NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F010727

Metagenome / Metatranscriptome Family F010727

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F010727
Family Type Metagenome / Metatranscriptome
Number of Sequences 300
Average Sequence Length 41 residues
Representative Sequence QENVTIQCKGRVVRTDETGEGGEGRGVACVIDSYEFVRNS
Number of Associated Samples 258
Number of Associated Scaffolds 300

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.33 %
% of genes from short scaffolds (< 2000 bps) 91.00 %
Associated GOLD sequencing projects 242
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.000 % of family members)
Environment Ontology (ENVO) Unclassified
(21.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.333 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 35.29%    Coil/Unstructured: 64.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 300 Family Scaffolds
PF00196GerE 46.67
PF00248Aldo_ket_red 2.33
PF00171Aldedh 2.33
PF00072Response_reg 2.00
PF027373HCDH_N 0.67
PF00578AhpC-TSA 0.67
PF01432Peptidase_M3 0.33
PF07883Cupin_2 0.33
PF02687FtsX 0.33
PF12704MacB_PCD 0.33
PF12762DDE_Tnp_IS1595 0.33
PF14312FG-GAP_2 0.33
PF03861ANTAR 0.33
PF01212Beta_elim_lyase 0.33
PF00672HAMP 0.33
PF13517FG-GAP_3 0.33
PF08533Glyco_hydro_42C 0.33
PF01361Tautomerase 0.33
PF00886Ribosomal_S16 0.33
PF04191PEMT 0.33
PF02504FA_synthesis 0.33
PF00903Glyoxalase 0.33
PF13432TPR_16 0.33

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 300 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 2.33
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 2.33
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 2.33
COG1167DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domainTranscription [K] 0.67
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.67
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.67
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 0.67
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.67
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.67
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.67
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.67
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.33
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.33
COG1942Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.33
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.33
COG1874Beta-galactosidase GanACarbohydrate transport and metabolism [G] 0.33
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.33
COG3033TryptophanaseAmino acid transport and metabolism [E] 0.33
COG3707Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domainsTranscription [K] 0.33
COG4992Acetylornithine/succinyldiaminopimelate/putrescine aminotransferaseAmino acid transport and metabolism [E] 0.33
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.33
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.33
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 0.33
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.33
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.33
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.33
COG0416Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis)Lipid transport and metabolism [I] 0.33
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.33
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 0.33
COG0228Ribosomal protein S16Translation, ribosomal structure and biogenesis [J] 0.33
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.33
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.33
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.33
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.33


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10115992All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium655Open in IMG/M
3300001170|JGI12704J13340_1012332All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium687Open in IMG/M
3300001356|JGI12269J14319_10122060All Organisms → cellular organisms → Bacteria1199Open in IMG/M
3300001356|JGI12269J14319_10223892All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium720Open in IMG/M
3300001416|JGI20176J14865_102298All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium672Open in IMG/M
3300001661|JGI12053J15887_10399018All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium661Open in IMG/M
3300001867|JGI12627J18819_10347675All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium599Open in IMG/M
3300002853|draft_1017529All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium640Open in IMG/M
3300003320|rootH2_10232847All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300004081|Ga0063454_100438767All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium891Open in IMG/M
3300004091|Ga0062387_100161652All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1304Open in IMG/M
3300004092|Ga0062389_100175322All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2065Open in IMG/M
3300004104|Ga0058891_1554324All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium866Open in IMG/M
3300004121|Ga0058882_1000724All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter706Open in IMG/M
3300004153|Ga0063455_100948124All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium616Open in IMG/M
3300004472|Ga0068974_1386117All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium850Open in IMG/M
3300004594|Ga0068976_1235969All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium593Open in IMG/M
3300004604|Ga0068943_1286594All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium532Open in IMG/M
3300004605|Ga0068952_1314575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter912Open in IMG/M
3300004643|Ga0062591_101854005All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium617Open in IMG/M
3300004969|Ga0072327_1272699All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium574Open in IMG/M
3300004972|Ga0072325_1321087All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium755Open in IMG/M
3300005166|Ga0066674_10308786All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium743Open in IMG/M
3300005178|Ga0066688_10673719All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter660Open in IMG/M
3300005293|Ga0065715_10097327All Organisms → cellular organisms → Bacteria3723Open in IMG/M
3300005434|Ga0070709_10921327All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium692Open in IMG/M
3300005435|Ga0070714_102151115All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium543Open in IMG/M
3300005468|Ga0070707_100046477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter4155Open in IMG/M
3300005529|Ga0070741_10035360All Organisms → cellular organisms → Bacteria6710Open in IMG/M
3300005538|Ga0070731_10883349All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium593Open in IMG/M
3300005542|Ga0070732_10319781All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium933Open in IMG/M
3300005542|Ga0070732_10523707All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium719Open in IMG/M
3300005546|Ga0070696_101573000All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium564Open in IMG/M
3300005557|Ga0066704_10618657All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium694Open in IMG/M
3300005591|Ga0070761_11088650All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium509Open in IMG/M
3300005764|Ga0066903_107002430All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium585Open in IMG/M
3300005921|Ga0070766_11296805All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter505Open in IMG/M
3300005994|Ga0066789_10071847All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300006028|Ga0070717_11545762All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium602Open in IMG/M
3300006031|Ga0066651_10777936All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium518Open in IMG/M
3300006041|Ga0075023_100307169All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium656Open in IMG/M
3300006041|Ga0075023_100445989All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium571Open in IMG/M
3300006046|Ga0066652_101853578All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium543Open in IMG/M
3300006052|Ga0075029_100893069All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium609Open in IMG/M
3300006052|Ga0075029_101157804All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium539Open in IMG/M
3300006086|Ga0075019_10424359All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium817Open in IMG/M
3300006163|Ga0070715_11036611All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium513Open in IMG/M
3300006172|Ga0075018_10344178All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium746Open in IMG/M
3300006176|Ga0070765_101487287All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium637Open in IMG/M
3300006755|Ga0079222_12217590All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium546Open in IMG/M
3300006797|Ga0066659_10141349All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1699Open in IMG/M
3300006800|Ga0066660_10488829All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1034Open in IMG/M
3300006800|Ga0066660_10986346All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium678Open in IMG/M
3300006804|Ga0079221_10894833All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium651Open in IMG/M
3300006903|Ga0075426_11264942All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium560Open in IMG/M
3300007788|Ga0099795_10627870All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium513Open in IMG/M
3300009038|Ga0099829_10323309All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1267Open in IMG/M
3300009038|Ga0099829_10922540All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium724Open in IMG/M
3300009089|Ga0099828_10441894All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1173Open in IMG/M
3300009090|Ga0099827_10129915All Organisms → cellular organisms → Bacteria2039Open in IMG/M
3300009093|Ga0105240_10253213All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium2035Open in IMG/M
3300009098|Ga0105245_10503768All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1227Open in IMG/M
3300009148|Ga0105243_12808737All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium527Open in IMG/M
3300009521|Ga0116222_1009145All Organisms → cellular organisms → Bacteria4714Open in IMG/M
3300009524|Ga0116225_1355706All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium652Open in IMG/M
3300009621|Ga0116116_1011933All Organisms → cellular organisms → Bacteria3607Open in IMG/M
3300009629|Ga0116119_1115580All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium672Open in IMG/M
3300009632|Ga0116102_1019203All Organisms → cellular organisms → Bacteria2385Open in IMG/M
3300009632|Ga0116102_1090158All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium894Open in IMG/M
3300009634|Ga0116124_1135901All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium689Open in IMG/M
3300009635|Ga0116117_1040186All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300009639|Ga0116122_1153336All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium732Open in IMG/M
3300009672|Ga0116215_1079179All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1477Open in IMG/M
3300009792|Ga0126374_10715772All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium754Open in IMG/M
3300009792|Ga0126374_10732126All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium747Open in IMG/M
3300009824|Ga0116219_10661044All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium573Open in IMG/M
3300009839|Ga0116223_10014644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5735Open in IMG/M
3300009839|Ga0116223_10514416All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium696Open in IMG/M
3300010046|Ga0126384_12275219All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium523Open in IMG/M
3300010047|Ga0126382_11654160All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium596Open in IMG/M
3300010048|Ga0126373_10314253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1567Open in IMG/M
3300010143|Ga0126322_1173898All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium514Open in IMG/M
3300010143|Ga0126322_1202420All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium710Open in IMG/M
3300010304|Ga0134088_10544780All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium574Open in IMG/M
3300010339|Ga0074046_10082336All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2090Open in IMG/M
3300010343|Ga0074044_10086449All Organisms → cellular organisms → Bacteria2116Open in IMG/M
3300010343|Ga0074044_10179303All Organisms → cellular organisms → Bacteria1411Open in IMG/M
3300010366|Ga0126379_10168392All Organisms → cellular organisms → Bacteria2067Open in IMG/M
3300010376|Ga0126381_100606747All Organisms → cellular organisms → Bacteria1557Open in IMG/M
3300010379|Ga0136449_103175228All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium636Open in IMG/M
3300010398|Ga0126383_10268906All Organisms → cellular organisms → Bacteria → Acidobacteria1684Open in IMG/M
3300010398|Ga0126383_11561874All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium749Open in IMG/M
3300010401|Ga0134121_13148378All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium509Open in IMG/M
3300010860|Ga0126351_1044267All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium567Open in IMG/M
3300011060|Ga0138583_1020669All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium529Open in IMG/M
3300011080|Ga0138568_1064980All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium806Open in IMG/M
3300011085|Ga0138581_1180609All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium637Open in IMG/M
3300011120|Ga0150983_11175137All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium500Open in IMG/M
3300011120|Ga0150983_11760213All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300011120|Ga0150983_12456077All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium597Open in IMG/M
3300011120|Ga0150983_14040493All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium882Open in IMG/M
3300011120|Ga0150983_15076723All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium636Open in IMG/M
3300012189|Ga0137388_10254786All Organisms → cellular organisms → Bacteria → Acidobacteria1598Open in IMG/M
3300012203|Ga0137399_10308083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1309Open in IMG/M
3300012206|Ga0137380_11749660All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium505Open in IMG/M
3300012210|Ga0137378_11307943All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium641Open in IMG/M
3300012359|Ga0137385_10847586All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium758Open in IMG/M
3300012361|Ga0137360_10037423All Organisms → cellular organisms → Bacteria3409Open in IMG/M
3300012410|Ga0134060_1300373All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium502Open in IMG/M
3300012924|Ga0137413_10959714All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium668Open in IMG/M
3300012929|Ga0137404_10204080All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1676Open in IMG/M
3300012971|Ga0126369_10006101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8961Open in IMG/M
3300012971|Ga0126369_12550867All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium596Open in IMG/M
3300014153|Ga0181527_1075738All Organisms → cellular organisms → Bacteria → Acidobacteria1671Open in IMG/M
3300014153|Ga0181527_1199047All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium837Open in IMG/M
3300014159|Ga0181530_10538444All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium577Open in IMG/M
3300014160|Ga0181517_10385026All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium722Open in IMG/M
3300014165|Ga0181523_10589195All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium611Open in IMG/M
3300014169|Ga0181531_10179973All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300014201|Ga0181537_10688251All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium695Open in IMG/M
3300014489|Ga0182018_10603092All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium576Open in IMG/M
3300014968|Ga0157379_10539558All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1084Open in IMG/M
3300014969|Ga0157376_12684957All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium538Open in IMG/M
3300015241|Ga0137418_10757993All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium734Open in IMG/M
3300015242|Ga0137412_10211719All Organisms → cellular organisms → Bacteria1545Open in IMG/M
3300015245|Ga0137409_11360738All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium554Open in IMG/M
3300015264|Ga0137403_11022036All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium673Open in IMG/M
3300016705|Ga0181507_1352969All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium582Open in IMG/M
3300017822|Ga0187802_10466363All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium500Open in IMG/M
3300017924|Ga0187820_1302590All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium527Open in IMG/M
3300017925|Ga0187856_1074938All Organisms → cellular organisms → Bacteria → Acidobacteria1400Open in IMG/M
3300017927|Ga0187824_10368294All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium520Open in IMG/M
3300017928|Ga0187806_1365196All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium518Open in IMG/M
3300017930|Ga0187825_10086156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1080Open in IMG/M
3300017933|Ga0187801_10128943All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium975Open in IMG/M
3300017935|Ga0187848_10330080All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium633Open in IMG/M
3300017936|Ga0187821_10307238All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium631Open in IMG/M
3300017938|Ga0187854_10263283All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium745Open in IMG/M
3300017955|Ga0187817_10108315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1752Open in IMG/M
3300017955|Ga0187817_10331147All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium971Open in IMG/M
3300017955|Ga0187817_10393862All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium884Open in IMG/M
3300017961|Ga0187778_10869239All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium618Open in IMG/M
3300017972|Ga0187781_10076325All Organisms → cellular organisms → Bacteria2314Open in IMG/M
3300017972|Ga0187781_10176802All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1503Open in IMG/M
3300017988|Ga0181520_11150068All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium506Open in IMG/M
3300017999|Ga0187767_10376176All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium506Open in IMG/M
3300018016|Ga0187880_1090216All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1530Open in IMG/M
3300018016|Ga0187880_1364539All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium610Open in IMG/M
3300018019|Ga0187874_10120468All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1128Open in IMG/M
3300018034|Ga0187863_10004326All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10163Open in IMG/M
3300018034|Ga0187863_10122563All Organisms → cellular organisms → Bacteria → Acidobacteria1453Open in IMG/M
3300018043|Ga0187887_10932642All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium514Open in IMG/M
3300018044|Ga0187890_10214195All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1089Open in IMG/M
3300018061|Ga0184619_10328056All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium699Open in IMG/M
3300018062|Ga0187784_10988169All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium669Open in IMG/M
3300018085|Ga0187772_10199857All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300018088|Ga0187771_10841737All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium778Open in IMG/M
3300018090|Ga0187770_10014656All Organisms → cellular organisms → Bacteria → Acidobacteria5142Open in IMG/M
3300018090|Ga0187770_11077480All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium648Open in IMG/M
3300018433|Ga0066667_10254543All Organisms → cellular organisms → Bacteria → Acidobacteria1333Open in IMG/M
3300019258|Ga0181504_1368667All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium553Open in IMG/M
3300019270|Ga0181512_1194467All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium506Open in IMG/M
3300019278|Ga0187800_1496748All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium843Open in IMG/M
3300019284|Ga0187797_1405482All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium671Open in IMG/M
3300019786|Ga0182025_1321873All Organisms → cellular organisms → Bacteria2113Open in IMG/M
3300019878|Ga0193715_1050520All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium892Open in IMG/M
3300019879|Ga0193723_1033668All Organisms → cellular organisms → Bacteria → Acidobacteria1539Open in IMG/M
3300019887|Ga0193729_1034353All Organisms → cellular organisms → Bacteria2124Open in IMG/M
3300020006|Ga0193735_1176745All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium529Open in IMG/M
3300021046|Ga0215015_10123364All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium978Open in IMG/M
3300021086|Ga0179596_10621799All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium548Open in IMG/M
3300021178|Ga0210408_11406498All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium525Open in IMG/M
3300021180|Ga0210396_11426633All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium572Open in IMG/M
3300021403|Ga0210397_10898626All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium686Open in IMG/M
3300021403|Ga0210397_11557489All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium513Open in IMG/M
3300021404|Ga0210389_10288362All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300021406|Ga0210386_11342659All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium601Open in IMG/M
3300021407|Ga0210383_11793343All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium500Open in IMG/M
3300021559|Ga0210409_10973427All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium723Open in IMG/M
3300021559|Ga0210409_11274856All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium611Open in IMG/M
3300021559|Ga0210409_11495624All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium551Open in IMG/M
3300021559|Ga0210409_11718759All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium504Open in IMG/M
3300021560|Ga0126371_10011799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7908Open in IMG/M
3300021861|Ga0213853_10124936All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium817Open in IMG/M
3300022510|Ga0242652_1027124All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium643Open in IMG/M
3300022523|Ga0242663_1085388All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium609Open in IMG/M
3300022531|Ga0242660_1182236All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium568Open in IMG/M
3300022531|Ga0242660_1193918All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium555Open in IMG/M
3300022712|Ga0242653_1046852All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium693Open in IMG/M
3300022717|Ga0242661_1157060All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium514Open in IMG/M
3300022718|Ga0242675_1040101All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium749Open in IMG/M
3300022724|Ga0242665_10113018All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium820Open in IMG/M
3300023255|Ga0224547_1009506All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1219Open in IMG/M
3300024227|Ga0228598_1098354All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium590Open in IMG/M
3300025509|Ga0208848_1062753All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium781Open in IMG/M
3300025527|Ga0208714_1103929All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium558Open in IMG/M
3300025905|Ga0207685_10383265All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium717Open in IMG/M
3300025922|Ga0207646_10681725All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium920Open in IMG/M
3300025929|Ga0207664_10272347All Organisms → cellular organisms → Bacteria → Acidobacteria1483Open in IMG/M
3300025935|Ga0207709_11480549All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium563Open in IMG/M
3300025942|Ga0207689_10589877All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium934Open in IMG/M
3300025960|Ga0207651_11763288All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium557Open in IMG/M
3300026035|Ga0207703_11414695All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium669Open in IMG/M
3300026297|Ga0209237_1092471All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1351Open in IMG/M
3300026322|Ga0209687_1259401All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium541Open in IMG/M
3300026334|Ga0209377_1047206All Organisms → cellular organisms → Bacteria1946Open in IMG/M
3300026360|Ga0257173_1030362All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium715Open in IMG/M
3300026498|Ga0257156_1021783All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1275Open in IMG/M
3300026548|Ga0209161_10249121All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium926Open in IMG/M
3300027109|Ga0208603_1053101All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium615Open in IMG/M
3300027313|Ga0207780_1009348All Organisms → cellular organisms → Bacteria2113Open in IMG/M
3300027439|Ga0209332_1038495All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium892Open in IMG/M
3300027480|Ga0208993_1086876All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium572Open in IMG/M
3300027583|Ga0209527_1110674All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300027648|Ga0209420_1179553All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium570Open in IMG/M
3300027674|Ga0209118_1218877All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium509Open in IMG/M
3300027698|Ga0209446_1178824All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium547Open in IMG/M
3300027745|Ga0209908_10146268All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium619Open in IMG/M
3300027767|Ga0209655_10035592All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1669Open in IMG/M
3300027787|Ga0209074_10121572All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium908Open in IMG/M
3300027826|Ga0209060_10410075All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium616Open in IMG/M
3300027842|Ga0209580_10671663All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium512Open in IMG/M
3300027869|Ga0209579_10049711All Organisms → cellular organisms → Bacteria2235Open in IMG/M
3300027884|Ga0209275_10321582All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium862Open in IMG/M
3300027898|Ga0209067_10394196All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium774Open in IMG/M
3300027911|Ga0209698_10027879All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5221Open in IMG/M
3300027911|Ga0209698_10529123All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium911Open in IMG/M
3300027911|Ga0209698_10847869All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium688Open in IMG/M
3300028020|Ga0265351_1001280All Organisms → cellular organisms → Bacteria1648Open in IMG/M
3300028745|Ga0302267_10385650All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium581Open in IMG/M
3300028759|Ga0302224_10074617All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300028759|Ga0302224_10160347All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium883Open in IMG/M
3300028906|Ga0308309_10378869All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1210Open in IMG/M
3300029636|Ga0222749_10388088All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium738Open in IMG/M
3300029916|Ga0302148_1041173All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1335Open in IMG/M
3300029943|Ga0311340_10855802All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium760Open in IMG/M
3300029993|Ga0302304_10023818All Organisms → cellular organisms → Bacteria2589Open in IMG/M
3300029999|Ga0311339_11268404All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium670Open in IMG/M
3300029999|Ga0311339_11945092All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium505Open in IMG/M
3300030007|Ga0311338_11109775All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium758Open in IMG/M
3300030007|Ga0311338_11408305All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium648Open in IMG/M
3300030020|Ga0311344_10694123All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium850Open in IMG/M
3300030056|Ga0302181_10401355All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium591Open in IMG/M
3300030058|Ga0302179_10279712All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium735Open in IMG/M
3300030506|Ga0302194_10310772All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium624Open in IMG/M
3300030524|Ga0311357_10676922All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium940Open in IMG/M
3300030549|Ga0210257_10665297All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium509Open in IMG/M
3300030580|Ga0311355_10320789All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300030583|Ga0210262_1193340All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium567Open in IMG/M
3300030618|Ga0311354_11571772All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium579Open in IMG/M
3300030646|Ga0302316_10226488All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium764Open in IMG/M
3300030741|Ga0265459_12146095All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium675Open in IMG/M
3300030743|Ga0265461_11528638All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium724Open in IMG/M
3300030862|Ga0265753_1077672All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium638Open in IMG/M
3300031057|Ga0170834_111945972All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium693Open in IMG/M
3300031231|Ga0170824_107880611All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium693Open in IMG/M
3300031234|Ga0302325_11985969All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium718Open in IMG/M
3300031234|Ga0302325_12573160All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium605Open in IMG/M
3300031236|Ga0302324_100065549All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6395Open in IMG/M
3300031247|Ga0265340_10378937All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium624Open in IMG/M
3300031469|Ga0170819_17004287All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium772Open in IMG/M
3300031525|Ga0302326_11952887All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium760Open in IMG/M
3300031546|Ga0318538_10331921All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium820Open in IMG/M
3300031573|Ga0310915_10950004All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium601Open in IMG/M
3300031718|Ga0307474_10460096All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium995Open in IMG/M
3300031718|Ga0307474_10587313All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium877Open in IMG/M
3300031719|Ga0306917_10315969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1209Open in IMG/M
3300031720|Ga0307469_10570964All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1005Open in IMG/M
3300031747|Ga0318502_10234848All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1067Open in IMG/M
3300031753|Ga0307477_10680104All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium689Open in IMG/M
3300031781|Ga0318547_10485457All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium762Open in IMG/M
3300031808|Ga0316037_117924All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300031823|Ga0307478_10632697All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium895Open in IMG/M
3300031823|Ga0307478_10758700All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium812Open in IMG/M
3300031823|Ga0307478_10887992All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium746Open in IMG/M
3300031823|Ga0307478_10944829All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium721Open in IMG/M
3300031859|Ga0318527_10085857All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1279Open in IMG/M
3300031894|Ga0318522_10238427All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium689Open in IMG/M
3300031897|Ga0318520_10372633All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium869Open in IMG/M
3300031962|Ga0307479_10479148All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1228Open in IMG/M
3300031996|Ga0308176_11203634All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium803Open in IMG/M
3300032001|Ga0306922_10865479All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium941Open in IMG/M
3300032072|Ga0326631_113439All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium565Open in IMG/M
3300032076|Ga0306924_11685015All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium665Open in IMG/M
3300032120|Ga0316053_115192All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium571Open in IMG/M
3300032180|Ga0307471_102162347All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium700Open in IMG/M
3300032180|Ga0307471_102712063All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium628Open in IMG/M
3300032180|Ga0307471_103629377All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium546Open in IMG/M
3300032205|Ga0307472_101917985All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium591Open in IMG/M
3300032421|Ga0310812_10226248All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium818Open in IMG/M
3300032515|Ga0348332_12859016All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium822Open in IMG/M
3300032783|Ga0335079_11354957All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium708Open in IMG/M
3300032805|Ga0335078_10886717All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1074Open in IMG/M
3300032805|Ga0335078_11796232All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium667Open in IMG/M
3300032892|Ga0335081_12728549All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium503Open in IMG/M
3300032955|Ga0335076_11662931All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium527Open in IMG/M
3300033402|Ga0326728_10164507All Organisms → cellular organisms → Bacteria2354Open in IMG/M
3300033500|Ga0326730_1089937All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium573Open in IMG/M
3300034090|Ga0326723_0288782All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium735Open in IMG/M
3300034199|Ga0370514_115856All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium686Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.33%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.67%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.33%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.33%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.67%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.33%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.67%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.33%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.33%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.00%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.00%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.00%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.67%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.67%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.67%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.33%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.33%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.33%
Hydrocarbon Resource EnvironmentsEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments0.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.33%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.33%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.33%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.33%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.33%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.33%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.33%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.33%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.33%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.33%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.33%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.33%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300001170Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001416Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002853PDIso9.ppmwps2EnvironmentalOpen in IMG/M
3300003320Sugarcane root Sample H2Host-AssociatedOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004121Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004472Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004594Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004604Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 31 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004605Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004969Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004972Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010143Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010860Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011060Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011080Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011085Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019258Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022510Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023255Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14EnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026360Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-BEnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027109Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes)EnvironmentalOpen in IMG/M
3300027313Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes)EnvironmentalOpen in IMG/M
3300027439Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028020Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029916Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030583Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE023SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031808Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE3 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032072Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032120Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033500Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fractionEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1011599213300000597Forest SoilVVIQCRGRVVRTDEPASGSKSPEARGVACVIDSYEFVRNT*
JGI12704J13340_101233223300001170Forest SoilRGRVVRTDEPNAAAGSGDNRGVACVIDSYEFVRNS*
JGI12269J14319_1012206033300001356Peatlands SoilIQCKGRVVRADPTGTSEEGRGVACVIDSYEFVRNS*
JGI12269J14319_1022389213300001356Peatlands SoilQCRGRVVRTDEPAAGSSSTPAEARGVACVIDSYDFVRHS*
JGI20176J14865_10229813300001416Arctic Peat SoilEMTGGQENVTIQCKGRVVRADETGSGGEGRGVACVIDSYEFVRNS*
JGI12053J15887_1039901823300001661Forest SoilGAKEGVVIQCRGRVVRTDEPDGGSPTEARGVACVIDSYDFVRH*
JGI12627J18819_1034767523300001867Forest SoilMTGGQENVTIQCKGRVVRADETGQGGEGRGVACVIDSYEFTRNS*
draft_101752913300002853Hydrocarbon Resource EnvironmentsENVTVQCKVRVVRTDEPATGGSSNPAEARGVACVIDSYDFVRHS*
rootH2_1023284723300003320Sugarcane Root And Bulk SoilMTGAKDNVIIQCRGRVVRADEASGDKDSRGVACVIDSYDFVRHS*
Ga0063454_10043876713300004081SoilMTGAKDNVIIQCRGRVVRTDEPAGSSPTEARGVACVIDSYDFVRHT*
Ga0062387_10016165213300004091Bog Forest SoilAQESVVIQCKGRVVRTDPTGSSTDGKGVACVIDSYEFVRN*
Ga0062389_10017532213300004092Bog Forest SoilEPVLVKCKGRVVRKDEPDGNSASDTRGVACVIDSYDFVRRS*
Ga0058891_155432413300004104Forest SoilGAKENVTVQCKGRVVRTDEPATGGSSPAEARGVACVIDSYDFVRHP*
Ga0058882_100072423300004121Forest SoilQENVVIQCKGRVVRADPTGTSEEGRGVACVIDSYEFVRNS*
Ga0063455_10094812423300004153SoilPEMTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDTYEFVRNS*
Ga0068974_138611713300004472Peatlands SoilAKENVTVQCKGRVVRTDEPATGGSSTPAEARGVACVIDSYDFVRHT*
Ga0068976_123596923300004594Peatlands SoilVIQCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS*
Ga0068943_128659413300004604Peatlands SoilDVVIQCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS*
Ga0068952_131457523300004605Peatlands SoilVTGAKENVTVQCKGRVVRTDEPATGGSSSPAEARGVACVIDSYDFVRHT*
Ga0062591_10185400513300004643SoilGAKENVVIQCRGRVVRTDEPAGSKPAEGRGVACVIDSYEFVRNS*
Ga0072327_127269923300004969Peatlands SoilGKEDVVIQCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS*
Ga0072325_132108713300004972Peatlands SoilEDVVIQCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS*
Ga0066674_1030878623300005166SoilAKENVVVKCQGRVVRTDQPAGAGQDSRGVACVIDSYDFVRR*
Ga0066688_1067371913300005178SoilITLPPDVTGGKEDVIIQCRGRVIRTDEPPASSPAEARGVACVIDTYEFVRNS*
Ga0065715_1009732713300005293Miscanthus RhizosphereENVVIQCRGRVVRTDEPPSGSTPDEGRGVACVIDSYEFVRNS*
Ga0070709_1092132713300005434Corn, Switchgrass And Miscanthus RhizosphereTGAKEGVVIQCRGRVVRTDEPDGGSPTEARGVACVIDSYDFVRH*
Ga0070714_10215111523300005435Agricultural SoilPPEVTGGKENVVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS*
Ga0070707_10004647753300005468Corn, Switchgrass And Miscanthus RhizosphereEMTGGTENVTIQCKGRVVRADETGSGGEGRGVACVIDSYEFVRNS*
Ga0070741_1003536013300005529Surface SoilGGQENVTIQCKGRVVRADETGGGGEGRGVACVIDTYEFVRNS*
Ga0070731_1088334913300005538Surface SoilKGRVVRTDEPASGGSSTSAEARGVACVIDSYDFVRHP*
Ga0070732_1031978113300005542Surface SoilPEVTGAKENVTVQCKGRVVRTDEPATGGSSTPAEARGVACVIDSYDFVRHT*
Ga0070732_1052370723300005542Surface SoilGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS*
Ga0070696_10157300013300005546Corn, Switchgrass And Miscanthus RhizosphereENVVIQCRGRVVRTDEPAGSKPAEGRGVACVIDSYEFVRNS*
Ga0066704_1061865723300005557SoilNVTIQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS*
Ga0070761_1108865023300005591SoilKENVTVQCKGRVVRTDEPATGGSTSPAEARGVACVIDSYDFVRHT*
Ga0066903_10700243013300005764Tropical Forest SoilQCRGRVVRTDEPVTNNPKQARGVACVIDSYDFVRRE*
Ga0070766_1129680523300005921SoilPEMTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS*
Ga0066789_1007184713300005994SoilAKDNVVVRCRGRVVRTDEPGGAPAESRGVACVIDSYDFVRHP*
Ga0070717_1154576223300006028Corn, Switchgrass And Miscanthus RhizosphereEMTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS*
Ga0066651_1077793613300006031SoilVVVKCQGRVVRTDQPAGAGQDSRGVACVIDSYDFVRR*
Ga0075023_10030716923300006041WatershedsPEVTGGKENVVIQCRGRVVRTDESSTDPEGTRGVACVIDSYEFVRNS*
Ga0075023_10044598913300006041WatershedsPEVTGGKENVVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS*
Ga0066652_10185357823300006046SoilVIQCRGRVVRTDEPAAGAAPGDNRGVACVIDSYEFVRNS*
Ga0075029_10089306923300006052WatershedsVIQCRGRVVRTDEPSAGSAPADNRGVACVIDSYEFVRNS*
Ga0075029_10115780413300006052WatershedsVIQCRGRVVRTDEPSAGGASADNRGVACVIDSYEFVRNS*
Ga0075019_1042435923300006086WatershedsIQCRGRVVRTDEPNAGTAQGESRGVACVIDSYEFVRNS*
Ga0070715_1103661123300006163Corn, Switchgrass And Miscanthus RhizosphereTGGQEHVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRKS*
Ga0075018_1034417823300006172WatershedsTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS*
Ga0070765_10148728713300006176SoilMTGAKEGVVIQCRGRVVRTDEPTGGPSEARGVACVIDSYDFVRH*
Ga0079222_1221759013300006755Agricultural SoilTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS*
Ga0066659_1014134913300006797SoilTGGTENVKIQCKGRVVRTDESGKADEGRGVACVIDSYEFIRNS*
Ga0066660_1048882933300006800SoilIIQCRGRVIRTDEPPASTPAEARGVACVIDTYEFVRNS*
Ga0066660_1098634623300006800SoilQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS*
Ga0079221_1089483323300006804Agricultural SoilGAKEGVAIQCRGRVVRTDEPAGSPTEARGVACVIDSYDFVRH*
Ga0075426_1126494213300006903Populus RhizosphereQENVTIQCKGRVVRADETGEGGEGRGVACVIDTYEFVRNS*
Ga0099795_1062787013300007788Vadose Zone SoilEDVVIQCRGRVVRTDEPAGGAASGDNRGVACVIDSYEFVRNS*
Ga0099829_1032330913300009038Vadose Zone SoilQCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS*
Ga0099829_1092254013300009038Vadose Zone SoilCRGRVVRTDDPAAGSSPTEARGVACVIDSYDFVRH*
Ga0099828_1044189413300009089Vadose Zone SoilCRGRVVRTDEPASGGSAEARGVACVIDSYEFVRNS*
Ga0099827_1012991543300009090Vadose Zone SoilIIQCHGRVVRTDDPASGSSPTGARGVACVIDSYDFVRH*
Ga0105240_1025321333300009093Corn RhizosphereGAKEGVVIQCRGRVVRTDEPAGGPTEARGVACVIDSYDFVRH*
Ga0105245_1050376823300009098Miscanthus RhizosphereVVIQCRGRVVRTDEPAGGPTEARGVACVIDSYDFVRH*
Ga0105243_1280873713300009148Miscanthus RhizosphereKDNVIIQCRGRVVRADEASGSSDSRGVACVIDSYDFVRHS*
Ga0116222_100914563300009521Peatlands SoilQENVVIQCKGRVVRTDPTGGSADGKGVACVIDSYEFVRN*
Ga0116225_135570623300009524Peatlands SoilGQENVVIQCKGRVVRSDPTGASEEGKGVACVIDSYEFVRNS*
Ga0116116_101193313300009621PeatlandQENVVIQCKGRVVRTDPTGASADGKGVACVIDSYEFVRNA*
Ga0116119_111558023300009629PeatlandRGRVVRTDEPNGSAESGDSRGVACVIDSYEFVRNG*
Ga0116102_101920343300009632PeatlandQENVVIQCKGRVVRTDPTGASEEGKGVACVIDSYEFVRNS*
Ga0116102_109015823300009632PeatlandCRGRVVRTDEPDASTEPGDSRGVACVIDSYEFVRNS*
Ga0116124_113590123300009634PeatlandIQCRGRVVRTDEPNASDESGDSRGVACVIDSYEFVRNS*
Ga0116117_104018633300009635PeatlandPEMTGGQENVTIQCKGRVVRADETGKDGEGRGVACVIDSYEFVRK*
Ga0116122_115333623300009639PeatlandVIHCRGRVVRTDEPNAGAASGDNRGVACVIDSYEFVRNS*
Ga0116215_107917913300009672Peatlands SoilKGRVVRTDEPATGGSSSPAEARGVACVIDSYDFVRHT*
Ga0126374_1071577213300009792Tropical Forest SoilGGQENVTIQCKGTVVRADETGEGGEGRGVACVIDSYEFVRNS*
Ga0126374_1073212613300009792Tropical Forest SoilAKENVVVQCRGRVVRTDEPSAKAGDSRGVACVIDSYDFVRH*
Ga0116219_1066104413300009824Peatlands SoilQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS*
Ga0116223_1001464413300009839Peatlands SoilNVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS*
Ga0116223_1051441613300009839Peatlands SoilKENVTVQCKGRVVRTDEPATGGSSTPAEARGVACVIDSYDFVRHP*
Ga0126384_1227521913300010046Tropical Forest SoilEVTGGKENVVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS*
Ga0126382_1165416023300010047Tropical Forest SoilGAKDNVIIQCRGRVVRADEASGDKDSRGVACVIDSYDFVRHS*
Ga0126373_1031425333300010048Tropical Forest SoilVVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS*
Ga0126322_117389813300010143SoilIQGRGRVVRTDNPPPGRNGENYRGVACVIDSYEFVRNT*
Ga0126322_120242023300010143SoilCRGRVVRTDEPASGSKSADARGVACVIDSYEFVRNS*
Ga0134088_1054478023300010304Grasslands SoilPDVTGGKEDVIIQCRGRVIRTDEPPASSPAEARGVACVIDTYEFVRNS*
Ga0074046_1008233633300010339Bog Forest SoilAKDNVIVQCRGRVVRTDEPAAGGKTTEARGVACVIDSYDFVRHS*
Ga0074044_1008644913300010343Bog Forest SoilQENVVIQCKGRVVRADPTGTSEEGRGVACVIDSYEFVRNT*
Ga0074044_1017930313300010343Bog Forest SoilMTGGQENVTIQCKGRVVRADATGSGGEGRGVACVIDSYEFVRNS*
Ga0126379_1016839213300010366Tropical Forest SoilKDTATTENVKIQCKGRVVRTDESGKGDEGRGVACVIDSYEFIRNS*
Ga0126381_10060674713300010376Tropical Forest SoilIQCRGRVVRTDESGQTSGSRGVACVIDSYEFVRNS*
Ga0136449_10317522813300010379Peatlands SoilIRCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRQ*
Ga0126383_1026890613300010398Tropical Forest SoilCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS*
Ga0126383_1156187413300010398Tropical Forest SoilKGRVVRTDEPATGGASAEARGVACVIDSYDFIRQP*
Ga0134121_1314837823300010401Terrestrial SoilRGRVVRTDTPPPGHNGDANYRGVACVIDSYEFVRNT*
Ga0126351_104426713300010860Boreal Forest SoilDVTGGQENVVIRCKGRVVRTDPTGASPDGKGVACVIDSYEFVRNT*
Ga0138583_102066923300011060Peatlands SoilVTVQCKGRVVRTDEPATGGSSTPAEARGVACVIDSYDFVRQT*
Ga0138568_106498013300011080Peatlands SoilGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS*
Ga0138581_118060913300011085Peatlands SoilQCKGRVVRSDETGEGGEGRGVACVIDTYEFVRNS*
Ga0150983_1117513723300011120Forest SoilDMTGGTENVKIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS*
Ga0150983_1176021323300011120Forest SoilVTIQCKGRVVRSDPTGTSPDGKGVACVIDSYEFVRK*
Ga0150983_1245607723300011120Forest SoilPEVTGGQENVVIACKGRVVRTDPTGASPDGKGVACVIDSYEFVRNS*
Ga0150983_1404049323300011120Forest SoilPEVTGAKENVTVQCKGRVVRTDEPASGGSSASAEARGVACVIDSYDFVRHP*
Ga0150983_1507672323300011120Forest SoilVTGGQENVTIQCKGRVVRTDPTGTSPDGKGVACVIDSYEFVRKS*
Ga0137388_1025478613300012189Vadose Zone SoilVIQCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS*
Ga0137399_1030808313300012203Vadose Zone SoilGGKENVTIQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS*
Ga0137380_1174966023300012206Vadose Zone SoilQCRGRVVRTDEPAAGAAPGDNRGVACVIDSYEFVRNS*
Ga0137378_1130794313300012210Vadose Zone SoilPPEMTGAKDNVIIQCRGRVVRTDEPAGSSPTEARGVACVIDSYDFVRHT*
Ga0137385_1084758613300012359Vadose Zone SoilGGPENVTIQCKERVVRADEPGEGGEGRGVACMIDSYEFVRNS*
Ga0137360_1003742313300012361Vadose Zone SoilMTGAKEGVVIQCRGRVVRTDEPTGGPTEARGVACVIDSYDFVRH*
Ga0134060_130037313300012410Grasslands SoilITLPPDVTGGKEDVIIQCRGRVIRTDEPPASTPAEARGVACVIDTYEFVRNS*
Ga0137413_1095971413300012924Vadose Zone SoilRGRVVRTDEPAAGAAPGDNRGVACVIDSYEFVRNS*
Ga0137404_1020408013300012929Vadose Zone SoilVVIQCRGRVVRADEASGSKDARGVACVIDSYDFVRHS*
Ga0126369_1000610113300012971Tropical Forest SoilNVVIQCRGRVVRTDEPAGSSTEARGVACVIDSYDFVRHN*
Ga0126369_1255086713300012971Tropical Forest SoilVTIQCKGRVVRSDESGEGGEGRGVACVIDSYEFVRNS*
Ga0181527_107573833300014153BogRGRVVRTDEPDASAETGDSRGVACVIDSYEFVRNS*
Ga0181527_119904723300014153BogKDNVVIQCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS*
Ga0181530_1053844413300014159BogCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS*
Ga0181517_1038502623300014160BogQCRGRVVRTDEPHDGAGSGDNRGVACVIDSYEFVRNS*
Ga0181523_1058919513300014165BogDVVIQCRGRVVRTDEPNTSADSGDSRGVACVIDSYEFVRNS*
Ga0181531_1017997313300014169BogIQCKGRVVRADATGEGGEGRGVACVIDSYEFVRNS*
Ga0181537_1068825113300014201BogKEPVLVQCKGRVVRTDEPAAGTEARGVACVIDSYDFVRHE*
Ga0182018_1060309223300014489PalsaGGQENVVIQCKGRVVRTDQTGSNDEGRGVACVIDSYEFVRNS*
Ga0157379_1053955813300014968Switchgrass RhizosphereMTGAKEGVVIQCRGRVVRTDEPAGGPTEARGVACVIDSYDFVRH*
Ga0157376_1268495713300014969Miscanthus RhizosphereQENVVIACRGRVVRTDDSKADAAGTRGVACVIDSYEFVRNS*
Ga0137418_1075799313300015241Vadose Zone SoilGRENVTIQCKGRVVRSDPTGSSPDGKGVACVIDSYEFVRKS*
Ga0137412_1021171913300015242Vadose Zone SoilGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS*
Ga0137409_1136073813300015245Vadose Zone SoilGTENVKIQCKGRVVRTDESGKGDEGRGVACVIDSYEFIRNS*
Ga0137403_1102203623300015264Vadose Zone SoilKIQCKGRVVRADETGSGGEGRGVACVIDTYEFVRNS*
Ga0181507_135296923300016705PeatlandGGQENVTIQCKGRVVRADATGEGGEGRGVACVIDSYEFVRNS
Ga0187802_1046636313300017822Freshwater SedimentVVVQCRGRVVRTDEPGGSNAESRGVACVIDSYDFIRHP
Ga0187820_130259013300017924Freshwater SedimentIVQCRGRVVRTDEPAAGSSSTPAEARGVACVIDSYDFVRHS
Ga0187856_107493813300017925PeatlandKDNVVIQCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS
Ga0187824_1036829413300017927Freshwater SedimentKMTGGPENVTIQCKGRVVRSDETGTGGEGRGVACVIDSYEFVRK
Ga0187806_136519613300017928Freshwater SedimentENVIVQCRGRVVRTDEPAAGGATEARGVACVIDSYDFIRHD
Ga0187825_1008615633300017930Freshwater SedimentQGRGRVVRTDTPPPGHNGDANYRGVACVIDSYEFVRNT
Ga0187801_1012894313300017933Freshwater SedimentIQCRGRVVRTDEPNASAGSGDSRGVACVIDSYEFVRNS
Ga0187848_1033008023300017935PeatlandVVIQCRGRVVRTDEPNGSAGSGDNRGVACVIDSYEFVRNS
Ga0187821_1030723813300017936Freshwater SedimentPEHVTIQCKGRVVRSDETGTGGEGRGVACVIDSYEFVRKS
Ga0187854_1026328313300017938PeatlandGQENVIIQCKGRVVRTDPTGSSAEGKGVACVIDSYEFVRNS
Ga0187817_1010831513300017955Freshwater SedimentGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS
Ga0187817_1033114723300017955Freshwater SedimentVVIQCRGRVVRTDEPSAGSASADNRGVACVIDSYEFVRNS
Ga0187817_1039386223300017955Freshwater SedimentKENVIVQCRGRVVRTDEPAAGGATEARGVACVIDSYDFIRHD
Ga0187778_1086923913300017961Tropical PeatlandPENVTIQCKGRVVRSDPTGSGGEGRGVACVIDSYEFVGNS
Ga0187781_1007632513300017972Tropical PeatlandTIQCKGRVVRTDDTGKGGEGRGVACVIDSYEFVRNS
Ga0187781_1017680223300017972Tropical PeatlandPEVTGAKENVIVQCRGRVVRTDEPAAGGKTTEARGVACVIDSYDFVRHS
Ga0181520_1115006823300017988BogQCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS
Ga0187767_1037617613300017999Tropical PeatlandIVQCRGRVVRTDEPVTNNPKQARGVACVIDSYDFVRRE
Ga0187880_109021613300018016PeatlandVVIQCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS
Ga0187880_136453923300018016PeatlandQENVVIQCKGRVVRTDPTGASEEGKGVACVIDSYEFVRNS
Ga0187874_1012046833300018019PeatlandCRGRVVRTDEPDASTEPGDSRGVACVIDSYEFVRNS
Ga0187863_10004326113300018034PeatlandPDVTGGKDNVVIQCKGRVVRTDPTGASEEGKGVACVIDSYEFVRNS
Ga0187863_1012256313300018034PeatlandKENVTVQCKGRVVRTDEPATGGSSSPAEARGVACVIDSYDFVRHP
Ga0187887_1093264213300018043PeatlandCRGRVVRTDEPTGGVNSTEARGVACVIDSYDFVRHS
Ga0187890_1021419513300018044PeatlandVIQCKGRVVRTDPTGASEEGKGVACVIDSYEFVRNS
Ga0184619_1032805623300018061Groundwater SedimentCKGRVVRSDDPASGGSGGEYRGVACVIDSYDFVRR
Ga0187784_1098816923300018062Tropical PeatlandQENVTIQCKGRVVRADESGKGGEGRGVACVIDSYEFVRNS
Ga0187772_1019985733300018085Tropical PeatlandGGQENVTIQCKGRVVRSDETGAGGEGRGVACVIDSYEFVRNTDH
Ga0187771_1084173713300018088Tropical PeatlandVIVQCRGRVVRTDEPASGNAKEPRGVACVIDSYDFLRRE
Ga0187770_1001465613300018090Tropical PeatlandDNVIVQCRGRVVRTDEPASGGKTTEARGVACVIDSYDFVRHS
Ga0187770_1107748013300018090Tropical PeatlandDVVIQCRGRVVRTDEPHGSAAPTEIRGVACVIDSYEFVRNS
Ga0066667_1025454313300018433Grasslands SoilTGGKEDVIIQCRGRVIRTDEPPASTPAEARGVACVIDTYEFVRNS
Ga0181504_136866723300019258PeatlandTIQCKGRVVRSDPTGTSPDGKGVACVIDSYEFVRK
Ga0181512_119446723300019270PeatlandDVTGGRENVVIACKGRVVRADPSGASEDGRGVACVIDSYEFVRNG
Ga0187800_149674823300019278PeatlandQENVTIQCKGRVVRTDETGEGGEGRGVACVIDSYEFVRNS
Ga0187797_140548223300019284PeatlandMTGGQENVTIQCKGRVVRADETGGGGEGRGVACVIDTYEFVRNT
Ga0182025_132187353300019786PermafrostMTGGQENVTIQCKGRVVRADETGKGGEGRGVACVIDSYEFVRNS
Ga0193715_105052023300019878SoilIHCKGRVVRSDDPASGGSGGESRGVACVIDSYDFVRR
Ga0193723_103366813300019879SoilQCRGRVVRTDESSIDPDGTRGVACVIDSYEFVRNS
Ga0193729_103435343300019887SoilPERTGAKEGVVIQCRGRVVRTDEPTGGPTEARGVACVIDSYDFVRH
Ga0193735_117674523300020006SoilNVTIQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS
Ga0215015_1012336413300021046SoilNVTLQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS
Ga0179596_1062179923300021086Vadose Zone SoilGKEDVVIQCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS
Ga0210408_1140649823300021178SoilVVIQCRGRVVRTDESKVDPDGTRGVACVIDSYEFVRNS
Ga0210396_1142663323300021180SoilEMTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRKS
Ga0210397_1089862623300021403SoilKEGVVIQCRGRVVRTDEPAGSSPTEARGVACVIDSYDFVRH
Ga0210397_1155748923300021403SoilPEMTGGTENVKIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRS
Ga0210389_1028836213300021404SoilEMTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS
Ga0210386_1134265913300021406SoilQEHVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNE
Ga0210383_1179334323300021407SoilCKGRVVRTDEPATGGSSNPAEARGVACVIDSYDFVRHT
Ga0210409_1097342723300021559SoilDHVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRKS
Ga0210409_1127485613300021559SoilTIQCKGRVVRTDPTGSSPDGKGVACVIDSYEFVRKS
Ga0210409_1149562413300021559SoilEVTGAKEVVVVQCKGRVVRKDEPAGNSATDTRGVACVIDSYDFVRRS
Ga0210409_1171875923300021559SoilTENVKIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS
Ga0126371_1001179983300021560Tropical Forest SoilQENVTIQCKGRVVRADESGEGGEGRGVACVIDSYEFVRNS
Ga0213853_1012493613300021861WatershedsGAKEGVVIQCRGRVVRTDEPTGSSPTEARGVACVIDSYDFVRH
Ga0242652_102712413300022510SoilENVTVQCKGRVVRTDEPATGGSSASAEARGVACVIDSYDFVRHP
Ga0242663_108538813300022523SoilIQCRGRVVRTDEPNASAGSGDNRGVACVIDSYEFVRNS
Ga0242660_118223613300022531SoilEMTGGQENVTIQCKGRVVRADATGTGGEGRGVACVIDSYEFVRNS
Ga0242660_119391823300022531SoilENVTIQCKGRVVRTDPTGSSPDGKGVACVIDSYEFVRKS
Ga0242653_104685223300022712SoilKENVVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS
Ga0242661_115706023300022717SoilGKDDVVIQCRGRVVRTDEPNTSAESGDSRGVACVIDSYEFVRNS
Ga0242675_104010113300022718SoilQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS
Ga0242665_1011301813300022724SoilGGKENVTIQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS
Ga0224547_100950623300023255SoilSQENVKIACKGRVVRSDPTGASPDGKGVACVIDSYEFVRNS
Ga0228598_109835413300024227RhizosphereTVQCKGRVVRTDEPATGGSSSPAEARGVACVIDSYDFVRHT
Ga0208848_106275323300025509Arctic Peat SoilTIQCKGRVVRADETGSGGEGRGVACVIDSYEFVRNS
Ga0208714_110392913300025527Arctic Peat SoilPEMTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS
Ga0207685_1038326523300025905Corn, Switchgrass And Miscanthus RhizosphereAKEGVVIQCRGRVVRTDEPDGGSPTEARGVACVIDSYDFVRH
Ga0207646_1068172523300025922Corn, Switchgrass And Miscanthus RhizosphereEGVVIQCRGRVVRTDEPTGGPTEARGVACVIDSYDFVRH
Ga0207664_1027234733300025929Agricultural SoilPPEVTGGKENVVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS
Ga0207709_1148054913300025935Miscanthus RhizosphereDNVIIQCRGRVVRADEASGSSDSRGVACVIDSYDFVRHS
Ga0207689_1058987713300025942Miscanthus RhizosphereAKENVVIQCRGRVVRTDEPPSGSTPDEGRGVACVIDSYEFVRNS
Ga0207651_1176328823300025960Switchgrass RhizosphereVTGAKDSVIIQCRGRVVRTDEAGSAEGPADSRGVACVIDSYDFVRHS
Ga0207703_1141469513300026035Switchgrass RhizosphereAKEGVVIQCRGRVVRTDEPDGGPADARGVACVIDSYDFVRH
Ga0209237_109247133300026297Grasslands SoilIIQCHGRVVRTDDPASGSSPTGARGVACVIDSYDFVRH
Ga0209687_125940123300026322SoilCRGRVIRTDEPASGGSSAEGRGVACVIDSYEFVRNS
Ga0209377_104720643300026334SoilHCKGRVVRSDDPASSSGGGDSRGVACVIDSYDFVRR
Ga0257173_103036213300026360SoilKEGVVIQCRGRVVRTDEPTGSPTEARGVACVIDSYDFVRH
Ga0257156_102178313300026498SoilIQCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS
Ga0209161_1024912123300026548SoilEVTGGKENVTIQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS
Ga0208603_105310123300027109Forest SoilPPDVTGGQQNVTIQCKGRVVRSDPTGSSPDGKGVACVIDSYEFVRKS
Ga0207780_100934843300027313Tropical Forest SoilTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS
Ga0209332_103849523300027439Forest SoilRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS
Ga0208993_108687613300027480Forest SoilEMTGGTENVTIQCKGRVVRADETGSGGEGRGVACVIDSYEFVRNS
Ga0209527_111067423300027583Forest SoilEDVVIQCRGRVVRTDEPNTSADSGESRGVACVIDSYEFVRNS
Ga0209420_117955323300027648Forest SoilEDVVIQCRGRVVRTDEPNTSAESGDNRGVACVIDSYEFVRNG
Ga0209118_121887723300027674Forest SoilPEVTGAKEPVMVKCIGRVVRTDEPASGGKSSEARGVACVIDSYDFVRHE
Ga0209446_117882413300027698Bog Forest SoilNVTVQCKGRVVRTDEPATGSSSTPAEARGVACVIDSYDFVRHP
Ga0209908_1014626823300027745Thawing PermafrostGAKESVTVQCRGRVVRTDEPAGASSAESRGVACVIDSYDFVRHS
Ga0209655_1003559233300027767Bog Forest SoilVIQCRGRVVRTDEPNASTEPGQSRGVACVIDSYEFVRNS
Ga0209074_1012157223300027787Agricultural SoilVTIQGRGRVVRTDNPPPGRNGENYRGVACVIDSYEFVRNT
Ga0209060_1041007523300027826Surface SoilKENVIVQCRGRVVRTDEPTSGKGEGRGVACVIDSYDFVRHE
Ga0209580_1067166313300027842Surface SoilGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVSNS
Ga0209579_1004971143300027869Surface SoilPEMTGGQENVTIQCKGRVVRADETGQGGEGRGVACVIDSYEFTRNS
Ga0209275_1032158213300027884SoilLPPDVTGGQENVVIQCKGRVVRADPTGTSEEGRGVACVIDSYEFVRTS
Ga0209067_1039419613300027898WatershedsRGRVVRTDEPTGGVNSREARGVACVIDSYDFIRHS
Ga0209698_1002787953300027911WatershedsIQCKGRVVRADEAGKGGEGRGVACVIDTYEFVRNS
Ga0209698_1052912313300027911WatershedsPEVTGGKENVVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS
Ga0209698_1084786923300027911WatershedsENVTIHCNGRVVRTDEPAGKDSDNRGVACVIDSYEFVRNS
Ga0265351_100128033300028020SoilGQENVTIQCKGRVVRADATGTGGEGRGVACVIDSYEFVRS
Ga0302267_1038565013300028745BogGGQENVVIQCKGRVVRTDPTGASADGKGVACVIDSYEFVRNA
Ga0302224_1007461713300028759PalsaPDVTGGQESVVIQCKGRVVRTDPTGASAEGKGVACVIDSYEFVRNS
Ga0302224_1016034713300028759PalsaDVTGGQENVTIQCKGRVVRSDPTGTSPDGKGVACVIDSYEFVRK
Ga0308309_1037886913300028906SoilGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFIRNS
Ga0222749_1038808813300029636SoilRVVRTDEPATGGSTSPAEARGVACVIDSYDFVRQS
Ga0302148_104117333300029916BogGKDDVVIQCRGRVVRTDEPKGSAGSGDDLGVACVIDSYEFVRNS
Ga0311340_1085580223300029943PalsaIQCKGRVVRTDPTGASADGKGVACVIDSYEFVRNS
Ga0302304_1002381813300029993PalsaVVIQCKGRVVRTDPTGASADGKGVACVIDSYEFVRNS
Ga0311339_1126840413300029999PalsaENVTVQCKGRVVRTDEPATGGSSTPAEARGVACVIDSYDFVRHP
Ga0311339_1194509213300029999PalsaNVTIQCKGRVVRADETGKDGEGRGVACVIDSYEFVRK
Ga0311338_1110977513300030007PalsaTGGQEHVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS
Ga0311338_1140830523300030007PalsaIQCRGRVVRTDEPNASTEPGDHRGVACVIDSYEFVRNS
Ga0311344_1069412323300030020BogPDVTGGQENVTIQCKGRVVRADPTGSSPDGKGVACVIDSYEFVRK
Ga0302181_1040135523300030056PalsaGKDSVVIQCRGRVVRTDEPHASTEPGDSRGVACVIDSYEFVRNS
Ga0302179_1027971213300030058PalsaVVTGGSESVTIQCKGRVVRTDPTGTSPDGKGVACVIDSYEFVRK
Ga0302194_1031077223300030506BogENVTIQCKGRVVRADPTGSSPDGKGVACVIDSYEFVRK
Ga0311357_1067692213300030524PalsaQCRGRVVRTDEPNGSAESGENRGVACVIDSYEFVRNS
Ga0210257_1066529723300030549SoilPDVTGGQENVVIQCKGRVVRADPTGTSEEGRGVACVIDSYEFVRNS
Ga0311355_1032078933300030580PalsaEPVTIQCKGRVVRSDETGEGGEGRGVACVIDSYEFVRKS
Ga0210262_119334023300030583SoilQENVVIQCKGRVVRADPTGTSEEGRGVACVIDSYEFVRNS
Ga0311354_1157177223300030618PalsaQENVVIQCKGRVVRTDPSGANDEGRGVACVIDSYEFVRNS
Ga0302316_1022648813300030646PalsaVTIQCKGRVVRSDPTGTSPDGKGVACVIDSYEFVRK
Ga0265459_1214609523300030741SoilVIQCRGRVVRTDEPNASAASGDNRGVACVIDSYEFVRNT
Ga0265461_1152863823300030743SoilQENVVIQCKGRVVRADPTGTSEEGRGVSCVIDSYEFVRNS
Ga0265753_107767223300030862SoilENVKIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRS
Ga0170834_11194597213300031057Forest SoilNVTIQCKGRVVRADETGKGGEGRGVACVIDSYEFVRNS
Ga0170824_10788061123300031231Forest SoilMTGAKEGVVIQCRGRVVRTDEPAGGSPTEARGVACVIDSYDFVRH
Ga0302325_1198596913300031234PalsaVVIQCRGRVVRTDEPHASTEPGDSRGVACVIDSYEFVRNS
Ga0302325_1257316013300031234PalsaQEHVVIQCKGRVVRTDPSGASAEGKGVACVIDSYEFVRNS
Ga0302324_10006554953300031236PalsaGKDDVVIQCRGRVVRTDEPNSSTEAGEHRGVACVIDSYEFVRNS
Ga0265340_1037893723300031247RhizosphereIQCRGRVVRTDEPKASAESGDSRGVACVIDSYEFVRNS
Ga0170819_1700428713300031469Forest SoilIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS
Ga0302326_1195288723300031525PalsaEVTGAKEDVIVQCKGRVVRTDEPAGHGPKETRGVACVIDTYDFVRRS
Ga0318538_1033192123300031546SoilENVVIQCRGRVVRTDENSTDAAGTRGVACVIDSYEFVRNT
Ga0310915_1095000413300031573SoilENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS
Ga0307474_1046009613300031718Hardwood Forest SoilGQENVVIACKGRVVRTDPTGASPDGKGVACVIDSYEFVRNS
Ga0307474_1058731313300031718Hardwood Forest SoilTIQCKGRVVRADETGSGGEGRGVACVIDSYEFVRKS
Ga0306917_1031596913300031719SoilGAKEPVIVQCRGRVVRTDEPVTNNPKQARGVACVIDSYDFVRRE
Ga0307469_1057096413300031720Hardwood Forest SoilVIQCRGRVVRTDESSTDPDGSRGVACVIDSYEFVRNS
Ga0318502_1023484813300031747SoilVIQCRGRVVRTDESDVDPDGTRGVACVIDSYEFVRNS
Ga0307477_1068010413300031753Hardwood Forest SoilIQCRGRVVRTDESKVDPDGTRGVACVIDSYEFVRNS
Ga0318547_1048545713300031781SoilPEVTGGKENVVIQCRGRVVRTDESDVDPDGTRGVACVIDSYEFVRNS
Ga0316037_11792423300031808SoilENVVIQCKGRVVRTDPTGASEDGKGVACVIDSYEFVRNA
Ga0307478_1063269723300031823Hardwood Forest SoilVTGGMENVVIQCKGRVVRTDPTGATADGKGVACVIDSYEFVRNS
Ga0307478_1075870013300031823Hardwood Forest SoilTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNE
Ga0307478_1088799223300031823Hardwood Forest SoilDVTGGQENVVIQCKGRVVRTDPTGASEEGKGVACVIDSYEFVRNS
Ga0307478_1094482923300031823Hardwood Forest SoilGGQENVTIQCKGRVVRADETGKGGEGRGVACVIDTYEFVRNS
Ga0318527_1008585713300031859SoilIQCRGRVVRTDESDVDPDGTRGVACVIDSYEFVRNS
Ga0318522_1023842723300031894SoilKENVVIQCRGRVVRTDESDVDPDGTRGVACVIDSYEFVRNS
Ga0318520_1037263323300031897SoilFIQCRGRVVRTDESDVDPDGTRGVACVIDSYEFVRNS
Ga0307479_1047914833300031962Hardwood Forest SoilEPVMVKCIGRVVRTDEPASGGKSSEARGVACVIDSYDFVRHE
Ga0308176_1120363423300031996SoilTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDTYEFVRNS
Ga0306922_1086547923300032001SoilTGGKDDVVIQCRGRVVRRDEVASGKETEAGGVACVIDSYEFVRNS
Ga0326631_11343913300032072SoilMTGGTENVKIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRS
Ga0306924_1168501523300032076SoilQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS
Ga0316053_11519213300032120SoilPDVTGGQESVTIQCKGRVVRSDATGASADGKGVACVIDSYEFVRKP
Ga0307471_10216234713300032180Hardwood Forest SoilAIGGKENITIQCRGRVVRKDAPAGGDPAESHGVACVIDSYEFIRNS
Ga0307471_10271206313300032180Hardwood Forest SoilGQENVVIQCKGRVVRTDPTGSSADGKGVACVIDTYEFVRNT
Ga0307471_10362937723300032180Hardwood Forest SoilRGRVVRADETGSTNNPTEARGVACVIDSYDFVRHS
Ga0307472_10191798523300032205Hardwood Forest SoilEVTGGQENVTIQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS
Ga0310812_1022624823300032421SoilEMTGGQENVTIQCKGRVVRADETGEGGKGRGVACVIDTYEFVRNS
Ga0348332_1285901613300032515Plant LitterVTGGQENVTIQCKGRVVRSDPTGTSPDGKGVACVIDSYEFVRK
Ga0335079_1135495723300032783SoilTGAKENVIIQCKGRVVRTDEPGTESPDSRGVACVIDSYDFVRNS
Ga0335078_1088671733300032805SoilAKEPVLVQCRGRVVRTDEPGTGEAKDTRGVACVIDSYDFIRRE
Ga0335078_1179623213300032805SoilVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS
Ga0335081_1272854923300032892SoilENVVIQCRGRVVRTDEPPSGSQPTEARGVACVIDSYDFVRHS
Ga0335076_1166293123300032955SoilENVTIQCKGRVVRSDETGEGGEGRGVACVIDSYEFVRNS
Ga0326728_1016450713300033402Peat SoilVIQCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS
Ga0326730_108993723300033500Peat SoilVVIQCRGRVVRADEAAGGGSPEARGVACVIDSYEFVRNS
Ga0326723_0288782_2_1213300034090Peat SoilVIQCRGRVVRTDEPAAGAAPGDNRGVACVIDSYEFVRNP
Ga0370514_115856_566_6793300034199Untreated Peat SoilVTIQCKGRVVRADETGKGGEGRGVACVIDSYEFVRNS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.