSTVQLERAGLPASSGYVMPEPIRKN* |
| Ga0137399_109330621 | 3300012203 | Vadose Zone Soil | HALSLHARVPDMHLDECERLLASIKQAASKEFGVEHTTVQLERAGLPAKSGYVMPEPAKN |
| Ga0137399_114316791 | 3300012203 | Vadose Zone Soil | IQRVAAKEFGVEHTTVQLERAGLPATSGYVMPEPGKK* |
| Ga0137362_114221952 | 3300012205 | Vadose Zone Soil | EKAAKSFRINHTTVQLERAGLPATSGYVMPEPAKK* |
| Ga0137376_111993202 | 3300012208 | Vadose Zone Soil | HLDKCESVLSGIKELLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKH* |
| Ga0137377_107660782 | 3300012211 | Vadose Zone Soil | ERLLVAIQQLAAKQFGIGHTTVQLERAGLPAKSGYVMPEPVKK* |
| Ga0137385_116760451 | 3300012359 | Vadose Zone Soil | DMHLDKCEGLLSGIKAMLAEEFSIGHVTVQLERAGLPAQSGYVMPEPAKR* |
| Ga0137360_102461141 | 3300012361 | Vadose Zone Soil | QLLAQEFSIGQVTVQLERAGLPAQSGYVMPEPAKR* |
| Ga0137360_102950122 | 3300012361 | Vadose Zone Soil | ERLLSSIKQVAAKEFGVDHTTVQLERAGLPAQSGYVIPEPAKN* |
| Ga0137360_106756972 | 3300012361 | Vadose Zone Soil | ECERLLASIKQAASKEFGVEHTTVQLERAGLPAKSGYVMPESAKN* |
| Ga0137360_109764601 | 3300012361 | Vadose Zone Soil | AMSCHARVPDMHLDKCESVLSGIKELLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKH* |
| Ga0137360_116546092 | 3300012361 | Vadose Zone Soil | HLDKCESLLSGIKAMLAEEFSIGHVTVQLERAGLPAQSGYVMPEPAKR* |
| Ga0137361_105588531 | 3300012362 | Vadose Zone Soil | RILISIQEKASKNFRINHTTVQLERAGLPATSGYVMPEPAKK* |
| Ga0137390_102758591 | 3300012363 | Vadose Zone Soil | QVAAKEFGVDHTTVQLERAGLPAQSGYVMPEPAKN* |
| Ga0137390_105437311 | 3300012363 | Vadose Zone Soil | KQVAAKEFGVDHTTVQLERAGLPAQSGYVMPEPVKN* |
| Ga0137390_108637021 | 3300012363 | Vadose Zone Soil | DACERILTSIQERAAKDFGIDHTTVQLERAGLPAKSGYVMPEPAKK* |
| Ga0137390_113833201 | 3300012363 | Vadose Zone Soil | MHLDKCESLLSGIKAMLAEEFSIGHVTVQLERAGLPAQSGYVMPEPAKR* |
| Ga0137390_119803631 | 3300012363 | Vadose Zone Soil | MLAEEFSIGHVTVQLERAGLPAQSGYVMPEPAKR* |
| Ga0137358_106901651 | 3300012582 | Vadose Zone Soil | KAAKSFRINHTTVQLERAGLPTTSGYVMPEPAKE* |
| Ga0137396_108217182 | 3300012918 | Vadose Zone Soil | KASQDFGIEHTTVQLERAGLPAVSGYVMPEPAKK* |
| Ga0137359_104908052 | 3300012923 | Vadose Zone Soil | ILVSIQEKAAKSFRINHTTVQLERAGLPAISGYVMPEPAKK* |
| Ga0137413_107802902 | 3300012924 | Vadose Zone Soil | CESVLGSICYLMKQEFSIGHVTVQLERAGLPAQSGYVMPEPAKR* |
| Ga0137404_102217631 | 3300012929 | Vadose Zone Soil | KCESVLGSICYLMKQEFSIGHVTVQLERAGLPAQSGYVMPEPAKR* |
| Ga0137407_115430421 | 3300012930 | Vadose Zone Soil | MHLDECEHLLASIKRKASLDFGIEHTTVQLERAGLPAVSGYVMPEPAKK* |
| Ga0137407_116589283 | 3300012930 | Vadose Zone Soil | KKLAEEFQIEHSTVQLERAGLPASSGYVMPEPLRKN* |
| Ga0137410_115990621 | 3300012944 | Vadose Zone Soil | GAIRKKLAEDFQIEHSTVQLERAGLPASSGYVMPEPIRKN* |
| Ga0126375_116640592 | 3300012948 | Tropical Forest Soil | SLGGGHHALSLHARIPNMHLDECERLLDSIKRVAAEQFRIEHTTVQLERAGLPAQSGYVMPEPAKK* |
| Ga0134077_101665721 | 3300012972 | Grasslands Soil | LAAKQFGIGHTTVQLERAGLPAKSGYVMPEPAKK* |
| Ga0134110_100131991 | 3300012975 | Grasslands Soil | MHLDECERLLASIKQVASKEFAVEHTTVQLERAGLPAHSGYVMPEPAKN* |
| Ga0163162_130415041 | 3300013306 | Switchgrass Rhizosphere | GVKVLLKAEFSIGHVTVQLERAGLPAQSGYVMPQPAKR* |
| Ga0181539_12142802 | 3300014151 | Bog | AIQKKVAEEFGIEHTTVQLERAGLPAVSGYVMPQPLRRG* |
| Ga0137411_12198204 | 3300015052 | Vadose Zone Soil | MHLDECEHLLASIKRKASQDFGIEHTTAQLERAGLPATSGYVMPEPAKK* |
| Ga0137405_11984182 | 3300015053 | Vadose Zone Soil | GGGEIAMSCHARVPDMHLDKCESVLSGIKELLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKH* |
| Ga0137403_104676422 | 3300015264 | Vadose Zone Soil | SLHARVPDMHLDECERLLASIKQVAAKEFGVEHTTVQLERAGLPAKSGYVMPEPAKN* |
| Ga0132258_103507873 | 3300015371 | Arabidopsis Rhizosphere | MHMDQCETILSGLKELLKKEFSINHVTVQPERDGLPAQSGYVMPEPAKR* |
| Ga0132256_1005218502 | 3300015372 | Arabidopsis Rhizosphere | MDQCETILSGLKELLKKEFSINHVTVQPERDGLPAQSGYVMPEPAKR* |
| Ga0182041_108590202 | 3300016294 | Soil | AIGQKLAHEFGIEHATVQLERAGLPATSGYVMPEPAPKP |
| Ga0182040_110036302 | 3300016387 | Soil | LRAIQKKVAADFGIEHVTVQIERAGLPATSGYVMPVPMRKS |
| Ga0182037_103121661 | 3300016404 | Soil | QAIQRRVAAEFGIEHATVQLERAGLPATSGYVMPEPAPKP |
| Ga0182038_116436892 | 3300016445 | Soil | TVLRSIKELLAEEFSIGHVTVQLERAGLPAQSGYVMPEPAKR |
| Ga0181515_15286721 | 3300016730 | Peatland | KVADDFGIEHTTVQLERAGLPAVSGYVMPQPLRRG |
| Ga0187818_100245564 | 3300017823 | Freshwater Sediment | RLLAAITQLVSKEFGIDHTTVQLERAGLPATSGYVMPEPARK |
| Ga0187819_103773142 | 3300017943 | Freshwater Sediment | DECERLLAAITQLASKEFGIDHTTVQLERAGLPATSGYVMPEPASK |
| Ga0187778_101803271 | 3300017961 | Tropical Peatland | KLAEEFEIEHSTVQLERAGLPATSGYVMPEPMRKS |
| Ga0187886_13690431 | 3300018018 | Peatland | AIQKKVAEKFGIEHTTVQLERAGLPAVSGYVMPQPLRRG |
| Ga0187874_100007831 | 3300018019 | Peatland | AAIQKKVAEEFGIEHTTVQLERAGLPAVSGYVMPQPLRRG |
| Ga0187772_101077721 | 3300018085 | Tropical Peatland | MDECEKVLCAIREKVAEFGIEHSTVQLERAGLPATSGYVMPEPAPTTSENRK |
| Ga0187770_117304312 | 3300018090 | Tropical Peatland | AELGIEHSTVQLERAGLPATSGYVMPEPMQTSAEK |
| Ga0066667_108196502 | 3300018433 | Grasslands Soil | LLETIRQIAAQQFHIEHTTVQLERAGLPAKSGYVMPEPPKK |
| Ga0066667_114228381 | 3300018433 | Grasslands Soil | IAMSCHARVPDMHLDKCESVLCGIKELLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKH |
| Ga0137408_11826871 | 3300019789 | Vadose Zone Soil | LLASTSIKQVAAKEFGVEHTTVQLERAGLPAKSGYVMPEPAKN |
| Ga0193722_11470341 | 3300019877 | Soil | DMHLDKCESLLSGIKAMLAKEFSIGHVTVQLERAGLPAQSGYVMPEPAKRG |
| Ga0179594_102919431 | 3300020170 | Vadose Zone Soil | LASIKQVAAKEFGVEHTTVQLERAGLPAQSGYVMPEPAKK |
| Ga0179594_103457501 | 3300020170 | Vadose Zone Soil | LLSGIKAMLAKEFSIGHVTVQLERAGLPAQSGYVMPEPAKRG |
| Ga0179592_102770021 | 3300020199 | Vadose Zone Soil | HLDKCESLLSGIKAMLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKR |
| Ga0179592_105124112 | 3300020199 | Vadose Zone Soil | DMHLDECERLLASIKQVASKEFGVEHTTVQLERAGLPAKSGYVMPEPVKK |
| Ga0210407_105194862 | 3300020579 | Soil | PDMHLDQCERLLRAIQEKAAKEFKIDHTTVQLERAGLPAVSGYVMPEPVKK |
| Ga0210407_105965751 | 3300020579 | Soil | MSCHARVPDMHLDKCESLLSAIKQVLAQEFSIGHVTVQLERAGLPAQSGYVMPEPARK |
| Ga0210407_111300002 | 3300020579 | Soil | ISIQEKAAKDFRIDHTTVQLERAGLPATSGYVMPEPAKK |
| Ga0210407_114674851 | 3300020579 | Soil | SIKQKASQDFGIEHTTVQLERAGLPAKSGYVMPEAAKK |
| Ga0210401_108596181 | 3300020583 | Soil | DMHLDQCERLLRAIQEKAAKEFKIDHTTVQLERAGLPAVSGYVMPDPVKK |
| Ga0210401_110085572 | 3300020583 | Soil | RKRVKEFGIEHSTVQLERAGLPATSGYVMPEPIRKN |
| Ga0210401_116198782 | 3300020583 | Soil | LCAIQKKVAEEFSIEHVTVQLERAGLPATSGYVMPEPIRKS |
| Ga0179596_103323571 | 3300021086 | Vadose Zone Soil | LLLASIQHVAAKEFGVEHTTVQLERAGLPATSGYVMPEPVKK |
| Ga0210404_100438871 | 3300021088 | Soil | MDECERILISIQEKASKDFRIDHTTVQLERAGLPATSGYVMPEPAKK |
| Ga0210404_102886662 | 3300021088 | Soil | DMHLDECEHLLASIKQAASQKFGIEHTTVQLERAGLPAKSGYVMPEPAKN |
| Ga0210404_103548221 | 3300021088 | Soil | DECERILTSIQEKAARNFRIEHTTVQLERAGLPATSGYVMPEPAKNS |
| Ga0210406_107163921 | 3300021168 | Soil | NALSLHARVPDMHLDECERLLASIKEVASREFGIEHTTVQLERAGLPAKSGYVMPEAAKK |
| Ga0210406_107197201 | 3300021168 | Soil | LAAIRKKLAEDFQIEHSTVQLERAGLPASSGYVMPEPMRKS |
| Ga0210400_100843001 | 3300021170 | Soil | ERILISIQEKASKDFRIDHTTVQLERAGLPATSGYVMPEPAKK |
| Ga0210400_104276761 | 3300021170 | Soil | LHARIPYMHLDECERLLASIQRVAAKEFGVEHTTVQLERAGLPAKSGYVMPVPAKK |
| Ga0210405_106159271 | 3300021171 | Soil | ALSLHARVPDMHLDECERLLAAIKQVAMKEFGVEHTTVQLERAGLPAKSGYVMPEPAKQ |
| Ga0210408_112313312 | 3300021178 | Soil | LHARVPDMHLDQCEALLISIREKARKEFQIEHTTVQLERAGLPAKSGYVMPAPIQK |
| Ga0210396_107397212 | 3300021180 | Soil | RAIQEKAAKEFEIDHTTVQLERAGLPAVSGYVMPEPVKK |
| Ga0210388_103118151 | 3300021181 | Soil | KVAAEFGIEHATVQLERAGLPATSGYVMPEPAPKP |
| Ga0210393_112843742 | 3300021401 | Soil | MHLDQCERLLRAIQEKASKEFKIDHTTVQLERAGLPARSGYVMPEPVKK |
| Ga0210389_111258461 | 3300021404 | Soil | LAEDFQIEHSTVQLERAGLPASSGYVMPEPVRKSSG |
| Ga0210387_104636802 | 3300021405 | Soil | ARIPDKHLDECERILTAIQEKAAKDFNIGHSTVQLERAGLPAQSGYVMPEPAK |
| Ga0210394_114202642 | 3300021420 | Soil | LLASIQRVAAREFGVEHTTVQLERAGLPATSGYVMPEPVKK |
| Ga0210384_100116471 | 3300021432 | Soil | ALSLHARVPDMHLDQCEALLISIREKARKEFQIEHTTVQLERAGLPAKSGYVMPAPIQK |
| Ga0210384_101301094 | 3300021432 | Soil | IQEKAAKDFGIGHSTVQFERAGLPAHSGYVMPEPAKK |
| Ga0210391_103470801 | 3300021433 | Soil | LDECERILIAIQEKAAKDFNIGHSTVQLERAGLPAQSGYVMPEPAK |
| Ga0210391_104510581 | 3300021433 | Soil | ECERILNAIQAKCAADFNIGHATIQLERAGLPATSGYVMPAPAK |
| Ga0210392_113094161 | 3300021475 | Soil | DMHMDECERILCAIQKKVADEFSIEHVTVQLERAGLPATSGYVMPEPVRKS |
| Ga0210402_101411311 | 3300021478 | Soil | GGGHNALSLHARVPDMHLDECERLLASIKQVAAKEFGVEHTTVQLERAGLPAKSGYVMPEPAKN |
| Ga0210402_115804032 | 3300021478 | Soil | SIKQKASQDFGIEHTTVQLERAGLPAQSGYVMPEPVKK |
| Ga0210402_118787712 | 3300021478 | Soil | LLASIKQAASQKFGIEHTTVQLERAGLPAKSGYVMPEPAKN |
| Ga0210402_120365651 | 3300021478 | Soil | ECEKILSAIQKKIAEQFAIEHVTVQLERAGLPATSGYVMPQPMQKT |
| Ga0210410_102446911 | 3300021479 | Soil | AIKQVASKEFGVDHTTVQLERAGLPAKSGYVMPEPVKK |
| Ga0210410_103718613 | 3300021479 | Soil | RKKLAENFQIEHSTVQLERAGLPASSGYVMPEPIRKN |
| Ga0210410_111260291 | 3300021479 | Soil | ECERILISIQEKASKDFRIDHTTVQLERAGLPATSGYVMPEPAKK |
| Ga0210409_101055725 | 3300021559 | Soil | RKKLAEEFQIEHSTVQLERAGLPASSGYVMPEPLRKNAG |
| Ga0210409_109285991 | 3300021559 | Soil | MHLDECERLLASIQKKAAQDLGIDHTTVQLERAGLPARSGYVMPEPAKK |
| Ga0126371_138146112 | 3300021560 | Tropical Forest Soil | DQCERILVAIREKARQDFRVSHTTVQLERAGLPATSGYVMPTPAAKL |
| Ga0242655_102700531 | 3300022532 | Soil | GDHHALSLHARVPDMHLDECEQLLASIKQKASQDFGIEHTTVQLERAGLPAHSGYVMPEPVKK |
| Ga0242662_100632811 | 3300022533 | Soil | HARVPDMHLDECERLLDSIKQVAAKEFSIEHTTVQLERAGLPAQSGYVMPEPVKK |
| Ga0224551_10249491 | 3300023259 | Soil | IQEKAAKDFNIGHSTVQFERAGLPATSGYVMPEPAK |
| Ga0247553_1109212 | 3300023672 | Soil | AIQEKAAKEFKIDHTTVQLERAGLPAVSGYVMPEPAKK |
| Ga0247669_10098071 | 3300024182 | Soil | ERILTSIQEKAAASFHIEHTTVQLERAGLPATSGYVMPEPARK |
| Ga0247676_10028134 | 3300024249 | Soil | KKLAEDFQIEHSTVQLERAGLPASSGYVMPEPIRKN |
| Ga0207642_103741382 | 3300025899 | Miscanthus Rhizosphere | MHMDQCETILSGLKELLKKEFSTNHVTVQPERAGLPAQSGYVMPKPAKQ |
| Ga0207699_103380551 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ILTSIQEKAAASFHIEHTTVQLERAGLPATSGYVMPEPARK |
| Ga0207699_110270762 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | QEKAAKEFSIDHTTVQLERAGLPARSGYVMPEPVKK |
| Ga0207699_111247042 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | IQTKAAKEFNIGHATIQLERAGLPATSGYVMPAPAK |
| Ga0207684_100294706 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSGIKELLAQEFSIAHVTVQLERAGLPAQSGYVMPEPAKH |
| Ga0207700_109938791 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ERILTSIQEKAARNFRIEHTTVQLERAGLPATSGYVMPEPAKK |
| Ga0207665_107149661 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MHMDKCETILSGIKELLKTEFSIGHVTVQLERAGLPAQSGYVMPEPAKQ |
| Ga0207689_112646041 | 3300025942 | Miscanthus Rhizosphere | ECERILLSIQERAAKDFGIGHTTVQLERAGLPATSGYVMPEPAKK |
| Ga0209152_104805111 | 3300026325 | Soil | PDMHLDECERLLASIKQLASKEFGVEHTTVQLERAGLPAQSGYVMPEPAKN |
| Ga0209158_10301891 | 3300026333 | Soil | LLASIKQVAAKEFGVEHTTVQLERAGLPAKSGYVMPEPAKN |
| Ga0209804_11486822 | 3300026335 | Soil | DMHLDECERLLASIKQVASKEFAVEHTTVQLERAGLPAHSGYVMPEPAKN |
| Ga0209057_11773762 | 3300026342 | Soil | LDECERLLEAIRQIAAKQFQIEHTTVQLERAGLPAKSGYVMPEPAKK |
| Ga0257153_10010971 | 3300026490 | Soil | IRKKLAEEFQIEHSTVQLERAGLPASSGYVMPEPLRKN |
| Ga0257158_10512912 | 3300026515 | Soil | CERLLASIKQVASKEFGVEHTTVQLERAGLPAKSGYVMPEPVKK |
| Ga0209157_10062641 | 3300026537 | Soil | ALSLHAHVPDMHLDECERLLASIKQLASKEFGVEHTTVQLERAGLPAQSGYVMPEPAKN |
| Ga0209161_101728102 | 3300026548 | Soil | VPDMHLDECERLLASIKQLASKEFGVEHTTVQLERAGLPAQSGYVMPEPAKN |
| Ga0209474_100271761 | 3300026550 | Soil | PDMHLDECERLLASIKQVASKEFAVEHTTVQLERAGLPAHSGYVMPEPAKN |
| Ga0209648_101113281 | 3300026551 | Grasslands Soil | PDMHLDECERLLASIKQIAAKEFGVEHTTVQLERAGLPAKSGYVMPEPAKN |
| Ga0209648_107532532 | 3300026551 | Grasslands Soil | PDMHLDECERLLASIQRVAAKEFGVEHTTVQLERAGLPAQSGYVMPEPAKK |
| Ga0179593_12476921 | 3300026555 | Vadose Zone Soil | LASIQRVAAKEFGVEHTTVQLERAGLPATSGYVMPEPVKK |
| Ga0179587_103283172 | 3300026557 | Vadose Zone Soil | HLDQCEMLLRAIQEKAAKEFKIDHTTVQLERAGLPAVSGYVMPEPVKK |
| Ga0179587_109296551 | 3300026557 | Vadose Zone Soil | ESLLSGIKAMLAKEFSIGHVTVQLERAGLPAQSGYVMPEPAKR |
| Ga0207630_1079552 | 3300026760 | Soil | HLDQCERLLAAIQEKAAKEFNIDHTTVQLERAGLPARSGYVMPEPVKK |
| Ga0207727_1252901 | 3300026854 | Tropical Forest Soil | RKVAADFGIEHVTVQIERAGLPATSGYVMPEPMRKS |
| Ga0209527_10221953 | 3300027583 | Forest Soil | VADKFGIGHTTVQLERAGLPAQSGYVMPEPFKKVESV |
| Ga0209388_11288272 | 3300027655 | Vadose Zone Soil | RLLSSIKQVAAKEFGVDHTTVQLERAGLPAQSGYVMPEPAKN |
| Ga0209118_10755812 | 3300027674 | Forest Soil | QRVAAKKFGVEHTTVQLERAGLPATSGYVMPEPVKK |
| Ga0209011_11172221 | 3300027678 | Forest Soil | PDMHLDECEHMLASIKRKASQDFGIEHTTVQLERAGLPAKSGYVMPEPLKK |
| Ga0207862_12433101 | 3300027703 | Tropical Forest Soil | KKLAEEFQIEHSTVQLERAGLPASSGYVMPEPIRKA |
| Ga0209656_105043012 | 3300027812 | Bog Forest Soil | CEKIIQAIQLKLAAEFGIEHATVQLERAGLPATSGYVMPEPARKP |
| Ga0209701_101669821 | 3300027862 | Vadose Zone Soil | KRKASQDFGIEHTTVQLERAGLPAVSGYVMPEPAKK |
| Ga0209701_103005751 | 3300027862 | Vadose Zone Soil | EKAAKEFKIEHTTVQLERAGLPAHSGYVMPEPLKK |
| Ga0209167_102631721 | 3300027867 | Surface Soil | RAIQEKAAKEFKIDHTTVQLERAGLPAVSGYVMPEPVKK |
| Ga0209283_102334191 | 3300027875 | Vadose Zone Soil | ERLLVAIQQLAAKQFGIGHTTVQLERAGLPAKSGYVMPEPAKK |
| Ga0209488_100283962 | 3300027903 | Vadose Zone Soil | MDECERILLCIQEKAAKDFQIDHTTVQLERAGLPARSGYVMPEPAKSG |
| Ga0209415_105784962 | 3300027905 | Peatlands Soil | DECERLLDSIKQVAAKEFGVEHTTVQLERAGLPAQSGYVMPEPAKN |
| Ga0209526_109938632 | 3300028047 | Forest Soil | AAIRKKLAEDFQIEHSTVQLERAGLPASSGYVMPEPIRKN |
| Ga0268264_103602081 | 3300028381 | Switchgrass Rhizosphere | KCETILFGIKELLKTEFSIGHVTVQLERAGLPAHSGYVMPEPAKR |
| Ga0137415_103859921 | 3300028536 | Vadose Zone Soil | PDMHLDECERLLASIQRVAAKEFGVEHTTVQLERAGLPATSGYVMPEPVKK |
| Ga0308309_107836072 | 3300028906 | Soil | CLGGNHNALSLHARVPDMHLDECERLLASIKEVASREFGIEHTTVQLERAGLPAKSGYVMPEAAKK |
| Ga0311340_101526201 | 3300029943 | Palsa | SSEFSIDHTTVQFERAGLPATSGYVMPEPAKPQIEQ |
| Ga0307482_10559641 | 3300030730 | Hardwood Forest Soil | LDECERLLASIKQVAAKEFGVEHTTVQLERAGLPAQSGYVMPEPAK |
| Ga0075371_116623341 | 3300030974 | Soil | HLDECERLLASIKQVAAKEFGVEHTTVQLERAGLPAQSGYVMPEPAKK |
| Ga0073994_122389062 | 3300030991 | Soil | DKFGIGHTTVQLERAGLPAQSGYVMPEPFKKVESV |
| Ga0074036_112152332 | 3300031049 | Soil | LLRAIQEKAAKEFKIDHTTVQLERAGLPAVSGYVMPEPVKK |
| Ga0170834_1111840682 | 3300031057 | Forest Soil | LHARVPDMHLDECERLLAAIKQVAMKEFGVEHTTVQLERAGLPAKSGYVMPEPAKQ |
| Ga0170834_1136691232 | 3300031057 | Forest Soil | SGIKAMLAEEFSIGHVTVQLERAGLPAQSGYVMPEPAKR |
| Ga0170822_160676071 | 3300031122 | Forest Soil | GIKAMLAEEFSIGHVTVQLERAGLPAQSGYVMPEPAKR |
| Ga0170823_167788641 | 3300031128 | Forest Soil | SAIKQLLAQEFSIGHVTVQLERAGLPAQSGYVMPEPARK |
| Ga0170824_1075994531 | 3300031231 | Forest Soil | GEIAMSCHARVPDMHLDRCESLLSAIKQLLAQEFSIGHVTVQLERAGLPAQSGYVMPEPVRK |
| Ga0170824_1144559101 | 3300031231 | Forest Soil | SVLSGIKERLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKR |
| Ga0170824_1150212372 | 3300031231 | Forest Soil | DMHLDECERILSDIQGKVADKFGIGHTTVQLERAGLPAQSGYVMPEPLKKVESV |
| Ga0265332_104012762 | 3300031238 | Rhizosphere | KILSAIQQKVATEFSIEHTTVQLERAGLPQSSGYVMPAPAAKT |
| Ga0170818_1038425082 | 3300031474 | Forest Soil | AVSLHARVPDMHLDECERILTDIQGKVAEQFGIGHTTVQLERAGLPAQSGYVMPEPLKKVETS |
| Ga0170818_1154692703 | 3300031474 | Forest Soil | CEKIIQAIQRKVAAEFGIEHATVQLERAGLPATSGYVMPEPAPKP |
| Ga0307483_10068022 | 3300031590 | Hardwood Forest Soil | RLLASIKKLASKEFGIEHTTVQLERAGLPATSGYVMPEPAEK |
| Ga0318542_101687293 | 3300031668 | Soil | IREKVQEFGIEHSTVQLERAGLPATSGYVMPEPARKE |
| Ga0318574_108047482 | 3300031680 | Soil | EKILKAIQRKVAADFGIEHVTVQIERAGLPATSGYVMPEPMRKT |
| Ga0318560_101527482 | 3300031682 | Soil | IKELVRKEFSIGHVTVQLERAGLPAQSGYVMPEPVKR |
| Ga0318560_104537182 | 3300031682 | Soil | KKVAADFGIEHVTVQIERAGLPATSGYVMPVPMRKS |
| Ga0307469_101312681 | 3300031720 | Hardwood Forest Soil | DMHLDECERLLASIKEVAAKEFSIEHTTVQLERAGLPAQSGYVMPEPVKK |
| Ga0307469_105674201 | 3300031720 | Hardwood Forest Soil | AIRKKLAEDFQIEHSTVQLERAGLPASSGYVMPEPLRKN |
| Ga0307469_123212751 | 3300031720 | Hardwood Forest Soil | RVPDMHLDRCESLLSAIKQLLAQEFSIGHVTVQLERAGLPAQSGYVMPEPARK |
| Ga0307468_1001247021 | 3300031740 | Hardwood Forest Soil | RCEAILSGIKDLLANEFSIGHVTVQLERAGLPAQSGYVMPEPAKQ |
| Ga0306918_100457193 | 3300031744 | Soil | AIQTKVAADFGIEHVTVQIERAGLPATSGYVMPEPMRKT |
| Ga0306918_109775241 | 3300031744 | Soil | CQKVKEFGIEHSTVQLERAGLPATSDYVMPEPVRKA |
| Ga0307477_100123631 | 3300031753 | Hardwood Forest Soil | CERILGSIQEKAAKSFRIEHTTVQLERAGLPATSGYVMPEPAKKEG |
| Ga0307477_110773711 | 3300031753 | Hardwood Forest Soil | ERILISIQEKAAKNFQIEHTTVQLERAGLPATSGYVMPEPAKK |
| Ga0307477_111692581 | 3300031753 | Hardwood Forest Soil | LWSLGGGHHALSLHARVPDMHLDECERLLASIKQVASKEFGVEHTTVQLERAGLPAKSGYVMPEPVKK |
| Ga0307475_101564703 | 3300031754 | Hardwood Forest Soil | LWSLGGGHHALSLHARVPDMHLDECERLLAAIKQVAMKEFGVEHTTVQLERAGLPAKSGYVMPEPAKQ |
| Ga0307475_110052841 | 3300031754 | Hardwood Forest Soil | MHMDKCESVLGSICYLMKENFSIGHVTVQLERAGLPAHSGYVMPEPAK |
| Ga0318547_103514582 | 3300031781 | Soil | DQCEAILAGIKELVRKEFSIGHVTVQLERAGLPAQSGYVMPEPVKR |
| Ga0307473_101893662 | 3300031820 | Hardwood Forest Soil | AMSCHARVPDMHLDKCESVLSGIKELLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKH |
| Ga0307473_114410441 | 3300031820 | Hardwood Forest Soil | LISIQEKAAKHFRIDHTTVQLERAGLPATSGYVMPEPAKK |
| Ga0307478_101443202 | 3300031823 | Hardwood Forest Soil | GEIAMSCHARVPDMHLDKCESVLVAIKQLLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKR |
| Ga0307478_105500741 | 3300031823 | Hardwood Forest Soil | CERLLAAIKQVAMKEFGVEHTTVQLERAGLPAKSGYVMPEPAKQ |
| Ga0302315_104086671 | 3300031837 | Palsa | GGGHNALSLHARVPDMHLDECERVLATIQQKAAKDFGIEHTTVQLERAGLPARSGYVMPEPAKGRSQNC |
| Ga0306919_100203574 | 3300031879 | Soil | HLDECERLLDAIRRVAATQFHIEHTTVQLERAGLPAQSGYVMPEPAKK |
| Ga0306919_106913341 | 3300031879 | Soil | GGEIALSCHARVPDMHLDKCETVLRSIKELLAEEFSIGHVTVQLERAGLPAQSGYVMPEPAKR |
| Ga0306921_112159882 | 3300031912 | Soil | MHLDKCESLLAGIKAMLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKQ |
| Ga0310912_109772182 | 3300031941 | Soil | KKLADEFQIEHSTVQLERAGLPASSGYVMPEPLRKN |
| Ga0310910_112148121 | 3300031946 | Soil | CHARVPDMHLDKCESLLAGIKAMLAQEFSIGHVTVQLERAGLPAQSGYVMPEPAKQ |
| Ga0310909_116894862 | 3300031947 | Soil | DMHLDKCETVLRSIKELLAEEFSIGHVTVQLERAGLPAQSGYVMPEPVKR |
| Ga0307479_111645262 | 3300031962 | Hardwood Forest Soil | GGGHHALSLHARVPDMHLDECERLLASIKQVAAREFGVEHTTVQLERAGLPAKSGYVMPEPAKN |
| Ga0307479_120383412 | 3300031962 | Hardwood Forest Soil | GHHALSLHARVPDMHLDECERLLASIKQVAAKEFGVEHTTVQLERAGLPAKSGYVMPEPAKN |
| Ga0318531_100842813 | 3300031981 | Soil | KVAADFGIEHVTVQIERAGLPATSGYVMPEPMRKT |
| Ga0306922_106884901 | 3300032001 | Soil | RKLADDFQIEHSTVQLERARLPASSGYVMPEPAPKN |
| Ga0318569_104837341 | 3300032010 | Soil | ALSLHARVPDMHLDECERLLDAIRRVAATQFHIEHTTVQLERAGLPAQSGYVMPEPAKK |
| Ga0318575_103855592 | 3300032055 | Soil | CEKILKAIQTKVAADFGIEHVTVQIERAGLPATSGYVMPEPMRKT |
| Ga0316051_10236772 | 3300032119 | Soil | EKAAKEFKIDHTTVQLERAGLPAVSGYVMPEPVKK |
| Ga0307470_105475071 | 3300032174 | Hardwood Forest Soil | AGHHAMSLHARVPDMHLDECEKILLSIQERAAKDFGIGHTTVQLERAGLPATSGYVMPEPAKK |
| Ga0307471_1010016891 | 3300032180 | Hardwood Forest Soil | KRKASQDFGIEHTTVQLERAGLPAKSGYVMPEPLKK |
| Ga0307471_1015995151 | 3300032180 | Hardwood Forest Soil | GHHALSLHARVADMHLDECERLLASIKQIAAKEFGVEHTTVQLERAGLPAQSGYVMPEPVKK |
| Ga0307471_1017691831 | 3300032180 | Hardwood Forest Soil | KELLQSDFSINHVTVQLERAGLPAQSGYVMPAPAKQ |
| Ga0307472_1022239322 | 3300032205 | Hardwood Forest Soil | MHMDQCETILSGLKELLEKEFSINHVTVQPERAGLPAQSGYVMPEPAKQ |
| Ga0307472_1024412302 | 3300032205 | Hardwood Forest Soil | ERILVCIQEKAAKSFRIDHTTVQLERAGLPARSGYVMPEPVKKA |
| Ga0348332_107990852 | 3300032515 | Plant Litter | QEKAAKEFKIDHTTVQLERAGLPAVSGYVMPAPVKK |
| Ga0348332_145685052 | 3300032515 | Plant Litter | DMHLDQCEQLLRAIQEKAAKEFKIDHTTVQLERAGLPAVSGYVMPEPAKK |
| Ga0315742_103436972 | 3300032756 | Forest Soil | LFLIFSVSYLDQCERLLRAIQEKAAKEFKIDHTTVQLERAGLPAVSGYVMPEPVKK |
| Ga0335080_100217324 | 3300032828 | Soil | HMDECERILQGIKQKALQEFKIEHVTIQLERAGLPAQSGYVMPEPAGKREPNC |
| Ga0316212_10034954 | 3300033547 | Roots | DMHLDQCEHLLKAIQEKAAKEFKIDHTTVQLERAGLPAVSGYVMPEPVKK |
| ⦗Top⦘ |