| Basic Information | |
|---|---|
| Family ID | F010714 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 300 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRVKLQLVMCSDAGQEETVTDVITLNKNNQRIEHLGLTLAEAK |
| Number of Associated Samples | 181 |
| Number of Associated Scaffolds | 300 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.49 % |
| % of genes near scaffold ends (potentially truncated) | 81.00 % |
| % of genes from short scaffolds (< 2000 bps) | 86.00 % |
| Associated GOLD sequencing projects | 162 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.23% β-sheet: 30.99% Coil/Unstructured: 64.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 300 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 1.67 |
| PF00496 | SBP_bac_5 | 1.67 |
| PF13565 | HTH_32 | 1.33 |
| PF00589 | Phage_integrase | 1.33 |
| PF07592 | DDE_Tnp_ISAZ013 | 1.00 |
| PF16363 | GDP_Man_Dehyd | 1.00 |
| PF02738 | MoCoBD_1 | 1.00 |
| PF03098 | An_peroxidase | 0.67 |
| PF01695 | IstB_IS21 | 0.67 |
| PF13744 | HTH_37 | 0.67 |
| PF07690 | MFS_1 | 0.67 |
| PF04986 | Y2_Tnp | 0.67 |
| PF13546 | DDE_5 | 0.67 |
| PF01402 | RHH_1 | 0.67 |
| PF03050 | DDE_Tnp_IS66 | 0.67 |
| PF12759 | HTH_Tnp_IS1 | 0.67 |
| PF00076 | RRM_1 | 0.67 |
| PF12762 | DDE_Tnp_IS1595 | 0.67 |
| PF02371 | Transposase_20 | 0.67 |
| PF10431 | ClpB_D2-small | 0.33 |
| PF13424 | TPR_12 | 0.33 |
| PF14216 | DUF4326 | 0.33 |
| PF00239 | Resolvase | 0.33 |
| PF01381 | HTH_3 | 0.33 |
| PF13614 | AAA_31 | 0.33 |
| PF01408 | GFO_IDH_MocA | 0.33 |
| PF00355 | Rieske | 0.33 |
| PF00872 | Transposase_mut | 0.33 |
| PF05199 | GMC_oxred_C | 0.33 |
| PF13155 | Toprim_2 | 0.33 |
| PF05168 | HEPN | 0.33 |
| PF11381 | DUF3185 | 0.33 |
| PF00962 | A_deaminase | 0.33 |
| PF13473 | Cupredoxin_1 | 0.33 |
| PF13191 | AAA_16 | 0.33 |
| PF00326 | Peptidase_S9 | 0.33 |
| PF00126 | HTH_1 | 0.33 |
| PF01464 | SLT | 0.33 |
| PF01814 | Hemerythrin | 0.33 |
| PF05598 | DUF772 | 0.33 |
| PF06742 | DUF1214 | 0.33 |
| PF00665 | rve | 0.33 |
| PF00266 | Aminotran_5 | 0.33 |
| PF01904 | DUF72 | 0.33 |
| PF00296 | Bac_luciferase | 0.33 |
| PF13229 | Beta_helix | 0.33 |
| PF00685 | Sulfotransfer_1 | 0.33 |
| PF04545 | Sigma70_r4 | 0.33 |
| PF01396 | zf-C4_Topoisom | 0.33 |
| PF14864 | Alkyl_sulf_C | 0.33 |
| PF04055 | Radical_SAM | 0.33 |
| PF00582 | Usp | 0.33 |
| PF13561 | adh_short_C2 | 0.33 |
| PF01436 | NHL | 0.33 |
| PF14104 | DUF4277 | 0.33 |
| PF13586 | DDE_Tnp_1_2 | 0.33 |
| PF10851 | DUF2652 | 0.33 |
| PF00211 | Guanylate_cyc | 0.33 |
| PF13005 | zf-IS66 | 0.33 |
| PF00158 | Sigma54_activat | 0.33 |
| PF01012 | ETF | 0.33 |
| PF10816 | DUF2760 | 0.33 |
| PF13358 | DDE_3 | 0.33 |
| PF02518 | HATPase_c | 0.33 |
| PF12974 | Phosphonate-bd | 0.33 |
| PF00561 | Abhydrolase_1 | 0.33 |
| PF00226 | DnaJ | 0.33 |
| PF04542 | Sigma70_r2 | 0.33 |
| PF05015 | HigB-like_toxin | 0.33 |
| PF07386 | DUF1499 | 0.33 |
| PF14319 | Zn_Tnp_IS91 | 0.33 |
| PF00890 | FAD_binding_2 | 0.33 |
| PF13517 | FG-GAP_3 | 0.33 |
| PF07969 | Amidohydro_3 | 0.33 |
| PF13384 | HTH_23 | 0.33 |
| PF07589 | PEP-CTERM | 0.33 |
| PF13738 | Pyr_redox_3 | 0.33 |
| PF01526 | DDE_Tnp_Tn3 | 0.33 |
| PF16694 | Cytochrome_P460 | 0.33 |
| PF13188 | PAS_8 | 0.33 |
| PF02899 | Phage_int_SAM_1 | 0.33 |
| PF13737 | DDE_Tnp_1_5 | 0.33 |
| COG ID | Name | Functional Category | % Frequency in 300 Family Scaffolds |
|---|---|---|---|
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.67 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.67 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.67 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.67 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.67 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.67 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.67 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.33 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.33 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.33 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.33 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.33 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.33 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.33 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.33 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.33 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.33 |
| COG4446 | Uncharacterized conserved protein, DUF1499 family | Function unknown [S] | 0.33 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.33 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.33 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.33 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.33 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.33 |
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 0.33 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.33 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.33 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.33 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.33 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.33 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.33 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.33 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.33 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.33 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.33 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.67 % |
| Unclassified | root | N/A | 25.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100683722 | Not Available | 557 | Open in IMG/M |
| 3300000956|JGI10216J12902_113605613 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300003203|JGI25406J46586_10049896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1409 | Open in IMG/M |
| 3300004268|Ga0066398_10180357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii | 547 | Open in IMG/M |
| 3300004463|Ga0063356_100472663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1645 | Open in IMG/M |
| 3300004633|Ga0066395_10717375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
| 3300005174|Ga0066680_10164230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1394 | Open in IMG/M |
| 3300005186|Ga0066676_10138242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1520 | Open in IMG/M |
| 3300005289|Ga0065704_10808357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 516 | Open in IMG/M |
| 3300005294|Ga0065705_10395961 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300005295|Ga0065707_10721440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300005332|Ga0066388_100319053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2199 | Open in IMG/M |
| 3300005332|Ga0066388_100866545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1486 | Open in IMG/M |
| 3300005332|Ga0066388_100941127 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300005332|Ga0066388_102253858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 984 | Open in IMG/M |
| 3300005332|Ga0066388_103369113 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300005332|Ga0066388_104479089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 711 | Open in IMG/M |
| 3300005332|Ga0066388_105092954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → Acidithiobacillus ferrivorans | 667 | Open in IMG/M |
| 3300005332|Ga0066388_106346636 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005332|Ga0066388_108786560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300005343|Ga0070687_100695824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300005441|Ga0070700_100188062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1442 | Open in IMG/M |
| 3300005445|Ga0070708_100260681 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300005445|Ga0070708_100769231 | Not Available | 905 | Open in IMG/M |
| 3300005471|Ga0070698_100187118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2008 | Open in IMG/M |
| 3300005540|Ga0066697_10393688 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300005547|Ga0070693_101359283 | Not Available | 551 | Open in IMG/M |
| 3300005552|Ga0066701_10119545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1559 | Open in IMG/M |
| 3300005552|Ga0066701_10368656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylovulum → Methylovulum psychrotolerans | 889 | Open in IMG/M |
| 3300005554|Ga0066661_10324614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 946 | Open in IMG/M |
| 3300005556|Ga0066707_10623663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 685 | Open in IMG/M |
| 3300005558|Ga0066698_10017177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4151 | Open in IMG/M |
| 3300005576|Ga0066708_10776074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 602 | Open in IMG/M |
| 3300005577|Ga0068857_101520150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
| 3300005617|Ga0068859_100071285 | All Organisms → cellular organisms → Bacteria | 3511 | Open in IMG/M |
| 3300005764|Ga0066903_103130766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 895 | Open in IMG/M |
| 3300005764|Ga0066903_104918666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 710 | Open in IMG/M |
| 3300005764|Ga0066903_105567006 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300005764|Ga0066903_106209013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300005764|Ga0066903_106227834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 623 | Open in IMG/M |
| 3300005937|Ga0081455_10956070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 531 | Open in IMG/M |
| 3300006049|Ga0075417_10012151 | All Organisms → cellular organisms → Bacteria | 3233 | Open in IMG/M |
| 3300006049|Ga0075417_10022954 | All Organisms → cellular organisms → Bacteria | 2507 | Open in IMG/M |
| 3300006049|Ga0075417_10486797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300006049|Ga0075417_10512527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 604 | Open in IMG/M |
| 3300006049|Ga0075417_10585028 | Not Available | 567 | Open in IMG/M |
| 3300006058|Ga0075432_10596399 | Not Available | 505 | Open in IMG/M |
| 3300006173|Ga0070716_100592539 | Not Available | 833 | Open in IMG/M |
| 3300006194|Ga0075427_10012773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1278 | Open in IMG/M |
| 3300006844|Ga0075428_100956255 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300006845|Ga0075421_101851570 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300006845|Ga0075421_101908377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300006846|Ga0075430_100369263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfocapsaceae → Desulfofustis → unclassified Desulfofustis → Desulfofustis sp. PB-SRB1 | 1184 | Open in IMG/M |
| 3300006846|Ga0075430_100778201 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300006846|Ga0075430_100808532 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300006847|Ga0075431_100151290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2390 | Open in IMG/M |
| 3300006847|Ga0075431_100557872 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300006853|Ga0075420_100125824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2256 | Open in IMG/M |
| 3300006853|Ga0075420_100131831 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
| 3300006853|Ga0075420_100828945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 796 | Open in IMG/M |
| 3300006904|Ga0075424_101059523 | Not Available | 864 | Open in IMG/M |
| 3300006904|Ga0075424_101091249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
| 3300006969|Ga0075419_11062642 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300007255|Ga0099791_10097798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1349 | Open in IMG/M |
| 3300007255|Ga0099791_10663901 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300007258|Ga0099793_10295142 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 787 | Open in IMG/M |
| 3300007258|Ga0099793_10373444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 699 | Open in IMG/M |
| 3300007265|Ga0099794_10436470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 686 | Open in IMG/M |
| 3300007265|Ga0099794_10691338 | Not Available | 543 | Open in IMG/M |
| 3300009012|Ga0066710_100225614 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
| 3300009012|Ga0066710_103514485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 593 | Open in IMG/M |
| 3300009038|Ga0099829_11757992 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300009089|Ga0099828_10053022 | All Organisms → cellular organisms → Bacteria | 3374 | Open in IMG/M |
| 3300009089|Ga0099828_11559965 | Not Available | 582 | Open in IMG/M |
| 3300009090|Ga0099827_11025603 | Not Available | 716 | Open in IMG/M |
| 3300009090|Ga0099827_11754222 | Not Available | 541 | Open in IMG/M |
| 3300009090|Ga0099827_11755424 | Not Available | 541 | Open in IMG/M |
| 3300009090|Ga0099827_11962387 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009100|Ga0075418_11162491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 836 | Open in IMG/M |
| 3300009100|Ga0075418_11699014 | Not Available | 686 | Open in IMG/M |
| 3300009137|Ga0066709_101890177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 832 | Open in IMG/M |
| 3300009143|Ga0099792_10790346 | Not Available | 621 | Open in IMG/M |
| 3300009147|Ga0114129_10068360 | All Organisms → cellular organisms → Bacteria | 4953 | Open in IMG/M |
| 3300009147|Ga0114129_11164203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 962 | Open in IMG/M |
| 3300009147|Ga0114129_12120472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 678 | Open in IMG/M |
| 3300009147|Ga0114129_12150909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 672 | Open in IMG/M |
| 3300009147|Ga0114129_12866313 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 571 | Open in IMG/M |
| 3300009162|Ga0075423_10080318 | All Organisms → cellular organisms → Bacteria | 3397 | Open in IMG/M |
| 3300009162|Ga0075423_12530695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 560 | Open in IMG/M |
| 3300009162|Ga0075423_13013975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 516 | Open in IMG/M |
| 3300009553|Ga0105249_10538663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1217 | Open in IMG/M |
| 3300009610|Ga0105340_1083773 | Not Available | 1267 | Open in IMG/M |
| 3300009799|Ga0105075_1064901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300009823|Ga0105078_1029177 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300009837|Ga0105058_1165644 | Not Available | 542 | Open in IMG/M |
| 3300010043|Ga0126380_10036699 | Not Available | 2535 | Open in IMG/M |
| 3300010043|Ga0126380_11386641 | Not Available | 616 | Open in IMG/M |
| 3300010043|Ga0126380_11596531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 582 | Open in IMG/M |
| 3300010046|Ga0126384_10130036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1909 | Open in IMG/M |
| 3300010046|Ga0126384_10466285 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300010046|Ga0126384_10686581 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300010046|Ga0126384_11191935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 702 | Open in IMG/M |
| 3300010046|Ga0126384_11192638 | Not Available | 702 | Open in IMG/M |
| 3300010046|Ga0126384_12247938 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010047|Ga0126382_10857277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 781 | Open in IMG/M |
| 3300010047|Ga0126382_11199933 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300010047|Ga0126382_12318631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 519 | Open in IMG/M |
| 3300010109|Ga0127497_1100208 | Not Available | 631 | Open in IMG/M |
| 3300010140|Ga0127456_1004074 | Not Available | 1036 | Open in IMG/M |
| 3300010358|Ga0126370_10897992 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 800 | Open in IMG/M |
| 3300010358|Ga0126370_11975541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 569 | Open in IMG/M |
| 3300010358|Ga0126370_12031097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
| 3300010358|Ga0126370_12573672 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010359|Ga0126376_10073091 | All Organisms → cellular organisms → Bacteria | 2517 | Open in IMG/M |
| 3300010359|Ga0126376_10360496 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300010359|Ga0126376_12309288 | Not Available | 584 | Open in IMG/M |
| 3300010359|Ga0126376_12861245 | Not Available | 532 | Open in IMG/M |
| 3300010359|Ga0126376_13157046 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300010360|Ga0126372_11359322 | Not Available | 741 | Open in IMG/M |
| 3300010360|Ga0126372_12189183 | Not Available | 602 | Open in IMG/M |
| 3300010362|Ga0126377_10812255 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 994 | Open in IMG/M |
| 3300010362|Ga0126377_12004115 | Not Available | 655 | Open in IMG/M |
| 3300010362|Ga0126377_12812756 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300010362|Ga0126377_13543276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
| 3300010366|Ga0126379_11280497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 839 | Open in IMG/M |
| 3300010366|Ga0126379_11633674 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300010366|Ga0126379_11648254 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300010366|Ga0126379_12263782 | Not Available | 644 | Open in IMG/M |
| 3300010366|Ga0126379_13259105 | Not Available | 543 | Open in IMG/M |
| 3300010398|Ga0126383_10090120 | All Organisms → cellular organisms → Bacteria | 2707 | Open in IMG/M |
| 3300010398|Ga0126383_10102179 | All Organisms → cellular organisms → Bacteria | 2566 | Open in IMG/M |
| 3300010398|Ga0126383_10499514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1275 | Open in IMG/M |
| 3300010398|Ga0126383_11089235 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 888 | Open in IMG/M |
| 3300010398|Ga0126383_11585407 | Not Available | 744 | Open in IMG/M |
| 3300010399|Ga0134127_12497120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
| 3300011000|Ga0138513_100049197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 638 | Open in IMG/M |
| 3300011119|Ga0105246_10192823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1578 | Open in IMG/M |
| 3300011269|Ga0137392_10089329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2407 | Open in IMG/M |
| 3300011270|Ga0137391_10653202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica | 877 | Open in IMG/M |
| 3300011271|Ga0137393_10460715 | Not Available | 1090 | Open in IMG/M |
| 3300012189|Ga0137388_11042142 | Not Available | 754 | Open in IMG/M |
| 3300012199|Ga0137383_10379579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1035 | Open in IMG/M |
| 3300012202|Ga0137363_10227795 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300012202|Ga0137363_10370872 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300012203|Ga0137399_10171875 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1744 | Open in IMG/M |
| 3300012204|Ga0137374_10206679 | Not Available | 1686 | Open in IMG/M |
| 3300012206|Ga0137380_10297768 | Not Available | 1446 | Open in IMG/M |
| 3300012207|Ga0137381_10739548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 854 | Open in IMG/M |
| 3300012207|Ga0137381_11113475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 679 | Open in IMG/M |
| 3300012207|Ga0137381_11204990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300012207|Ga0137381_11545595 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012208|Ga0137376_11402980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
| 3300012209|Ga0137379_10295841 | Not Available | 1529 | Open in IMG/M |
| 3300012209|Ga0137379_11465394 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012209|Ga0137379_11693973 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012210|Ga0137378_10322088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1438 | Open in IMG/M |
| 3300012210|Ga0137378_11210483 | Not Available | 671 | Open in IMG/M |
| 3300012211|Ga0137377_10190741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1968 | Open in IMG/M |
| 3300012211|Ga0137377_10917765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 807 | Open in IMG/M |
| 3300012212|Ga0150985_110670688 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012349|Ga0137387_10238028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1311 | Open in IMG/M |
| 3300012351|Ga0137386_10964821 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012356|Ga0137371_10191867 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300012357|Ga0137384_10818739 | Not Available | 753 | Open in IMG/M |
| 3300012359|Ga0137385_10701140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 845 | Open in IMG/M |
| 3300012359|Ga0137385_10822108 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300012359|Ga0137385_10937263 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012359|Ga0137385_11227331 | Not Available | 612 | Open in IMG/M |
| 3300012360|Ga0137375_10351549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1308 | Open in IMG/M |
| 3300012361|Ga0137360_10286992 | Not Available | 1363 | Open in IMG/M |
| 3300012361|Ga0137360_10653251 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300012361|Ga0137360_10856549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 783 | Open in IMG/M |
| 3300012361|Ga0137360_10913915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
| 3300012361|Ga0137360_11089370 | Not Available | 690 | Open in IMG/M |
| 3300012362|Ga0137361_10076837 | All Organisms → cellular organisms → Bacteria | 2845 | Open in IMG/M |
| 3300012362|Ga0137361_10131919 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
| 3300012362|Ga0137361_11033374 | Not Available | 742 | Open in IMG/M |
| 3300012362|Ga0137361_11287987 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 655 | Open in IMG/M |
| 3300012363|Ga0137390_10166190 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. | 2194 | Open in IMG/M |
| 3300012363|Ga0137390_10241556 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Schlesneria → Schlesneria paludicola | 1791 | Open in IMG/M |
| 3300012363|Ga0137390_10891082 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300012410|Ga0134060_1344313 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012480|Ga0157346_1028494 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012683|Ga0137398_11160608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
| 3300012685|Ga0137397_11322158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
| 3300012917|Ga0137395_10075298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica | 2189 | Open in IMG/M |
| 3300012922|Ga0137394_10054201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3317 | Open in IMG/M |
| 3300012922|Ga0137394_10177670 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300012922|Ga0137394_10208072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1672 | Open in IMG/M |
| 3300012922|Ga0137394_10908853 | Not Available | 734 | Open in IMG/M |
| 3300012925|Ga0137419_11252601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium SG8_19 | 622 | Open in IMG/M |
| 3300012927|Ga0137416_10037217 | All Organisms → cellular organisms → Bacteria | 3306 | Open in IMG/M |
| 3300012929|Ga0137404_11865859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 559 | Open in IMG/M |
| 3300012930|Ga0137407_11025002 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300012930|Ga0137407_11552665 | Not Available | 630 | Open in IMG/M |
| 3300012930|Ga0137407_12327911 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012944|Ga0137410_10028544 | All Organisms → cellular organisms → Bacteria | 3881 | Open in IMG/M |
| 3300012944|Ga0137410_10262699 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 1356 | Open in IMG/M |
| 3300012944|Ga0137410_10894305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300012944|Ga0137410_11833603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
| 3300012948|Ga0126375_10074678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1917 | Open in IMG/M |
| 3300012957|Ga0164303_11241830 | Not Available | 548 | Open in IMG/M |
| 3300012971|Ga0126369_10391267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1425 | Open in IMG/M |
| 3300012971|Ga0126369_11431824 | Not Available | 781 | Open in IMG/M |
| 3300012972|Ga0134077_10144118 | Not Available | 947 | Open in IMG/M |
| 3300013306|Ga0163162_10432212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1449 | Open in IMG/M |
| 3300013306|Ga0163162_11200579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300013306|Ga0163162_12302582 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 619 | Open in IMG/M |
| 3300013762|Ga0116693_1031803 | Not Available | 584 | Open in IMG/M |
| 3300015245|Ga0137409_10393433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 1201 | Open in IMG/M |
| 3300015245|Ga0137409_10817310 | Not Available | 767 | Open in IMG/M |
| 3300015264|Ga0137403_11539678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300016270|Ga0182036_10156887 | Not Available | 1627 | Open in IMG/M |
| 3300016270|Ga0182036_10561486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 911 | Open in IMG/M |
| 3300016319|Ga0182033_11418199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Merismopediaceae → Synechocystis → unclassified Synechocystis → Synechocystis sp. PCC 7509 | 626 | Open in IMG/M |
| 3300016341|Ga0182035_11910115 | Not Available | 539 | Open in IMG/M |
| 3300016357|Ga0182032_10364887 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 1159 | Open in IMG/M |
| 3300017792|Ga0163161_11030382 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300018063|Ga0184637_10587202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
| 3300018432|Ga0190275_10082976 | Not Available | 2788 | Open in IMG/M |
| 3300018432|Ga0190275_12630393 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300018466|Ga0190268_10445471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 854 | Open in IMG/M |
| 3300019279|Ga0184642_1455145 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300019789|Ga0137408_1403858 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300021560|Ga0126371_12371748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 641 | Open in IMG/M |
| 3300021560|Ga0126371_13413740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
| 3300021560|Ga0126371_13611030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 522 | Open in IMG/M |
| 3300022226|Ga0224512_10566478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
| 3300022413|Ga0224508_10118260 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1763 | Open in IMG/M |
| 3300023261|Ga0247796_1003059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2138 | Open in IMG/M |
| 3300025908|Ga0207643_10025067 | All Organisms → cellular organisms → Bacteria | 3295 | Open in IMG/M |
| 3300025933|Ga0207706_10479887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1074 | Open in IMG/M |
| 3300025936|Ga0207670_11529806 | Not Available | 567 | Open in IMG/M |
| 3300025939|Ga0207665_11699019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300025961|Ga0207712_10326591 | Not Available | 1268 | Open in IMG/M |
| 3300025972|Ga0207668_10601768 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 958 | Open in IMG/M |
| 3300026035|Ga0207703_11529050 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300026296|Ga0209235_1180718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 775 | Open in IMG/M |
| 3300026328|Ga0209802_1247804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 615 | Open in IMG/M |
| 3300026538|Ga0209056_10656374 | Not Available | 529 | Open in IMG/M |
| 3300026542|Ga0209805_1400706 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300027576|Ga0209003_1090314 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300027654|Ga0209799_1158301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 516 | Open in IMG/M |
| 3300027669|Ga0208981_1171763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
| 3300027748|Ga0209689_1404921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 522 | Open in IMG/M |
| 3300027862|Ga0209701_10105419 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
| 3300027873|Ga0209814_10091679 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300027873|Ga0209814_10269344 | Not Available | 740 | Open in IMG/M |
| 3300027873|Ga0209814_10571083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 503 | Open in IMG/M |
| 3300027874|Ga0209465_10028476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2619 | Open in IMG/M |
| 3300027874|Ga0209465_10276880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 840 | Open in IMG/M |
| 3300027880|Ga0209481_10117691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1294 | Open in IMG/M |
| 3300027880|Ga0209481_10189985 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1024 | Open in IMG/M |
| 3300027882|Ga0209590_10355534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 944 | Open in IMG/M |
| 3300027882|Ga0209590_10357672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 941 | Open in IMG/M |
| 3300027903|Ga0209488_10046763 | Not Available | 3182 | Open in IMG/M |
| 3300027903|Ga0209488_10158362 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300027907|Ga0207428_10067278 | All Organisms → cellular organisms → Bacteria | 2821 | Open in IMG/M |
| 3300027909|Ga0209382_10643962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1148 | Open in IMG/M |
| 3300028536|Ga0137415_10173077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1988 | Open in IMG/M |
| 3300028587|Ga0247828_10476345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 737 | Open in IMG/M |
| 3300028587|Ga0247828_11170279 | Not Available | 513 | Open in IMG/M |
| 3300028592|Ga0247822_11928906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 506 | Open in IMG/M |
| 3300028792|Ga0307504_10109648 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300030620|Ga0302046_10152040 | All Organisms → cellular organisms → Bacteria | 1899 | Open in IMG/M |
| 3300030903|Ga0308206_1025971 | Not Available | 1029 | Open in IMG/M |
| 3300030990|Ga0308178_1076840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 672 | Open in IMG/M |
| 3300031093|Ga0308197_10361415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
| 3300031093|Ga0308197_10387396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 543 | Open in IMG/M |
| 3300031094|Ga0308199_1002676 | Not Available | 2127 | Open in IMG/M |
| 3300031421|Ga0308194_10107877 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300031562|Ga0310886_10220260 | Not Available | 1046 | Open in IMG/M |
| 3300031744|Ga0306918_10521533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 931 | Open in IMG/M |
| 3300031781|Ga0318547_10147660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1380 | Open in IMG/M |
| 3300031847|Ga0310907_10520747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
| 3300031858|Ga0310892_10418722 | Not Available | 876 | Open in IMG/M |
| 3300031859|Ga0318527_10337408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300031890|Ga0306925_10598060 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1165 | Open in IMG/M |
| 3300031896|Ga0318551_10869821 | Not Available | 525 | Open in IMG/M |
| 3300031913|Ga0310891_10300471 | Not Available | 566 | Open in IMG/M |
| 3300031942|Ga0310916_11333164 | Not Available | 590 | Open in IMG/M |
| 3300031947|Ga0310909_10802055 | Not Available | 778 | Open in IMG/M |
| 3300031954|Ga0306926_12057574 | Not Available | 640 | Open in IMG/M |
| 3300031954|Ga0306926_12634836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 548 | Open in IMG/M |
| 3300032000|Ga0310903_10589698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 590 | Open in IMG/M |
| 3300032075|Ga0310890_10057145 | All Organisms → cellular organisms → Bacteria | 2264 | Open in IMG/M |
| 3300032076|Ga0306924_10080875 | All Organisms → cellular organisms → Bacteria | 3643 | Open in IMG/M |
| 3300032076|Ga0306924_11241754 | Not Available | 804 | Open in IMG/M |
| 3300032089|Ga0318525_10512362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 614 | Open in IMG/M |
| 3300032261|Ga0306920_104043167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
| 3300033289|Ga0310914_10662715 | Not Available | 938 | Open in IMG/M |
| 3300034668|Ga0314793_083509 | Not Available | 642 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.00% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.67% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.33% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.33% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.33% |
| Beach Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand | 0.33% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.33% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.33% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.33% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.33% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010109 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013762 | Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-J598 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022226 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022413 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1006837221 | 3300000364 | Soil | MRVKLQLVICNDPDQEETITDVITFNKNNQHIEHLGLTMA |
| JGI10216J12902_1136056132 | 3300000956 | Soil | MQCKLQLVICTDDGCEETVTDLVTLTKNCKRIEHLGLTLAEAKRVF* |
| JGI25406J46586_100498961 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MRVKLQLVISHDDGHEETVTDVITLTKHHQRIEHLGLSLAESKQLLGTLQRHILQQ |
| Ga0066398_101803571 | 3300004268 | Tropical Forest Soil | MRVKLQLVMCNDKSDEETVTDIITLNKNNQHIEHLGLSLAESKYLLGTLQR |
| Ga0063356_1004726631 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRVKLQLVLCNDDGCEETVTDIVSLKKHCHRIEHLGLTLAESKQLLKL |
| Ga0066395_100201992 | 3300004633 | Tropical Forest Soil | MRVKLQLVMCSDDGQEETITDIVTLQRDSQRIEHLGLTLREAKQLLNTLQKRLLQHQVDAFLDAS* |
| Ga0066395_107173752 | 3300004633 | Tropical Forest Soil | MRVKLQLVMCSDEGHEETVTDVITLDKNHRRIEHLGLTLAEAKQLLSTLQ |
| Ga0066680_101642301 | 3300005174 | Soil | MRGTLQLVMCNDKGDQETVTDVITLNKNKQRIEHLGLTLAESK |
| Ga0066676_101382422 | 3300005186 | Soil | MRVKLQLVMCNDQGDEETVTDVLTLNKHHQRIEHLGLTLAESKQLLSTALSSC* |
| Ga0065704_108083571 | 3300005289 | Switchgrass Rhizosphere | MRVKLQLVICHDEGQDETVTDVIALNKNQQRIEHLGLTLAE |
| Ga0065705_103959613 | 3300005294 | Switchgrass Rhizosphere | MRIKLQLILCNDQGDEETVTDVITLNKNNQRIEHLGLSLAESKQLLSTLQR |
| Ga0065707_107214402 | 3300005295 | Switchgrass Rhizosphere | MRVQLQLVVCHDDGYEETVTDIITLNKHNQHIEHLGLSLAESKQLLSALQRHLLHQ |
| Ga0066388_1003190533 | 3300005332 | Tropical Forest Soil | MRVKLQLVMCSDEGQEETVTDVITLKKNNQRIEQLGLTLAESK |
| Ga0066388_1008665453 | 3300005332 | Tropical Forest Soil | MRVKLQLVICHDDGQEETVTDVITLNKNNQRIEQLGLTLAESKQLLSIL* |
| Ga0066388_1009411271 | 3300005332 | Tropical Forest Soil | LRNNSTITDVITLNKNNKRIEHLGLTLSEAKQLLSTTQHHLLRQQ |
| Ga0066388_1022538581 | 3300005332 | Tropical Forest Soil | MRVTLQHVICHGDSQEETVTDIITLKKNNQCIEHLGLTLAESKQLLSTLQRH |
| Ga0066388_1033691131 | 3300005332 | Tropical Forest Soil | MRVKLQLVMCHDDGHEETITDVITLNKNNKRIEHLGLTLSEAKQLLSTTQHHLLRQQ |
| Ga0066388_1044790893 | 3300005332 | Tropical Forest Soil | MRVKLQLVLCNDDGREETVTDIVSLKKDCHRIEHLGLTLAESKQLLKRHCQLIENHDQTP |
| Ga0066388_1050929541 | 3300005332 | Tropical Forest Soil | MRVKLQLVMCNDKGDEETVTDIITLNKNHQRIEHLGLTLAESKQ |
| Ga0066388_1063466361 | 3300005332 | Tropical Forest Soil | CNDQGDEETVTDVITLNKNTQRIEHRGLTLAESKQLLSTLQRHLL* |
| Ga0066388_1087865601 | 3300005332 | Tropical Forest Soil | MCSDDGQEETITDIVTLQRDSQRIEHLGLTLREAKQLLNTLQKRLLQHQVDAFLDAS* |
| Ga0070687_1006958242 | 3300005343 | Switchgrass Rhizosphere | MRVKLQLVLCNDDGCEETVTDIVSLKKHCHRIEHLGLTLAESKQLLKLIQKTLLQQ |
| Ga0070700_1001880622 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVKLQLVMCSDDGRAETVTDLVTLQKDCQRIEQLGLTLKEAKQLLTT |
| Ga0070708_1002606812 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVKLQLVMCNDKGQEETVTDLITLNKDNQRIEHLGLTLAASKQLLRQCK* |
| Ga0070708_1007692311 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVKLQRVLWNDAGDEETVTDVITLNKNTQRIEPLGLTLSEATQLLSTPQR |
| Ga0070698_1001871183 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVKLQRVLWNDEGDEETVTDVITLNKNTQRIEPLGLTLSEATQLLSTPQRHLLGLNRG* |
| Ga0066697_103936882 | 3300005540 | Soil | MRVKLQRVMCHDEGDEETVTDVIILNKNHQRIEHLGLTLAESKHLLSTLQRHL |
| Ga0070693_1013592831 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVKLQLVMCNDEGDEETVTDVITLNKNNQRIEHLGLTLSEAKQLLSTTQRHLLR |
| Ga0066701_101195451 | 3300005552 | Soil | MRVKLQLVICHDEGHEETVTDVITLNKNHQRIEHLGLTLAESKQLLSTL* |
| Ga0066701_103686562 | 3300005552 | Soil | MHVKLQLVMCSDDGHEETITDLVTLQKDAQRIEHLGLTLREAKQ |
| Ga0066661_103246142 | 3300005554 | Soil | MRVKLQLVMCSDDGHEETVTDLVTLKKHSTRLEHLG |
| Ga0066707_106236631 | 3300005556 | Soil | MRVKLQLVMCSDDGQEETITDIVTLQKDAQRIEHLGLTLREAKQL |
| Ga0066698_100171771 | 3300005558 | Soil | MRVKLQLVLCNDEGDEETVTDVITLNKNNQRIEHLGLTLSEAKQLL |
| Ga0066708_107760742 | 3300005576 | Soil | MRVKLQLVMCSDAGQEETVTDVITLDKDNRRIEHLGLTLAEA |
| Ga0068857_1015201502 | 3300005577 | Corn Rhizosphere | MRVKLQLVMCSDDGQAETITDVVTLQKDAQSIEHLGLTLREAKQLLTTI |
| Ga0068859_1000712851 | 3300005617 | Switchgrass Rhizosphere | MRVKLQLVLCNDEGEEETVTDVFILNKHHQRIEHLG |
| Ga0066903_1018850871 | 3300005764 | Tropical Forest Soil | MRVKLQLVMYSEEGQEETVTDVITLNKNSQRIEHLGLTMAEAKQLLSALQRHLLQHQVDTFLD |
| Ga0066903_1031307663 | 3300005764 | Tropical Forest Soil | MRVTLQLVISHDDGHEETVTDIITLNKNNQCIEHLAG* |
| Ga0066903_1049186662 | 3300005764 | Tropical Forest Soil | MRVKLQLVMCNDKGDEETVTDVITLNKNHQRIEHLGL |
| Ga0066903_1055670062 | 3300005764 | Tropical Forest Soil | MRVKLQLVMCNDEGDEETVTDVITLNKNNQRIEHLGLTLSEAKQLLSTTQRH |
| Ga0066903_1062090132 | 3300005764 | Tropical Forest Soil | MRVKLQLVISHDDGHEETVTDVITLTKNHQHIEHLGLSLAES |
| Ga0066903_1062278341 | 3300005764 | Tropical Forest Soil | MRVKLQLVICHDDGHEETVTDVITLNKNNQRIEHLGV |
| Ga0081455_109560702 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRIKLQLVICHDDGHEATVTDVLTLNKNNQRIEQLGVCNLL* |
| Ga0075417_100121516 | 3300006049 | Populus Rhizosphere | TRTRRSPRMRVKLQLVMCSDEGDEETVTDVIILNKHHQRIEHLGLTLAESKHLLSTLFRG |
| Ga0075417_100229546 | 3300006049 | Populus Rhizosphere | MRVKLQLVMCNDQCAEEIVTDVITLDKNHRRIEHLGLTLAEAKQLLST |
| Ga0075417_104867972 | 3300006049 | Populus Rhizosphere | MRVKLQLVLCSDEGQEETVTEVITLNKNSQRIEHLGLTLAEA |
| Ga0075417_105125271 | 3300006049 | Populus Rhizosphere | MRVKLQLVMCSDDGQEETVTDMITLNKNSQRIEHLGLTLAGAKR* |
| Ga0075417_105850281 | 3300006049 | Populus Rhizosphere | MRVKLQLVMCNDVGDEETVTDVITLNNKHQRIEHLGLTLAESKH |
| Ga0075432_105963992 | 3300006058 | Populus Rhizosphere | MRVKLQLVMCNDEGEEETVTDVITLNKNNQRIEHLGLTLSEAKQLLSTTQRHLLRQ* |
| Ga0070716_1005925391 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVKLQLVMCNDKGDEETVTDVITLDKNHQRIEHSG* |
| Ga0075427_100127733 | 3300006194 | Populus Rhizosphere | MRVKLQLVICHDDGQEETVTDVITLNKNNKRIEHLGLSLAESKQLLST |
| Ga0066658_107309771 | 3300006794 | Soil | MRVKLPLVMCNDEGHEETVTDVITLNKNNQRIEHLGLPLLEAKQLLSTTQRHLLRQQVAACL |
| Ga0075428_1009562551 | 3300006844 | Populus Rhizosphere | MRVKLQLVLCSDEGQEETVTEVMTLNKNSQRIEHLG |
| Ga0075421_1018515702 | 3300006845 | Populus Rhizosphere | MRVKLQLVMCNDQGEEETVTDVITLNKHHQRIEHLGLTL |
| Ga0075421_1019083773 | 3300006845 | Populus Rhizosphere | MRVKLQLVMCSDDGREETVTDLVTLQKDAKRIEHLGLTLKEAKQLLTTIQKRLL |
| Ga0075430_1003692633 | 3300006846 | Populus Rhizosphere | MRVKLQLVMCSDDGREETVTDLVTLQKDAKRIEHLGLTLKE |
| Ga0075430_1007782012 | 3300006846 | Populus Rhizosphere | MRVKLQLVMCSDEGQEETVTDVITLNKNNERIEHLGLPQAEAKQLLNTLLPQ* |
| Ga0075430_1008085322 | 3300006846 | Populus Rhizosphere | MRVKLQLVISHDDGHEETVTDIITLNKNNQRIEHLGLSLAESKQLLSTLQRHLLQQQ |
| Ga0075431_1001512905 | 3300006847 | Populus Rhizosphere | MRLKLQLVMCNDQGEEETVTDVITLNKHHQRIEHLGLTL |
| Ga0075431_1005578723 | 3300006847 | Populus Rhizosphere | MRVKLQLVMCNDQGAEETVTDVITLDKNHRRIEHLGLTLAEAKQLLSTLQ |
| Ga0075420_1001258242 | 3300006853 | Populus Rhizosphere | MRVTLQLVVSHDDGHQETVTDVITLTKNHQRIEHLGLSLAESK |
| Ga0075420_1001318311 | 3300006853 | Populus Rhizosphere | MHVKLQLVMCSDDGQEEIITDLVTLQQDSQRIEHLGLTLREAKQLLNTVQQRLLQH |
| Ga0075420_1008289451 | 3300006853 | Populus Rhizosphere | MRVKLQLVVSHDDGHQETVTDVITLTKNHQRIEHLGLSLAESK |
| Ga0075424_1010595232 | 3300006904 | Populus Rhizosphere | MRVKLQLVICNDPDQEETITDVITFNKNNQRIEHLGLTMAEA |
| Ga0075424_1010912491 | 3300006904 | Populus Rhizosphere | LSDDGQEETVADSITLQKDAQRIEHLGLTLREAKQLLNTIQKHL |
| Ga0075419_110626422 | 3300006969 | Populus Rhizosphere | MRIKLQLIMCNDQGDEETVTDVITLNKNNQRIEHLGLVMFHRW* |
| Ga0099791_100977981 | 3300007255 | Vadose Zone Soil | RMRVKLQLVICSDEGHEETVTDVMTLNKNSQHIEHLGLTLAGDKELLSPLQ* |
| Ga0099791_106639011 | 3300007255 | Vadose Zone Soil | MHVKLQLVMCSDDGHEETITDLVTLQKDAQRIEHLGLTLREAKQLLNTVQQRL |
| Ga0099793_102951421 | 3300007258 | Vadose Zone Soil | MRVKLQLVMCSDDGREETVTDLVTLKKDSQRIEHLGLTLKEAKQLLTTIQKRLLQHQVD |
| Ga0099793_103734442 | 3300007258 | Vadose Zone Soil | MCHDDGQEETVTDVITLNKNHQRLEHLGLTLAESKQLL |
| Ga0099794_104364702 | 3300007265 | Vadose Zone Soil | MRVKLQLVICSDEGHEETVTDVMTLNKNSQRIEHLGLTLAGAKELLSTLQRQLLQHGRVPVSCG* |
| Ga0099794_106913382 | 3300007265 | Vadose Zone Soil | MRVKLQLVIYDDDGQEETVTDVVTLKKDHRRIEHLGLTLAEAKQLLN |
| Ga0066710_1002256143 | 3300009012 | Grasslands Soil | MHVKLQLVMCSDDGHEETITDLVTLQKDAQRIEHLGLTLREATQLLNTVQQ |
| Ga0066710_1035144851 | 3300009012 | Grasslands Soil | MRIKLQLIMCNDQGDEETVTDVITLNKNNQRIEHLGLTL |
| Ga0099829_117579922 | 3300009038 | Vadose Zone Soil | MRVKLQLIMCSDDGHEDTITDIVTLQKDSQRIEHLSLTI |
| Ga0099828_100530223 | 3300009089 | Vadose Zone Soil | MRVKLQLVMCNDQGDEETVTDVITLNKNHQRIEHLGLTLAEA |
| Ga0099828_115599651 | 3300009089 | Vadose Zone Soil | MRVKLQLVICHDEGHEETVTDVITLNKNHQRIEHLGLTLAESKQLLSTL |
| Ga0099827_110256031 | 3300009090 | Vadose Zone Soil | MRVKLQLVMCSDDGHENTITDLVTLQKDSQRIEHLGLT |
| Ga0099827_117542222 | 3300009090 | Vadose Zone Soil | RSPRMRVKLQLVMCNDEGDEETVTDVITLNKNNFL* |
| Ga0099827_117554241 | 3300009090 | Vadose Zone Soil | MRVKLQLVICNDEGHEETVTDVITLNKHNQHIEHLGLTLAESKQLLST |
| Ga0099827_119623872 | 3300009090 | Vadose Zone Soil | MRVKLQLVICHGDGQEETVTDVITLNKNHQRIEHLGLTLAES |
| Ga0075418_111624911 | 3300009100 | Populus Rhizosphere | MRVKLQRVMCSDEGQEETVTDVITLNKNNERIEHLGLPQAEAKQLLNTLLPQ* |
| Ga0075418_116990141 | 3300009100 | Populus Rhizosphere | MRVKLQLVICHDNGHEETVTDVITLNKNNQRIEHLGLSLAEAKQLLSTIQQHLL |
| Ga0066709_1018901772 | 3300009137 | Grasslands Soil | MRVKLQLVICSDDGHEETITDLITLQKDSQRIEHLGLTLREAK |
| Ga0099792_107903461 | 3300009143 | Vadose Zone Soil | MRVKLQRVICHDDGHEETVTDVITLNKNNKRLEHLGLSLAESKQLL |
| Ga0114129_100683602 | 3300009147 | Populus Rhizosphere | MRVKLQLVICHDDGHEETVTDVITLNKHNQRIEQLGLSLAESKQLLSTL* |
| Ga0114129_111642032 | 3300009147 | Populus Rhizosphere | MRLKLQLVMCNDQGDEETVTDVITLNKHHQRIEHLGLTL |
| Ga0114129_121204722 | 3300009147 | Populus Rhizosphere | MRVKLQLVLCSDEGQEETVTDVITLDKDNQRIEHLGLTLAEAKQLLS |
| Ga0114129_121509091 | 3300009147 | Populus Rhizosphere | MRVKLQLVMCGDDGCEETVTDLVTLKKDSTRIEHLGLS |
| Ga0114129_128663132 | 3300009147 | Populus Rhizosphere | MRVKLQLVLCHDEGHEETVTDVITLNKNHQRIEHLGLTLAESKQLLS |
| Ga0075423_100803184 | 3300009162 | Populus Rhizosphere | MRLKLQLVLCNDQGDEETVTDVITLNKHHQRIEHLGLTLAESKPLLSTL |
| Ga0075423_125306951 | 3300009162 | Populus Rhizosphere | MRLKLQLVMCNDQGDEETVTDVITLNKHHQRIEHLGLTLAESK |
| Ga0075423_130139751 | 3300009162 | Populus Rhizosphere | MRLKLQLVLCNDQGNEETVTDVITLNKHHQRIEHLGLTLAESKPLLSTLQ |
| Ga0105249_105386632 | 3300009553 | Switchgrass Rhizosphere | MRVKLQLVMCHDDGQEEIVTDVITLNKHNQCIEHLGLSLAESKQL |
| Ga0105340_10837733 | 3300009610 | Soil | MRVKLQLVMCNDTGDEETVTDVITLNKNNQRIEHLGLTL |
| Ga0105075_10649011 | 3300009799 | Groundwater Sand | MRVKLQLVLCSDEGHEETVTDVITLNKNSQRIEHLGLTLAEAKQLLST |
| Ga0105078_10291772 | 3300009823 | Groundwater Sand | MRVKLQLVMCNDEGHEETVTEVITLDKDNRRIEHLGLTLAES |
| Ga0105058_11656442 | 3300009837 | Groundwater Sand | MRVKLQLIRCSDAGQEETVTEAVTLKKDHQRLASLGLTLVGTLDVKTV |
| Ga0126380_100366992 | 3300010043 | Tropical Forest Soil | MRVKLQLVICHDDGHEETVTDVITLNKNNQRIEHLGFSLAESKQLLSTLQRHLLQ |
| Ga0126380_113866411 | 3300010043 | Tropical Forest Soil | MRVKLQLVVCHDDGYEETVTDIITLTKKNQRIEHLGLSLA |
| Ga0126380_115965311 | 3300010043 | Tropical Forest Soil | MRVKLQLVISHDDGHEETVTDIITLTKNNQRIEHLGLSLAESKQLLSTL |
| Ga0126384_101300363 | 3300010046 | Tropical Forest Soil | MRVKLQLVVCHDDGYEETVTDIITLKKNNQRIEHLGLSLAESKQ |
| Ga0126384_104662852 | 3300010046 | Tropical Forest Soil | MRVKLQLVMCNDKSDEETVTDIITLNKNNQHIEHLGLSLAESKYLLGTLQRQQGDAGANR |
| Ga0126384_106865812 | 3300010046 | Tropical Forest Soil | MRVKLQLVMCNDQGDEETVTDVIILNKNHQRIEHLG* |
| Ga0126384_111919351 | 3300010046 | Tropical Forest Soil | MRVKLQLVMCSDEGQEETVTDVITLDKDNQRIEHLGLT |
| Ga0126384_111926381 | 3300010046 | Tropical Forest Soil | MRVKLQLVLCSDEGQEETVTDVITLNKNNQRIEHLGLTMAEAKQLLSTLQQH |
| Ga0126384_122479382 | 3300010046 | Tropical Forest Soil | MRVKLQLVMCSDEGQEETVTDVITLNKNSQRIEHLGLTMAEAKQLLSTLQQHLL |
| Ga0126382_108572773 | 3300010047 | Tropical Forest Soil | MRVKLQLVICNDEGQEETVTDVIALNKNQQRIEHPGLTLAESK |
| Ga0126382_111999332 | 3300010047 | Tropical Forest Soil | MRVKLQLVICDDDGHEETVTDVVTLRKDAQRIEQLGLTLKEAKQLLNTIQRRLL |
| Ga0126382_123186311 | 3300010047 | Tropical Forest Soil | MRVKLQLVICNDDGQEETVTDVIALNKNQQRIEHLGLTLA |
| Ga0127497_11002082 | 3300010109 | Grasslands Soil | MRVKLQLVMCNDEGDEETVTDVITLNKNNQRIEHLGLTLSEAKQLLS |
| Ga0127456_10040743 | 3300010140 | Grasslands Soil | MCNDEGDEETVTDVITLNKNNQRIEHLGLTLSEAKQLLSTPQRHL |
| Ga0126370_101483872 | 3300010358 | Tropical Forest Soil | MRVKLQLVMCSDDGQEETITDIVTLQRDSQRIEHLDLTLREAKQLLNTLQKRLLQHQVDAFLDAS* |
| Ga0126370_108979921 | 3300010358 | Tropical Forest Soil | MRVTLQLVICHDDGHEETVIDVITLNKHNQRIEHLGVSLAESKQLLS |
| Ga0126370_119755411 | 3300010358 | Tropical Forest Soil | MRVKLQLVMCNDQGEEETVTDVRTLTKNQQRIEHLGLTLAESK |
| Ga0126370_120310971 | 3300010358 | Tropical Forest Soil | MRVKLQLVMCHDDGHEETITDVITLNKNNKRIEHLGLTLSEAKQ |
| Ga0126370_125736721 | 3300010358 | Tropical Forest Soil | MRLKLQLVLCNDQGEEETVTDVLTLNKHHQRIEHLGL |
| Ga0126376_100730916 | 3300010359 | Tropical Forest Soil | MRVKLQLVMCNDQGDEETVTAVIILNKHHQRIEHLGLTLAE |
| Ga0126376_103604961 | 3300010359 | Tropical Forest Soil | MRVTLQLVICHDDGQEETVTDVITLNKHNQRIEHLGVSLAE |
| Ga0126376_123092881 | 3300010359 | Tropical Forest Soil | MRVTLQLVICHDDGQEETVTDVIALNKNNQRIEHLGLGSVI* |
| Ga0126376_128612452 | 3300010359 | Tropical Forest Soil | MRVKLQLVLCSDEGQEETVTEVITLDKNHQRIEHLGLTLAEAKQLLS |
| Ga0126376_131570462 | 3300010359 | Tropical Forest Soil | MRVKLPLILCSDDGQEETVTDVVTLQKDSQRIEHLGLPLREAKQLLNTIQKRLLQ |
| Ga0126372_113593221 | 3300010360 | Tropical Forest Soil | MRVTLQLVICHDDGQEETVTDVITLNKHNQRIEPLGVS |
| Ga0126372_121891832 | 3300010360 | Tropical Forest Soil | MRVKLQLVICHDDGHEETVTDVITLNKNPQRIEHLGLTMAESKHLLSTLQRH |
| Ga0126377_108122551 | 3300010362 | Tropical Forest Soil | MRVKLQLVMCSDDGREETVTDLVTLQKDSQRIEHLGLTLKEAKQLLTTIQKRL |
| Ga0126377_120041151 | 3300010362 | Tropical Forest Soil | MRVQLQLVICHDQGQEETVTDVITLNKNHQRIEHLG |
| Ga0126377_128127562 | 3300010362 | Tropical Forest Soil | MRVKLQLVICNDEGHEEIVTDVITLNKNNHRIEHLGLSLAEAKRLLSALQRHLLQQ |
| Ga0126377_135432761 | 3300010362 | Tropical Forest Soil | MRVKLQLVMCSDEGHEETVTDVITLDKNHRRIEHLG |
| Ga0126379_112804971 | 3300010366 | Tropical Forest Soil | MRVKLQLVMCSDAGQEETVTDVITLDKDNRRIEHLGL |
| Ga0126379_116336743 | 3300010366 | Tropical Forest Soil | MRVTLQLVVSHDDGHQETVTDVITLTKNHQRIEHLGLSLAESKQL |
| Ga0126379_116482542 | 3300010366 | Tropical Forest Soil | MRVKLQLVICHDDGHEETVTDVITLNKNHQRIEHLGLTLAE |
| Ga0126379_122637821 | 3300010366 | Tropical Forest Soil | MRVKLQIVLCSDDGREETVTDVVTLQKDSRRIEHL |
| Ga0126379_132591051 | 3300010366 | Tropical Forest Soil | MHVKLQLVICHDDGHEETVIDVIILNKNSQRIEHLGVS |
| Ga0126383_100901201 | 3300010398 | Tropical Forest Soil | MRIKLQLVICHDDGHEETVTDVITLNKNNQRIEHLG |
| Ga0126383_101021791 | 3300010398 | Tropical Forest Soil | MRDKLQLVMCSDEGHEETVTDVITLNKNNVSGHRH* |
| Ga0126383_103266951 | 3300010398 | Tropical Forest Soil | MRVKLQLVLCDDDGQEETVTDIVTLKKDHRRLEHLGLMLQEAKQLLNTIQKRLLQRQVDAFLEAC |
| Ga0126383_104995142 | 3300010398 | Tropical Forest Soil | MRVKLQLVICHDDGHEETVTDVVTLDKNNHRIEHLGLSLAESKQ |
| Ga0126383_110892351 | 3300010398 | Tropical Forest Soil | MRVKLQLVICHDEGHEETVTDVIILNKNHQRIEHLGLTLAESKQLLSTLQ |
| Ga0126383_115854072 | 3300010398 | Tropical Forest Soil | MRVKLQLVMYSDAGQEETVTDVITLDKNNQRIEHLGLTLAEAKQL |
| Ga0134127_124971201 | 3300010399 | Terrestrial Soil | MRVKLQLVMCSDDGQEEIITDIVTLKKDAQRIEHLGLTLKEAKQL |
| Ga0138513_1000491972 | 3300011000 | Soil | MRIKLQLIMCSDYGQEETVTDLVTLQKDFQRSEHLGLTLQEAKQLLNAI* |
| Ga0105246_101928234 | 3300011119 | Miscanthus Rhizosphere | MRVKLQLVICHDDGQEETVTNVFTLTKNNQRIEHLGLTLAES |
| Ga0137392_100893291 | 3300011269 | Vadose Zone Soil | MRVKLQLVMCNDQGDEETVTDLITLNKNNQRIEHLGLTLAESKHL |
| Ga0137391_106532021 | 3300011270 | Vadose Zone Soil | MRVKLQLVICHDDGHEETVTDVITLNKHNQRIEHLGLSLAESKQLL |
| Ga0137393_104607152 | 3300011271 | Vadose Zone Soil | MRVKLQLVICHDDGHEETVTDVITLNKNNKRLDHLGL |
| Ga0137388_110421421 | 3300012189 | Vadose Zone Soil | MRVKLQLVICHDDGHEETVTDVITLNKNHQRIEHLGLSLAESKQL |
| Ga0137383_103795794 | 3300012199 | Vadose Zone Soil | MRVKLQLVMCSDEGQEETVTDVITLDKNHRRIEHLGLTLA |
| Ga0137363_102277952 | 3300012202 | Vadose Zone Soil | MRVKLQLVLCSDAGQEETVTEVITLNKNNNEPVKG* |
| Ga0137363_103708721 | 3300012202 | Vadose Zone Soil | MRVKIQLVMCSDEGHEETVTDVITLDKDHRRIEHLGLTL |
| Ga0137399_101718751 | 3300012203 | Vadose Zone Soil | MRVKLQLVMCGDDGCEETVTDLVTLKKDSTRIEHLGLSLKEAKQLLNTIQKVSVIKIVI* |
| Ga0137374_102066792 | 3300012204 | Vadose Zone Soil | MRLKLQLVMCNDQGDEETVTDVLTLNKHHQRIEHLGLTLAES |
| Ga0137380_102977683 | 3300012206 | Vadose Zone Soil | MRIKLQLVMCSDDGQEETITDLVTLQKDSQRIEHLGLTLREAKQLLNTTQKRMLQH |
| Ga0137381_107395483 | 3300012207 | Vadose Zone Soil | MRVKLQRIMCSDDGHADTITDIVTLQKDSQRIEHLSLTIREAKQLLNTIHSIL |
| Ga0137381_111134752 | 3300012207 | Vadose Zone Soil | MRVKLQLVMCSDDGHEETVTDIVTLKKDCQRIEHLGLTLKEAKQLLKTTQQR |
| Ga0137381_112049902 | 3300012207 | Vadose Zone Soil | MRLKLQLVPCHDQGDEETVTDVITLNKNTQRIEHLGLTLSEA |
| Ga0137381_115455952 | 3300012207 | Vadose Zone Soil | MRIKLQLVMCSDDGQEETITDLVTLQKDSQRIEHLGLTLREAKQLLNTIQKRLLHH |
| Ga0137376_114029801 | 3300012208 | Vadose Zone Soil | MYCKIQLVMCTDDGREETVTDVLTLTKDSQRIEHLGLTLA |
| Ga0137379_102958413 | 3300012209 | Vadose Zone Soil | MCHDEGDEETVTDVITLNKNTQRIEHLGLTLSEATQLLSTPQRHL |
| Ga0137379_114653941 | 3300012209 | Vadose Zone Soil | MRVKLQLTICHDDGHEETVTDVITLNKNNQRIEHLGLS |
| Ga0137379_116939732 | 3300012209 | Vadose Zone Soil | MRVKLQLVMCSDDGREETVTDIVTLKKHSTRLEHLGLSLKEAKQLLTTIQHR |
| Ga0137378_103220881 | 3300012210 | Vadose Zone Soil | MCNDEGDEETVTDVITLNKNNQRIEHLGLTLSEAKQLLSTTQRHLLR |
| Ga0137378_112104831 | 3300012210 | Vadose Zone Soil | MRVKLQLVICDDDGQEETITDLVTLQKDSQRIEHLGLTLREAKQLLNTIQ |
| Ga0137377_101907412 | 3300012211 | Vadose Zone Soil | MYVKLQLVMCNDEGQEETVTDVITLNKNSQRIEHLGLTLAEAKQLLSTL* |
| Ga0137377_109177651 | 3300012211 | Vadose Zone Soil | MRVKLQLVMCNDEGDEETVTDVITLNKNNQRIEHLGLTLSEAKQLLSTTQ |
| Ga0150985_1106706881 | 3300012212 | Avena Fatua Rhizosphere | MRVKLQLVMCSDDGQEETVTDLVTLQKDAQRIEHLGLTLREAKQLLNTLQKHLL* |
| Ga0137387_102380283 | 3300012349 | Vadose Zone Soil | MRVKLQLVMCHDDGQEETVTDVITLNKNHQRLEHLGLTL |
| Ga0137386_109648211 | 3300012351 | Vadose Zone Soil | MCNDQGDEETVTDVITLNKNNQYIEHLGLTLAESKQLLSILQR |
| Ga0137371_101918673 | 3300012356 | Vadose Zone Soil | MHVKLQLVMCNDEGQEETVTDVITLDKNSRRIEHLGLTLA |
| Ga0137384_108187391 | 3300012357 | Vadose Zone Soil | MRVKLQLIMCNDQGHEETVTDVITLNKNHQRIEHLGLTLA |
| Ga0137385_107011403 | 3300012359 | Vadose Zone Soil | MRVKLQLVICHDEGHEETVTDVITLNKNHQRIEHLGLTLAESK |
| Ga0137385_108221081 | 3300012359 | Vadose Zone Soil | MRVKLQLVMCSDDGHEETVTDIVTLKKDCQRIEHLGLTLKEAKQL |
| Ga0137385_109372631 | 3300012359 | Vadose Zone Soil | MRVKLQLVMCSDDGREETVTDLVTLQKDSTRPAHLGLSLKAAKQL |
| Ga0137385_112273311 | 3300012359 | Vadose Zone Soil | MRLKLQLVMCSDDGQEETLTDLVTLQKDAQRIAHLGLTLRE |
| Ga0137375_103515494 | 3300012360 | Vadose Zone Soil | MRVKLQLVICHDDGQEETVTDVIALNKNNQRIEHLGLSLAESKQ |
| Ga0137360_102869921 | 3300012361 | Vadose Zone Soil | MRVKLQLVLCNDEGDEETVTDVITLNKNNQRIEHLGLTLS |
| Ga0137360_106532513 | 3300012361 | Vadose Zone Soil | MRVKLQLVICNDEGQEETVTDVIVLNKNHQRIEHLGLTLAESKQLLST |
| Ga0137360_108565491 | 3300012361 | Vadose Zone Soil | MRVKLQLVMCSDDGHEETITDLVTLQKDSQRIEHL |
| Ga0137360_109139151 | 3300012361 | Vadose Zone Soil | MRVKVQLVMCSDDGQEETITDLVTLQKDSQRIEHLGLT |
| Ga0137360_110893703 | 3300012361 | Vadose Zone Soil | MRVKLQLVMCSDAGQEETITDLVTLQKDAQRIEHLGLTLREAKQLLNTLQQCLLQ |
| Ga0137361_100768371 | 3300012362 | Vadose Zone Soil | MRVKLQLVIGNDEGHEETVTDVITLNKNNQRIEHLGLT |
| Ga0137361_101319193 | 3300012362 | Vadose Zone Soil | MHVKLQLVMCSDDGHEETITDLVTLQKDAQRIEHLGLTLRVLPVA* |
| Ga0137361_110333741 | 3300012362 | Vadose Zone Soil | MCNDEGDEETVTDVITLNKNTQRIEHLGLTLSEAKQLLSTPQRHLLRQQVDAF |
| Ga0137361_112701762 | 3300012362 | Vadose Zone Soil | MRVKLQLVICHDDGHEETVTDVITLNKNNQRIEQLGLTLAASKQLLSILQRHVLQQQITGLSQKPPLSQLTG* |
| Ga0137361_112879871 | 3300012362 | Vadose Zone Soil | MRLDILAIRGQEETVTDVITLDKNHRRIEHLGLTLAEAKQLLSTLQRH |
| Ga0137390_101661901 | 3300012363 | Vadose Zone Soil | MRVKLQLVMCSDEGHEETVTDVMTLNKNSHRIEHLGLTMAEAKQLLSTLQQHLLQ |
| Ga0137390_102415563 | 3300012363 | Vadose Zone Soil | MRVKLQLVMCSDEDHEETVTDVMTLNKNSQRIEHLGLTLAEAKQ |
| Ga0137390_108910822 | 3300012363 | Vadose Zone Soil | MRVKLQLVMCSDDGQEETVTDIVTLQKDSQRIEHLGLTLRE |
| Ga0134060_13443131 | 3300012410 | Grasslands Soil | MRVKLQLVMCSDEDHEETVTDVMTLNKNSQRIEHLGLTLAEAKQLLKHAPSRPLM* |
| Ga0157346_10284942 | 3300012480 | Arabidopsis Rhizosphere | MRVKLQLVISHDEGHEETVTDVITLNKNHQRIEHLGLTLAESKQ |
| Ga0137398_111606081 | 3300012683 | Vadose Zone Soil | MRVKLQLVMCGDDGCEETVTDLVTLKKDSTRIEHLGLSLKEAKQLLNTAQKVSVIKIVI* |
| Ga0137397_113221581 | 3300012685 | Vadose Zone Soil | MRVTLQLVMCSDEGQEEIVTDVITLNKNSQRIEHLGLTLAEA |
| Ga0137395_100752985 | 3300012917 | Vadose Zone Soil | MRVKLQLVICHDDGHEETVTDVITLNKHNQRIEHLGLSLAESKQLLSTLQRHLL |
| Ga0137394_100542011 | 3300012922 | Vadose Zone Soil | MRLKLQLVMCNDQGDEETVTDVITLNKHHQRIEHLGLT |
| Ga0137394_101776701 | 3300012922 | Vadose Zone Soil | MRVKLQLVMCSDEGHEETVTDVITLNKNSQRIAHLGLTLG |
| Ga0137394_102080722 | 3300012922 | Vadose Zone Soil | MRVKLQLVICSDEGHEETVTDVMTLNKNSQRIEHLGLTLAGAKELLSTLQRQLLQHGRVSVSCG* |
| Ga0137394_109088531 | 3300012922 | Vadose Zone Soil | MRVKLQLVLCSDEGHEETVTDVITLDKDHRRIEHLGLTLAEAKQVLST |
| Ga0137419_112526013 | 3300012925 | Vadose Zone Soil | MRVKLQLVICHDDGHEETVTDVITLNKHNQRIEHLGLSLAES |
| Ga0137416_100372171 | 3300012927 | Vadose Zone Soil | MCSDDGQEETVTDLVTLQKDAQRIEHLGLTLREAKQPLNTLQKHLLQHQ |
| Ga0137404_118658592 | 3300012929 | Vadose Zone Soil | MRVKLQLVMCNDEGDEETVTDVITFNKHNHRIEHLGLSLAES |
| Ga0137407_110250021 | 3300012930 | Vadose Zone Soil | MRVKLQLIIGNDEGHEETVTDVITLNKNNQRIEHLGL |
| Ga0137407_115526652 | 3300012930 | Vadose Zone Soil | MRVKLQLVLCNDEGDEETVTDVITLNKNNPRIEHLGLTLSEA |
| Ga0137407_123279112 | 3300012930 | Vadose Zone Soil | MRVKLQLVMCSDEGQEETVTDVITLNKNHQRIEHLGLTLAEAKQLLSALQRH |
| Ga0137410_100285443 | 3300012944 | Vadose Zone Soil | MRIKLQLVMCSDDGQAETITDLVTLQKDAQHIEHLGLTLREAKQLLNTLQKRLLQH |
| Ga0137410_102626993 | 3300012944 | Vadose Zone Soil | MCNDKGEEETVTDLITFNKNHQRIEHLGLTLAESTQLLSTLQWHLLQQQVTT |
| Ga0137410_108943052 | 3300012944 | Vadose Zone Soil | MRVKLQLVMCNDQGDEETVTDVITLNKNHQRIEHLGLTLAESKQL |
| Ga0137410_118336031 | 3300012944 | Vadose Zone Soil | MRVKLQLVICSDDGHEETGTDIVTLEKDFQRIAHLSLTLSEAKQLLNTLQKH |
| Ga0126375_100746782 | 3300012948 | Tropical Forest Soil | MRVKLQLVICHDDDHEETVTDVITLTKNNQRIEPPLRKG* |
| Ga0164303_112418301 | 3300012957 | Soil | MHVKLQLVICHDDGYEETVTDVITLDKHNQRIEHLGLSLAESKQLLSTLQRHLLQQQ |
| Ga0126369_103912671 | 3300012971 | Tropical Forest Soil | MRVTLQLVISHDDGHEEIVTDVITLAKNNQRIEHLGLSLAESKYLLGALQRHLPLQRHLSAMERF* |
| Ga0126369_114318241 | 3300012971 | Tropical Forest Soil | MRVKLQLVICNDEGHEETVTDVITLNKNNRRIEHLGLT |
| Ga0134077_101441183 | 3300012972 | Grasslands Soil | MCHDEGDEETVTDVITLNKNNQRIEHLGLTLSEAKQLLSTTQR |
| Ga0163162_104322122 | 3300013306 | Switchgrass Rhizosphere | MRVQLQLVVCHDDGYEETVTDIITLNKHNQRIEHLGLSLAES |
| Ga0163162_112005792 | 3300013306 | Switchgrass Rhizosphere | MRVTLQLVMCNDQGDEETVTDVITLNKRHQRIEHLGLTLAECKHLLSTVRSKYVVGLT* |
| Ga0163162_123025823 | 3300013306 | Switchgrass Rhizosphere | MRVKLQLVMCNDEGYEETVTDVITLNKNNQRIEHLGL |
| Ga0116693_10318032 | 3300013762 | Beach Sand | MRVKLQLVISHDDGHEETITDVITLNKNHKRIEHLGLSLAESKQLLSTVSPGSSGR* |
| Ga0137409_103934332 | 3300015245 | Vadose Zone Soil | MCVKLQLVICNDKGQEETVTDLITLNKDNQRIEHLGLTMAESKHLLSTLQQHLLQQQ |
| Ga0137409_108173102 | 3300015245 | Vadose Zone Soil | MRVKLQLVRCSDAGQEETVTDVITLDKDNRRIEHLGLT |
| Ga0137403_115396781 | 3300015264 | Vadose Zone Soil | MRVKLQLVMCSDEGQEETVTDVMTLNENSQRIEHLGLTMAEAK* |
| Ga0182036_101568873 | 3300016270 | Soil | MRVNLQLVMCSDEGHEETVTDVITLDKNHRRIEHLGLTLAEAKQLLSTLQRHLL |
| Ga0182036_105614862 | 3300016270 | Soil | MRVTLQLIICHDDGHEETATDVITLNKNHKRIEHLGLSLAES |
| Ga0182033_114181992 | 3300016319 | Soil | MRVKLQLVICHDEGHAETVTDVITLNKHHQRVEHLGLTLAESKQLLVVFSIWRWPF |
| Ga0182035_119101152 | 3300016341 | Soil | MRVKLQLVICHDDGQEETVTDVITLNKHNQRIEHLGLSLAESKQL |
| Ga0182032_103648871 | 3300016357 | Soil | MRIKLQLVMCHDDGQEETVTDVITLTKNPQRIEHLGLTMAETKQ |
| Ga0163161_110303821 | 3300017792 | Switchgrass Rhizosphere | MCSDDGQEETITDIVTLQKDSQRSEHLGLTVKEAKQLLNTIQQRLLRHQV |
| Ga0184637_105872022 | 3300018063 | Groundwater Sediment | MRVKLQLVMCSDDGHEDTITDLVTLQKDSQRIEHLGLTLREAKQLLDTI |
| Ga0190275_100829762 | 3300018432 | Soil | MRVKLQLVMCSDAGQEETVTDVITLDKNYRRIEHLGLTLAEAKQLLSTLQRHLL |
| Ga0190275_126303932 | 3300018432 | Soil | MRVKLQLIICQEDGHEETITDVITLTKNNQRLEHLGLFLAESKQLLSTI |
| Ga0190268_104454711 | 3300018466 | Soil | MHVKLQLVICHGDGHEETVTDIITLRKNNQRIEHLGLTLAESKQ |
| Ga0184642_14551451 | 3300019279 | Groundwater Sediment | MRIKLQLILCTEQSDEETVTDVLTLNKNHRRIEPLGLSLA |
| Ga0137408_14038584 | 3300019789 | Vadose Zone Soil | MRVTLQLVICHDDGQEETVTDVITLNKNNHRIEHLG |
| Ga0126371_123717482 | 3300021560 | Tropical Forest Soil | MRVKLQLVMCHDDGHEETITDVITLNKNNKRIEHLGLTLSEAKHLLSTTQHHLLRQQV |
| Ga0126371_134137402 | 3300021560 | Tropical Forest Soil | MRVKLQLVLCGDDGREETVTDLITLKKDSQRIEQLGLTLGLFAQSPQKA |
| Ga0126371_136110301 | 3300021560 | Tropical Forest Soil | MRVKLQLVICHGDSQEETVTDIITLKKNNQCIEHLGLTL |
| Ga0224512_105664782 | 3300022226 | Sediment | MRVKLQLVMCSDDGREQTVTDIVTLKKNPTASSISA |
| Ga0224508_101182601 | 3300022413 | Sediment | MRVKLQLVLCSDDGREETVTDIVAWNKDYHRTEHLGLALAESKQLLYDDVKSVKLH |
| Ga0247796_10030591 | 3300023261 | Soil | MRVKLQLVLCNDDGCEETVTDIVSLKKHCHRIEHLGLTL |
| Ga0207643_100250675 | 3300025908 | Miscanthus Rhizosphere | MRVKLQLVMCSDEGQEETVTDVSMLNKNSQRIEHLGLTLAEAKQLLDMLRSP |
| Ga0207706_104798874 | 3300025933 | Corn Rhizosphere | MRVKLQLVICHDDGQEETVTDVITLNKNNKRIEHLGLSLAESKHLLS |
| Ga0207670_115298061 | 3300025936 | Switchgrass Rhizosphere | MRVQLQLVICHDDGHEETVTDVFTLNKHHQRIEHLGLSLAE |
| Ga0207665_116990191 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVKLQLVMCSDAGQEETVTDVITLDKDNRRIEHLGLTLAEAQQLLSP |
| Ga0207712_103265911 | 3300025961 | Switchgrass Rhizosphere | MRVKLQLVICDDDGHEETVTDIVTLRKDAQRIEHLGL |
| Ga0207668_106017681 | 3300025972 | Switchgrass Rhizosphere | MRVKLQLVMCSDAGQEETVTDVITLDKNRRRIEHLGLTLAEA |
| Ga0207703_115290501 | 3300026035 | Switchgrass Rhizosphere | MRVTLQLVICNDKDQEKTVTDVITFNKNTQRIEHLGLTLTESKQLLSTLQRQLLQQQ |
| Ga0209235_11807181 | 3300026296 | Grasslands Soil | MRVKLQLVMCHDDGQEETVTDVITLNKNHQRLEHL |
| Ga0209802_12478041 | 3300026328 | Soil | MRVKLQLVICSDDGHEETITDLITLQKDSQRIEHL |
| Ga0209056_106563742 | 3300026538 | Soil | MRVKLQLVLCHDEGDEETVTDVITLNKNNQRIEHLGLTLSEAKQLLSTPQRHLLRQ |
| Ga0209805_14007062 | 3300026542 | Soil | MRVKLQLVISHDDGHEETVTDVITLTKNHQRIEHLGLSLAESKHLLGTLQ |
| Ga0209003_10903142 | 3300027576 | Forest Soil | MRLKLQLVLCNDQGNEETVTDVITLNKHHQRIEHLGLTLAESKPLPLNL |
| Ga0209799_11583011 | 3300027654 | Tropical Forest Soil | MRVKLQLVISHDDGHEETVTDIITLNKNNQRIEHLGLSLAESKQLLSTL |
| Ga0208981_11717631 | 3300027669 | Forest Soil | MRVKLQLVMCGDDGCEETVTDLVTLKKDSTRIEHLGLSLKEAKQLLNTIQKVSVIKIVIWSMW |
| Ga0209689_14049212 | 3300027748 | Soil | MRVKLQLVISHDDGHEETVTDVITLTKNHQRIEHLGLSLAESKQLLGTLQRHI |
| Ga0209180_106792952 | 3300027846 | Vadose Zone Soil | MHVKLQLVMCGDDGQEETITDIITLQKDSQHIEHLGLTLREAKQLLNTLQQHLLQRQVEGFLEASST |
| Ga0209701_101054191 | 3300027862 | Vadose Zone Soil | MRVKLQLVMCSDDGHEATITDIVTLQKDSQRIEHLGLT |
| Ga0209814_100916792 | 3300027873 | Populus Rhizosphere | MRLKLQLVLCNDKGEEETVTDVITLNKNHQRIEHLGLTLAESKQLLS |
| Ga0209814_102693442 | 3300027873 | Populus Rhizosphere | MRVKLQLVMCNDQGDEETVTDVITLNKNNQRIEHLG |
| Ga0209814_105710831 | 3300027873 | Populus Rhizosphere | MRVKLQLVICSDEGQEETITDVITLDKDHRRIEHLG |
| Ga0209465_100284762 | 3300027874 | Tropical Forest Soil | MRVKLQLVMCSDDGQEETITDIVTLQRDSQRIEHLGLTLREAKQLLNTLQKRLLQHQVDAFLDAS |
| Ga0209465_102768803 | 3300027874 | Tropical Forest Soil | MRVTLQLVISHDDGHEEIVTDVITLAKNNQRIEHLGLSLAES |
| Ga0209481_101176911 | 3300027880 | Populus Rhizosphere | MRVKLQLVMCNDEGHEETVTDVITLNKNNQRIEHLGLTLSEAKQLLSTTQRHLL |
| Ga0209481_101899852 | 3300027880 | Populus Rhizosphere | MRVKLQLVMCSDEGQEETVTDVITLDKNHRRIEHLGLTLAEAKQLL |
| Ga0209590_103555342 | 3300027882 | Vadose Zone Soil | MRVKLQLVMCSDDGQEDTITDVVTLRKDAQRIEHLGLTLREATQLLNTL |
| Ga0209590_103576722 | 3300027882 | Vadose Zone Soil | MHVKLQLVMCGDDGQEETITDIITLQKDSQHIEHLG |
| Ga0209488_100467631 | 3300027903 | Vadose Zone Soil | MRVKLQLVMCNDEGDEETVTDVITLNKNTQRIEHL |
| Ga0209488_101583621 | 3300027903 | Vadose Zone Soil | MRLKLQLVLCNDKGDEETVTDVITLNKNHQRIEHLGLTLAES |
| Ga0207428_100672781 | 3300027907 | Populus Rhizosphere | MRLKLQLVLCNDQGNEETVTDVITLNKHHQRIEHLGLTLAESKPLLS |
| Ga0209382_106439622 | 3300027909 | Populus Rhizosphere | MRVKLQLVMCSDEGDEETVTDVIILNKHHQRIEHLGLTLAESKHLLSTLFRG |
| Ga0137415_101730773 | 3300028536 | Vadose Zone Soil | MRIKLQLVMCSDDGQAETITDLVTLQKDAQRIEHLGLTLREAK |
| Ga0247828_104763451 | 3300028587 | Soil | MRVKPPLVLCTDDGCEETVTDVITLQKDHQRIEHLGLTL |
| Ga0247828_111702791 | 3300028587 | Soil | MRVKLQLVICHDDGHEETVTDVITLNKNHRRIEHLGLTLAESKQLLST |
| Ga0247822_119289062 | 3300028592 | Soil | MRVKLQLVISYDDGHEETVTDVITLNKHNQRIEHLGLSLAESKQLLSTL |
| Ga0307504_101096481 | 3300028792 | Soil | MRVKLQLVMCSDAGQEETVTDVITLNKNNQRIEHLGLTLAEAK |
| Ga0302046_101520401 | 3300030620 | Soil | MRVKLQLVICHDDGHEETVTDVITLNKNNQRIEHLGLSL |
| Ga0308206_10259713 | 3300030903 | Soil | MHVKLQLVMCSDDAQEDTITDLATLQKDAQYTEHLGLTLREAK |
| Ga0308178_10768402 | 3300030990 | Soil | MRVKLQLVMCNDAGDEETVTDVITFNKHNQRIEHLGLSLGC |
| Ga0308197_103614151 | 3300031093 | Soil | MRVKLQLVMCNDEGHEETVTDVITLNKNNQRIEHLGLTLSEAKQLLSTTQRHLLRQQVDA |
| Ga0308197_103873961 | 3300031093 | Soil | MRVKLQLVLCSDDGCEETVTDIVTLRKDSQHIEHLGLTLVEAK |
| Ga0308199_10026763 | 3300031094 | Soil | MRVKLQLVICSDDGQEETITDVITLQKDSQRIEHLGLTLREAKQLLNTLQKHLLQPTLSN |
| Ga0308194_101078772 | 3300031421 | Soil | MRVKLQLVMCSDEGHEETITDVITLDKNNRRIDHLGLTLAEAKQLLSPLQRHLLQ |
| Ga0310886_102202601 | 3300031562 | Soil | VRVKLQLVLRTDDGCEETVTDIVTRQKDSQRIEYLGLT |
| Ga0306918_105215333 | 3300031744 | Soil | MRVKLQLVICHDEGHAETVTDVITLNKHHQRVEHLGLTLAESKQLLVVFSIWRW |
| Ga0318494_108837512 | 3300031751 | Soil | MRVKLQLVICHDDGHEETVTDVITLNKHHQRIEHLGVSLAESKQLLRPLLRPLLQQHVTTFLDTH |
| Ga0318547_101476601 | 3300031781 | Soil | MRVKLQLVVCHDDGYEETVTDIITLTKNNQRIEHLGVSLAEST |
| Ga0310907_105207471 | 3300031847 | Soil | MRIKLQLVMCSDDGQEETITDVVTLQKDSQRIEHLGLTLREAK |
| Ga0310892_104187221 | 3300031858 | Soil | VRVKLQLVLCTDDGCEETVTDIVTRQKDSQRIEYLGLTLAEAKQLLTTIQQ |
| Ga0318527_103374082 | 3300031859 | Soil | MRVTLQLVVSHDDGHQETVTDVITLTKNHQHIEHLG |
| Ga0306925_105980601 | 3300031890 | Soil | MRVKLQLVMCNDQGDEETVSDVITLNKNHQRIEHLGLTLAES |
| Ga0318551_108698212 | 3300031896 | Soil | MRVKLQLVLYSDDGQEQTVTDVVTLPKDCQRIKHLGLTL |
| Ga0310891_103004712 | 3300031913 | Soil | MRVTLQLVMCNDQGDAETVTDVITLNKNHQRIEHLGLTLVEA |
| Ga0310916_113331641 | 3300031942 | Soil | MRVKLQLVMCNDQDEEETVTDVITLNKNNQRIEHLG |
| Ga0310909_108020551 | 3300031947 | Soil | MRVKLQLVVCHDDGYEETVTDIITLTKNNQRIEHLGVSLAESTQLLSALQRHL |
| Ga0306926_120575741 | 3300031954 | Soil | MRVKLQLVICHHDGHEETVTDVITLNKQNERIEHLGVSLAESKQLLSCVAQKYYPSL |
| Ga0306926_126348361 | 3300031954 | Soil | MRVKLQLVICHDEGHEETVTDVITLNKNTQRIEHLGLSLAESKQLLGTLQ |
| Ga0310903_105896981 | 3300032000 | Soil | MRVKLQLVVSHDDGHQETVTDVITLTKNHQRIEHLGLSLAESKQLLGTLQRHILQ |
| Ga0310890_100571452 | 3300032075 | Soil | MRVKLQLVLCTDDGCEETVTDVITLQKDHQRIEHLGLTLAEAKQLLTTI |
| Ga0306924_100808753 | 3300032076 | Soil | MRVKLQLVMCSDEGHEETVTDVITLNKNNVSGHRH |
| Ga0306924_112417542 | 3300032076 | Soil | MRVKLQLVMCSDEGQEETVTDVITLDKNHRRIEHLGLTLAVVLHR |
| Ga0318525_105123622 | 3300032089 | Soil | MRVKLQLVVCHDDGYEETVTDIITLTKNNQRIEHLGVSLAESTQLLSALQRHLLQQ |
| Ga0306920_1040431672 | 3300032261 | Soil | MRVKLQLVMCSDEGQEETITDVITLNKNSQRIEHLGLTLAEAKQLLST |
| Ga0310914_106627152 | 3300033289 | Soil | MRVKLQLVICHHDGHEETVTDVITLNKQNERIEHLGVS |
| Ga0314793_083509_1_156 | 3300034668 | Soil | MRVKLQLALCTDDGCEETVTDIVTRQKDSQRIEYLGLTLAAAKQLLTTIQQC |
| ⦗Top⦘ |