Basic Information | |
---|---|
Family ID | F010554 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 302 |
Average Sequence Length | 44 residues |
Representative Sequence | GVICLSYGVYGWAAFFLVLAALNLAGGYWYLTIARSASARA |
Number of Associated Samples | 220 |
Number of Associated Scaffolds | 302 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.67 % |
% of genes near scaffold ends (potentially truncated) | 91.39 % |
% of genes from short scaffolds (< 2000 bps) | 91.72 % |
Associated GOLD sequencing projects | 206 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (55.960 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.848 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.517 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.629 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 302 Family Scaffolds |
---|---|---|
PF12802 | MarR_2 | 3.97 |
PF00106 | adh_short | 2.98 |
PF00571 | CBS | 2.65 |
PF10706 | Aminoglyc_resit | 2.32 |
PF00196 | GerE | 2.32 |
PF08044 | DUF1707 | 1.66 |
PF13360 | PQQ_2 | 1.66 |
PF00011 | HSP20 | 1.66 |
PF02574 | S-methyl_trans | 1.66 |
PF13561 | adh_short_C2 | 1.32 |
PF13242 | Hydrolase_like | 1.32 |
PF13649 | Methyltransf_25 | 1.32 |
PF02514 | CobN-Mg_chel | 1.32 |
PF00561 | Abhydrolase_1 | 0.99 |
PF04978 | DUF664 | 0.99 |
PF00581 | Rhodanese | 0.99 |
PF13344 | Hydrolase_6 | 0.99 |
PF01738 | DLH | 0.99 |
PF00583 | Acetyltransf_1 | 0.99 |
PF00005 | ABC_tran | 0.99 |
PF01734 | Patatin | 0.66 |
PF11248 | DUF3046 | 0.66 |
PF00248 | Aldo_ket_red | 0.66 |
PF06445 | GyrI-like | 0.66 |
PF01243 | Putative_PNPOx | 0.66 |
PF01011 | PQQ | 0.66 |
PF00440 | TetR_N | 0.66 |
PF10417 | 1-cysPrx_C | 0.66 |
PF02861 | Clp_N | 0.66 |
PF08281 | Sigma70_r4_2 | 0.66 |
PF12680 | SnoaL_2 | 0.66 |
PF02378 | PTS_EIIC | 0.66 |
PF02540 | NAD_synthase | 0.66 |
PF01315 | Ald_Xan_dh_C | 0.66 |
PF03448 | MgtE_N | 0.66 |
PF01828 | Peptidase_A4 | 0.66 |
PF01872 | RibD_C | 0.66 |
PF01906 | YbjQ_1 | 0.66 |
PF01145 | Band_7 | 0.66 |
PF01263 | Aldose_epim | 0.33 |
PF07859 | Abhydrolase_3 | 0.33 |
PF12833 | HTH_18 | 0.33 |
PF13537 | GATase_7 | 0.33 |
PF13669 | Glyoxalase_4 | 0.33 |
PF00483 | NTP_transferase | 0.33 |
PF07690 | MFS_1 | 0.33 |
PF08240 | ADH_N | 0.33 |
PF13424 | TPR_12 | 0.33 |
PF00330 | Aconitase | 0.33 |
PF06081 | ArAE_1 | 0.33 |
PF07929 | PRiA4_ORF3 | 0.33 |
PF01565 | FAD_binding_4 | 0.33 |
PF00872 | Transposase_mut | 0.33 |
PF02485 | Branch | 0.33 |
PF03061 | 4HBT | 0.33 |
PF14907 | NTP_transf_5 | 0.33 |
PF13376 | OmdA | 0.33 |
PF02036 | SCP2 | 0.33 |
PF08922 | DUF1905 | 0.33 |
PF04461 | DUF520 | 0.33 |
PF00665 | rve | 0.33 |
PF01645 | Glu_synthase | 0.33 |
PF00589 | Phage_integrase | 0.33 |
PF00296 | Bac_luciferase | 0.33 |
PF13560 | HTH_31 | 0.33 |
PF00797 | Acetyltransf_2 | 0.33 |
PF00132 | Hexapep | 0.33 |
PF13419 | HAD_2 | 0.33 |
PF07885 | Ion_trans_2 | 0.33 |
PF13411 | MerR_1 | 0.33 |
PF03795 | YCII | 0.33 |
PF00122 | E1-E2_ATPase | 0.33 |
PF01670 | Glyco_hydro_12 | 0.33 |
PF00850 | Hist_deacetyl | 0.33 |
PF00578 | AhpC-TSA | 0.33 |
PF01636 | APH | 0.33 |
PF00067 | p450 | 0.33 |
PF00290 | Trp_syntA | 0.33 |
PF01895 | PhoU | 0.33 |
PF03706 | LPG_synthase_TM | 0.33 |
PF13520 | AA_permease_2 | 0.33 |
PF08241 | Methyltransf_11 | 0.33 |
PF01548 | DEDD_Tnp_IS110 | 0.33 |
PF07927 | HicA_toxin | 0.33 |
PF01370 | Epimerase | 0.33 |
PF00293 | NUDIX | 0.33 |
PF02502 | LacAB_rpiB | 0.33 |
PF01037 | AsnC_trans_reg | 0.33 |
PF00400 | WD40 | 0.33 |
PF12323 | HTH_OrfB_IS605 | 0.33 |
PF13459 | Fer4_15 | 0.33 |
PF04542 | Sigma70_r2 | 0.33 |
PF00174 | Oxidored_molyb | 0.33 |
PF01402 | RHH_1 | 0.33 |
PF00102 | Y_phosphatase | 0.33 |
PF00378 | ECH_1 | 0.33 |
PF00324 | AA_permease | 0.33 |
PF13632 | Glyco_trans_2_3 | 0.33 |
PF07963 | N_methyl | 0.33 |
PF13191 | AAA_16 | 0.33 |
COG ID | Name | Functional Category | % Frequency in 302 Family Scaffolds |
---|---|---|---|
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.66 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 1.66 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 1.66 |
COG1429 | Cobalamin biosynthesis protein CobN, Mg-chelatase | Coenzyme transport and metabolism [H] | 1.32 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.66 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.66 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.66 |
COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.66 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.66 |
COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.66 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.66 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.66 |
COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.66 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.33 |
COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.33 |
COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.33 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.33 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.33 |
COG2453 | Protein-tyrosine phosphatase | Signal transduction mechanisms [T] | 0.33 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.33 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.33 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.33 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.33 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.33 |
COG0159 | Tryptophan synthase alpha chain | Amino acid transport and metabolism [E] | 0.33 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.33 |
COG4129 | Uncharacterized membrane protein YgaE, UPF0421/DUF939 family | Function unknown [S] | 0.33 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.33 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.33 |
COG5599 | Protein tyrosine phosphatase | Signal transduction mechanisms [T] | 0.33 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.33 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.33 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.33 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.33 |
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.33 |
COG0698 | Ribose 5-phosphate isomerase RpiB | Carbohydrate transport and metabolism [G] | 0.33 |
COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.33 |
COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.33 |
COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.33 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.33 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.33 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.33 |
COG1666 | Cyclic di-GMP-binding protein YajQ, UPF0234 family | Signal transduction mechanisms [T] | 0.33 |
COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.33 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.33 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.33 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.33 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.33 |
COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.33 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 55.96 % |
Unclassified | root | N/A | 44.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459024|GZRSKLJ02HCNP2 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
2189573004|GZGWRS401D0J62 | Not Available | 523 | Open in IMG/M |
2189573004|GZGWRS402IS270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 1-11 | 527 | Open in IMG/M |
3300000036|IMNBGM34_c009134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1258 | Open in IMG/M |
3300001084|JGI12648J13191_1024954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
3300001593|JGI12635J15846_10912363 | Not Available | 501 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100665724 | Not Available | 919 | Open in IMG/M |
3300002563|JGI24138J36424_10087743 | Not Available | 765 | Open in IMG/M |
3300004080|Ga0062385_10416873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
3300004082|Ga0062384_100030949 | Not Available | 2415 | Open in IMG/M |
3300004477|Ga0068971_1415736 | Not Available | 886 | Open in IMG/M |
3300004615|Ga0068926_1399748 | Not Available | 884 | Open in IMG/M |
3300004635|Ga0062388_102426997 | Not Available | 549 | Open in IMG/M |
3300004971|Ga0072324_1265472 | Not Available | 853 | Open in IMG/M |
3300005364|Ga0070673_100698276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 931 | Open in IMG/M |
3300005365|Ga0070688_100276749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 1204 | Open in IMG/M |
3300005435|Ga0070714_101357204 | Not Available | 694 | Open in IMG/M |
3300005436|Ga0070713_100776803 | Not Available | 917 | Open in IMG/M |
3300005436|Ga0070713_100933227 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300005437|Ga0070710_10973896 | Not Available | 616 | Open in IMG/M |
3300005471|Ga0070698_100353942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1400 | Open in IMG/M |
3300005533|Ga0070734_10111747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1599 | Open in IMG/M |
3300005574|Ga0066694_10223513 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300005577|Ga0068857_100528946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1109 | Open in IMG/M |
3300005598|Ga0066706_10950325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 666 | Open in IMG/M |
3300005602|Ga0070762_11224174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus saharensis | 520 | Open in IMG/M |
3300005610|Ga0070763_10210803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Rothia → Rothia dentocariosa | 1040 | Open in IMG/M |
3300005712|Ga0070764_10338471 | Not Available | 877 | Open in IMG/M |
3300005764|Ga0066903_104534408 | Not Available | 741 | Open in IMG/M |
3300005764|Ga0066903_107032754 | Not Available | 583 | Open in IMG/M |
3300005921|Ga0070766_10228772 | Not Available | 1172 | Open in IMG/M |
3300005921|Ga0070766_10543818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
3300005921|Ga0070766_11037651 | Not Available | 565 | Open in IMG/M |
3300005952|Ga0080026_10053487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 1061 | Open in IMG/M |
3300005995|Ga0066790_10489799 | Not Available | 526 | Open in IMG/M |
3300006052|Ga0075029_100313539 | Not Available | 1003 | Open in IMG/M |
3300006052|Ga0075029_100530578 | Not Available | 780 | Open in IMG/M |
3300006059|Ga0075017_100985901 | Not Available | 656 | Open in IMG/M |
3300006176|Ga0070765_100110013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2398 | Open in IMG/M |
3300006176|Ga0070765_100110689 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
3300006176|Ga0070765_100760588 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300006176|Ga0070765_102100195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
3300006176|Ga0070765_102228753 | Not Available | 511 | Open in IMG/M |
3300006642|Ga0075521_10112044 | Not Available | 1258 | Open in IMG/M |
3300006755|Ga0079222_12063540 | Not Available | 563 | Open in IMG/M |
3300006854|Ga0075425_102185554 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300006861|Ga0063777_1406075 | Not Available | 664 | Open in IMG/M |
3300006871|Ga0075434_100435711 | Not Available | 1332 | Open in IMG/M |
3300006893|Ga0073928_10156513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1832 | Open in IMG/M |
3300006904|Ga0075424_101688199 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300009162|Ga0075423_11420741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 743 | Open in IMG/M |
3300009521|Ga0116222_1160590 | Not Available | 967 | Open in IMG/M |
3300009545|Ga0105237_11178677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 773 | Open in IMG/M |
3300009551|Ga0105238_12793995 | Not Available | 525 | Open in IMG/M |
3300009645|Ga0116106_1255689 | Not Available | 557 | Open in IMG/M |
3300009672|Ga0116215_1031892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2427 | Open in IMG/M |
3300009672|Ga0116215_1482544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis saalfeldensis | 536 | Open in IMG/M |
3300009683|Ga0116224_10222542 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300009698|Ga0116216_10340448 | Not Available | 912 | Open in IMG/M |
3300009700|Ga0116217_10133561 | Not Available | 1670 | Open in IMG/M |
3300009764|Ga0116134_1226475 | Not Available | 647 | Open in IMG/M |
3300009824|Ga0116219_10477665 | Not Available | 691 | Open in IMG/M |
3300010043|Ga0126380_11062862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
3300010046|Ga0126384_12029301 | Not Available | 550 | Open in IMG/M |
3300010048|Ga0126373_10321388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1551 | Open in IMG/M |
3300010048|Ga0126373_10407922 | Not Available | 1385 | Open in IMG/M |
3300010048|Ga0126373_12652956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
3300010343|Ga0074044_10738181 | Not Available | 643 | Open in IMG/M |
3300010343|Ga0074044_11156360 | Not Available | 505 | Open in IMG/M |
3300010358|Ga0126370_10370329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1165 | Open in IMG/M |
3300010358|Ga0126370_10892042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
3300010360|Ga0126372_10516502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1126 | Open in IMG/M |
3300010361|Ga0126378_10550599 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300010361|Ga0126378_10764716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1076 | Open in IMG/M |
3300010366|Ga0126379_11894986 | Not Available | 699 | Open in IMG/M |
3300010373|Ga0134128_10177422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2404 | Open in IMG/M |
3300010373|Ga0134128_12677928 | Not Available | 550 | Open in IMG/M |
3300010373|Ga0134128_12733826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300010376|Ga0126381_102331983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 768 | Open in IMG/M |
3300010376|Ga0126381_102758982 | Not Available | 702 | Open in IMG/M |
3300010376|Ga0126381_103982335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
3300010376|Ga0126381_104797081 | Not Available | 520 | Open in IMG/M |
3300010396|Ga0134126_10745754 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300010398|Ga0126383_11850927 | Not Available | 692 | Open in IMG/M |
3300010867|Ga0126347_1587525 | Not Available | 680 | Open in IMG/M |
3300010880|Ga0126350_10668830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 779 | Open in IMG/M |
3300011035|Ga0138542_114440 | Not Available | 548 | Open in IMG/M |
3300011120|Ga0150983_11288743 | Not Available | 552 | Open in IMG/M |
3300011120|Ga0150983_12620124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia → Leifsonia aquatica → Leifsonia aquatica ATCC 14665 | 530 | Open in IMG/M |
3300011120|Ga0150983_12727046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1281 | Open in IMG/M |
3300011120|Ga0150983_13555503 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300011120|Ga0150983_16523632 | Not Available | 885 | Open in IMG/M |
3300012200|Ga0137382_10210435 | Not Available | 1338 | Open in IMG/M |
3300012209|Ga0137379_10790116 | Not Available | 854 | Open in IMG/M |
3300012285|Ga0137370_10668785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
3300012507|Ga0157342_1005239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1185 | Open in IMG/M |
3300012957|Ga0164303_10073157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1608 | Open in IMG/M |
3300012971|Ga0126369_11248301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 833 | Open in IMG/M |
3300013100|Ga0157373_10538879 | Not Available | 846 | Open in IMG/M |
3300014155|Ga0181524_10126114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1372 | Open in IMG/M |
3300014164|Ga0181532_10434718 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300014489|Ga0182018_10165881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1254 | Open in IMG/M |
3300014638|Ga0181536_10096737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1690 | Open in IMG/M |
3300014745|Ga0157377_10043756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2493 | Open in IMG/M |
3300016319|Ga0182033_11306841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 652 | Open in IMG/M |
3300016319|Ga0182033_11627315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
3300016341|Ga0182035_10938855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces aurantiacus group → Streptomyces phaeoluteigriseus | 765 | Open in IMG/M |
3300016371|Ga0182034_10819210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
3300016387|Ga0182040_10894954 | Not Available | 736 | Open in IMG/M |
3300016422|Ga0182039_12230327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
3300016445|Ga0182038_10081400 | Not Available | 2288 | Open in IMG/M |
3300016445|Ga0182038_11219842 | Not Available | 671 | Open in IMG/M |
3300016445|Ga0182038_11594100 | Not Available | 587 | Open in IMG/M |
3300017821|Ga0187812_1129560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 817 | Open in IMG/M |
3300017926|Ga0187807_1331729 | Not Available | 509 | Open in IMG/M |
3300017928|Ga0187806_1279746 | Not Available | 584 | Open in IMG/M |
3300017937|Ga0187809_10146222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 816 | Open in IMG/M |
3300017942|Ga0187808_10064372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1567 | Open in IMG/M |
3300017946|Ga0187879_10371377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
3300017948|Ga0187847_10146149 | Not Available | 1293 | Open in IMG/M |
3300017948|Ga0187847_10536674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex | 650 | Open in IMG/M |
3300017955|Ga0187817_10456498 | Not Available | 815 | Open in IMG/M |
3300017970|Ga0187783_10065057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2687 | Open in IMG/M |
3300018007|Ga0187805_10122955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1177 | Open in IMG/M |
3300018035|Ga0187875_10212161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1065 | Open in IMG/M |
3300018037|Ga0187883_10428244 | Not Available | 679 | Open in IMG/M |
3300018038|Ga0187855_10127857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1524 | Open in IMG/M |
3300018044|Ga0187890_10801057 | Not Available | 533 | Open in IMG/M |
3300018060|Ga0187765_10123928 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
3300018060|Ga0187765_10435631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TRM64462 | 817 | Open in IMG/M |
3300018089|Ga0187774_10221847 | Not Available | 1050 | Open in IMG/M |
3300020581|Ga0210399_10597006 | Not Available | 914 | Open in IMG/M |
3300020581|Ga0210399_10713993 | Not Available | 823 | Open in IMG/M |
3300020583|Ga0210401_10847194 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300020583|Ga0210401_11434698 | Not Available | 548 | Open in IMG/M |
3300021088|Ga0210404_10479238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
3300021181|Ga0210388_10240883 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
3300021181|Ga0210388_11809498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinokineospora → Actinokineospora bangkokensis | 503 | Open in IMG/M |
3300021402|Ga0210385_10488900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 932 | Open in IMG/M |
3300021402|Ga0210385_11482492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
3300021402|Ga0210385_11550226 | Not Available | 506 | Open in IMG/M |
3300021403|Ga0210397_11033355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
3300021403|Ga0210397_11207125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
3300021405|Ga0210387_11427201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
3300021406|Ga0210386_10126002 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
3300021406|Ga0210386_11716472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
3300021407|Ga0210383_10008917 | All Organisms → cellular organisms → Bacteria | 8639 | Open in IMG/M |
3300021407|Ga0210383_10759851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
3300021420|Ga0210394_11163620 | Not Available | 663 | Open in IMG/M |
3300021420|Ga0210394_11864409 | Not Available | 500 | Open in IMG/M |
3300021433|Ga0210391_10282123 | Not Available | 1303 | Open in IMG/M |
3300021433|Ga0210391_10708410 | Not Available | 789 | Open in IMG/M |
3300021474|Ga0210390_10187736 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
3300021474|Ga0210390_10518298 | Not Available | 1003 | Open in IMG/M |
3300021474|Ga0210390_11052363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
3300021478|Ga0210402_12028004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
3300021560|Ga0126371_10071677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 3372 | Open in IMG/M |
3300021560|Ga0126371_10290553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1759 | Open in IMG/M |
3300021560|Ga0126371_11001294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 977 | Open in IMG/M |
3300022528|Ga0242669_1030878 | Not Available | 837 | Open in IMG/M |
3300022531|Ga0242660_1063648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 834 | Open in IMG/M |
3300022709|Ga0222756_1001486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2025 | Open in IMG/M |
3300022709|Ga0222756_1039134 | Not Available | 679 | Open in IMG/M |
3300022724|Ga0242665_10064410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1010 | Open in IMG/M |
3300025412|Ga0208194_1074836 | Not Available | 515 | Open in IMG/M |
3300025432|Ga0208821_1052149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 738 | Open in IMG/M |
3300025527|Ga0208714_1019296 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
3300025634|Ga0208589_1106171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
3300025650|Ga0209385_1123058 | Not Available | 806 | Open in IMG/M |
3300025904|Ga0207647_10206873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1134 | Open in IMG/M |
3300025906|Ga0207699_10197208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1362 | Open in IMG/M |
3300025910|Ga0207684_10035034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4263 | Open in IMG/M |
3300025915|Ga0207693_11015237 | Not Available | 633 | Open in IMG/M |
3300025939|Ga0207665_10798730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
3300026217|Ga0209871_1082809 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300026551|Ga0209648_10250358 | Not Available | 1312 | Open in IMG/M |
3300026947|Ga0207853_1016953 | Not Available | 1150 | Open in IMG/M |
3300027073|Ga0208366_1004146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1389 | Open in IMG/M |
3300027648|Ga0209420_1088039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 891 | Open in IMG/M |
3300027652|Ga0209007_1024272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens | 1561 | Open in IMG/M |
3300027654|Ga0209799_1102773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulforamulus → Desulforamulus aquiferis | 649 | Open in IMG/M |
3300027662|Ga0208565_1020960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2355 | Open in IMG/M |
3300027854|Ga0209517_10280630 | Not Available | 983 | Open in IMG/M |
3300027855|Ga0209693_10227814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
3300027874|Ga0209465_10263266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 863 | Open in IMG/M |
3300027879|Ga0209169_10160965 | Not Available | 1170 | Open in IMG/M |
3300027889|Ga0209380_10059450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiales incertae sedis → Allonocardiopsis → Allonocardiopsis opalescens | 2174 | Open in IMG/M |
3300027894|Ga0209068_10652994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
3300027895|Ga0209624_10147636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → Kitasatospora cheerisanensis → Kitasatospora cheerisanensis KCTC 2395 | 1553 | Open in IMG/M |
3300027908|Ga0209006_11126883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
3300028711|Ga0307293_10137499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 778 | Open in IMG/M |
3300028775|Ga0302231_10235885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
3300028789|Ga0302232_10529465 | Not Available | 579 | Open in IMG/M |
3300028801|Ga0302226_10137166 | Not Available | 1070 | Open in IMG/M |
3300028879|Ga0302229_10510413 | Not Available | 531 | Open in IMG/M |
3300028906|Ga0308309_10034182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3522 | Open in IMG/M |
3300028906|Ga0308309_10819567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia → Leifsonia aquatica → Leifsonia aquatica ATCC 14665 | 808 | Open in IMG/M |
3300029943|Ga0311340_10634667 | Not Available | 927 | Open in IMG/M |
3300029951|Ga0311371_10616941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1389 | Open in IMG/M |
3300029999|Ga0311339_10264759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1879 | Open in IMG/M |
3300030007|Ga0311338_10069136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4564 | Open in IMG/M |
3300030013|Ga0302178_10159839 | Not Available | 1110 | Open in IMG/M |
3300030053|Ga0302177_10532155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
3300030225|Ga0302196_10397200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
3300030494|Ga0310037_10350866 | Not Available | 619 | Open in IMG/M |
3300030524|Ga0311357_10100258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2900 | Open in IMG/M |
3300030524|Ga0311357_11306801 | Not Available | 622 | Open in IMG/M |
3300030580|Ga0311355_10908621 | Not Available | 799 | Open in IMG/M |
3300030603|Ga0210253_10988853 | Not Available | 616 | Open in IMG/M |
3300030617|Ga0311356_10519287 | Not Available | 1161 | Open in IMG/M |
3300030617|Ga0311356_11885823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinokineospora → Actinokineospora bangkokensis | 531 | Open in IMG/M |
3300030707|Ga0310038_10473057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 533 | Open in IMG/M |
3300030740|Ga0265460_13094307 | Not Available | 501 | Open in IMG/M |
3300030743|Ga0265461_11366961 | Not Available | 751 | Open in IMG/M |
3300031018|Ga0265773_1036103 | Not Available | 550 | Open in IMG/M |
3300031234|Ga0302325_12505730 | Not Available | 615 | Open in IMG/M |
3300031236|Ga0302324_102085424 | Not Available | 708 | Open in IMG/M |
3300031525|Ga0302326_10970124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1198 | Open in IMG/M |
3300031525|Ga0302326_11921196 | Not Available | 769 | Open in IMG/M |
3300031545|Ga0318541_10719472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 557 | Open in IMG/M |
3300031561|Ga0318528_10481624 | Not Available | 666 | Open in IMG/M |
3300031572|Ga0318515_10356409 | Not Available | 784 | Open in IMG/M |
3300031670|Ga0307374_10652192 | Not Available | 518 | Open in IMG/M |
3300031672|Ga0307373_10526630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
3300031708|Ga0310686_105453878 | Not Available | 1199 | Open in IMG/M |
3300031708|Ga0310686_112873980 | Not Available | 539 | Open in IMG/M |
3300031708|Ga0310686_114387517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1265 | Open in IMG/M |
3300031713|Ga0318496_10549670 | Not Available | 638 | Open in IMG/M |
3300031713|Ga0318496_10804083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
3300031715|Ga0307476_10609173 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300031716|Ga0310813_10182101 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
3300031723|Ga0318493_10425885 | Not Available | 728 | Open in IMG/M |
3300031723|Ga0318493_10686952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
3300031744|Ga0306918_10437625 | Not Available | 1021 | Open in IMG/M |
3300031744|Ga0306918_11362212 | Not Available | 544 | Open in IMG/M |
3300031751|Ga0318494_10031934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2699 | Open in IMG/M |
3300031751|Ga0318494_10261677 | Not Available | 993 | Open in IMG/M |
3300031765|Ga0318554_10752524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
3300031781|Ga0318547_10840129 | Not Available | 572 | Open in IMG/M |
3300031798|Ga0318523_10459154 | Not Available | 631 | Open in IMG/M |
3300031819|Ga0318568_10581509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces aurantiacus group → Streptomyces phaeoluteigriseus | 698 | Open in IMG/M |
3300031832|Ga0318499_10075772 | Not Available | 1283 | Open in IMG/M |
3300031832|Ga0318499_10303855 | Not Available | 616 | Open in IMG/M |
3300031860|Ga0318495_10416389 | Not Available | 591 | Open in IMG/M |
3300031890|Ga0306925_10627752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1132 | Open in IMG/M |
3300031896|Ga0318551_10484843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
3300031897|Ga0318520_10663229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
3300031942|Ga0310916_10729044 | Not Available | 838 | Open in IMG/M |
3300031942|Ga0310916_10978451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
3300032001|Ga0306922_10932489 | Not Available | 900 | Open in IMG/M |
3300032010|Ga0318569_10082035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1438 | Open in IMG/M |
3300032010|Ga0318569_10516733 | Not Available | 556 | Open in IMG/M |
3300032010|Ga0318569_10607758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 509 | Open in IMG/M |
3300032025|Ga0318507_10158457 | Not Available | 970 | Open in IMG/M |
3300032041|Ga0318549_10247527 | Not Available | 802 | Open in IMG/M |
3300032060|Ga0318505_10201331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
3300032060|Ga0318505_10635379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
3300032063|Ga0318504_10599905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
3300032065|Ga0318513_10224048 | Not Available | 908 | Open in IMG/M |
3300032065|Ga0318513_10397941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 672 | Open in IMG/M |
3300032066|Ga0318514_10141717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1243 | Open in IMG/M |
3300032074|Ga0308173_11430157 | Not Available | 649 | Open in IMG/M |
3300032089|Ga0318525_10243569 | Not Available | 924 | Open in IMG/M |
3300032089|Ga0318525_10421146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
3300032089|Ga0318525_10737323 | Not Available | 501 | Open in IMG/M |
3300032091|Ga0318577_10122445 | Not Available | 1229 | Open in IMG/M |
3300032121|Ga0316040_110255 | Not Available | 648 | Open in IMG/M |
3300032160|Ga0311301_11599387 | Not Available | 793 | Open in IMG/M |
3300032160|Ga0311301_11635107 | Not Available | 781 | Open in IMG/M |
3300032160|Ga0311301_11653247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
3300032174|Ga0307470_10443440 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300032180|Ga0307471_100885219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1060 | Open in IMG/M |
3300032261|Ga0306920_101421519 | Not Available | 993 | Open in IMG/M |
3300032515|Ga0348332_10825346 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300032515|Ga0348332_14084339 | Not Available | 594 | Open in IMG/M |
3300032770|Ga0335085_11456070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
3300032783|Ga0335079_10048568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4864 | Open in IMG/M |
3300032783|Ga0335079_10376924 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
3300032829|Ga0335070_11503561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
3300032892|Ga0335081_10683587 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300032892|Ga0335081_12073125 | Not Available | 604 | Open in IMG/M |
3300032892|Ga0335081_12108256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
3300032892|Ga0335081_12224183 | Not Available | 576 | Open in IMG/M |
3300032895|Ga0335074_10135561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3153 | Open in IMG/M |
3300032895|Ga0335074_10195360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2477 | Open in IMG/M |
3300032895|Ga0335074_10802722 | Not Available | 878 | Open in IMG/M |
3300032895|Ga0335074_10810380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium | 871 | Open in IMG/M |
3300032895|Ga0335074_11214865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 634 | Open in IMG/M |
3300032896|Ga0335075_10035251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7160 | Open in IMG/M |
3300032896|Ga0335075_10291137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1835 | Open in IMG/M |
3300032896|Ga0335075_10449366 | Not Available | 1343 | Open in IMG/M |
3300032898|Ga0335072_10347466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1626 | Open in IMG/M |
3300033134|Ga0335073_10324233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Longimycelium → Longimycelium tulufanense | 1837 | Open in IMG/M |
3300033134|Ga0335073_10354884 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
3300033134|Ga0335073_10925384 | Not Available | 914 | Open in IMG/M |
3300033134|Ga0335073_11216087 | Not Available | 754 | Open in IMG/M |
3300033134|Ga0335073_11532381 | Not Available | 641 | Open in IMG/M |
3300033290|Ga0318519_10826757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
3300033547|Ga0316212_1012994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia asymbiotica | 1183 | Open in IMG/M |
3300034124|Ga0370483_0081560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1051 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.28% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.95% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.29% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.29% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.64% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.30% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.32% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.99% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.66% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.32% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.32% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.32% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.32% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.32% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.99% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.99% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.99% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.99% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.66% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.66% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.66% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.66% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.66% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.66% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.66% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.33% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.33% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.33% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.33% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.33% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.33% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.33% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.33% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.33% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.33% |
Passalidae Beetle Gut | Host-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Passalidae Beetle Gut | 0.33% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.33% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.33% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Host-Associated | Open in IMG/M |
3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002563 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004615 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004971 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006861 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011035 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 23 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026947 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 6 (SPAdes) | Environmental | Open in IMG/M |
3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030225 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030603 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032121 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD1_09120400 | 2170459024 | Grass Soil | VICLSYGVKGWAAFFLIIGALNLAGGSWYITIDRSAPA |
FG2_03110610 | 2189573004 | Grass Soil | YGVYGWAAFFLVLGAMNLAGGYWYLTVVRSASART |
FG2_01437980 | 2189573004 | Grass Soil | TRIAGGGVATAAGVVCLSYGVYGWAAFFLVLAALNLAGGSWYITIDRSASARS |
IMNBGM34_0091343 | 3300000036 | Passalidae Beetle Gut | AGSFVATVAGVLCLSYTAYGWAAFFLXVGALNLADGCWYMAIARSAPPRA* |
JGI12648J13191_10249542 | 3300001084 | Forest Soil | CLGYDVSGWAAFFLAVAALNLAGGSWFLAIAGPVSARLK* |
JGI12635J15846_109123631 | 3300001593 | Forest Soil | AAGVICLGYGVYGWAAFFLAVAAAHLAGGYWFLTIDRSAPART* |
JGIcombinedJ26739_1006657241 | 3300002245 | Forest Soil | GLVCLSYGVYGWAAFFLVLAALNLAGGSWYLTIARSASART* |
JGI24138J36424_100877431 | 3300002563 | Arctic Peat Soil | AAGIGTFILSYSAYGWAALFLVLGALNLACGYWYLTVARSASART* |
Ga0062385_104168731 | 3300004080 | Bog Forest Soil | IGAFILSYGAYGWAAFFLVVGAANLAVGYWEITIARSAAARA* |
Ga0062384_1000309491 | 3300004082 | Bog Forest Soil | GVVCLSYGVYGWAAFFLVLGTLNLAGGCWYLTIARSAPART* |
Ga0068971_14157362 | 3300004477 | Peatlands Soil | HIAGGSVAAAAGIVCLSYGVYGWAAFFLVIAALNLAGGCWYLTIARSASART* |
Ga0068926_13997482 | 3300004615 | Peatlands Soil | RIAGGGVTGAAGVVCLSYGVYGWAAFFLVIAALNLAGGCWYLTIARSASART* |
Ga0062388_1024269971 | 3300004635 | Bog Forest Soil | AAGVVCLSYGVYGWAAFFLVLGTLNLAGGCWYLTIARSAPART* |
Ga0072324_12654721 | 3300004971 | Peatlands Soil | VVCLSYGVYGWAAFFLVIAALNLAGGCWYLTIARSASART* |
Ga0070673_1006982761 | 3300005364 | Switchgrass Rhizosphere | SVAAAAGVICLSYGVKGWAAFFLIIGALNLAGGSWYITIDRSAPA* |
Ga0070688_1002767491 | 3300005365 | Switchgrass Rhizosphere | GSVAAAAGVICLSYGVKGWAAFFLIIGALNLAGGSWYITIDRSAPA* |
Ga0070714_1013572041 | 3300005435 | Agricultural Soil | VCLAYGVYGWAAFFLVLGALNLGGGSWYITIARSASART* |
Ga0070713_1007768032 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAGAGLICLAYGAYGWAAFFLLLGALNLAGGYWYLTIARSRSARA* |
Ga0070713_1009332271 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | IAAAAGVVCLAYGVYPWAAFFLILGALNLGGGYWYLTIDRSASART* |
Ga0070710_109738962 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GAGLICLAYGAYGWAAFFLLLGALNLAGGYWYLTIARSQSAQA* |
Ga0070698_1003539423 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | YGVYGWAAFFLVLGALNFAGGYWYITLDRCTCPNLSLRDS* |
Ga0070734_101117472 | 3300005533 | Surface Soil | AYGVYGYAAFFLVLGALNLAGGSWYLAIARSTSART* |
Ga0066694_102235131 | 3300005574 | Soil | AYGVYPWAAFFLILGALNLGGGYWYLTIDRSASART* |
Ga0068857_1005289463 | 3300005577 | Corn Rhizosphere | TRIAGGSVAAAAGFICLSYGVKGWAAFFLIIGALNLAGGSWYITIDRSAPA* |
Ga0066706_109503252 | 3300005598 | Soil | YGVYGWAAFFLVIAALNLAGGYWYLSIDRSASART* |
Ga0070762_112241742 | 3300005602 | Soil | VAGFICLSYAVYGWAAFFLVIAALNIAGGCWDLSIARSAAART* |
Ga0070763_102108031 | 3300005610 | Soil | AAAGLICLAYGAYGWAAFFLVIATLNLAGGSWYITIARSAPARTWA* |
Ga0070764_103384712 | 3300005712 | Soil | LSYGVYSWAAFFLVIAALNLAGGSWYLTIARSASGPA* |
Ga0066903_1045344081 | 3300005764 | Tropical Forest Soil | ICLAYGVYGWAAFFLIIAALNLAGGYWYLSIDRTAPARA* |
Ga0066903_1047043531 | 3300005764 | Tropical Forest Soil | SARLVAFSRSVAAAAGVVCLAYGVCGWATFFLVIAALNLAGGFWYITAARSASAPS* |
Ga0066903_1070327541 | 3300005764 | Tropical Forest Soil | GVYGWAAFFLVIAALNLAGGSWYLTIARTASARA* |
Ga0070766_102287722 | 3300005921 | Soil | SVAAAAGVICLSYGVYGWAAFFLVLGALNIAGGSWYLNIARSAPARA* |
Ga0070766_105438183 | 3300005921 | Soil | SVAAAAGVICLSYGVYGWAAFFLVIGALNLGGGYWYLTVDRSAPART* |
Ga0070766_110376511 | 3300005921 | Soil | RIAGGSVQAAAGLICLAYGVYGWAAFFLVLAALNLAGGSWYLTVARSASART* |
Ga0080026_100534871 | 3300005952 | Permafrost Soil | IAGGFVAATAGGVCLSYAAYGWAAFFLILGVLNLAGGYWYITIARSAPHRA* |
Ga0066790_104897992 | 3300005995 | Soil | VCLSYGVYGWAAFFLVLGALNLAGGCWYITIARSESART* |
Ga0075029_1003135393 | 3300006052 | Watersheds | AGVICLSYGVHGWAVFFLAIAALNLAGGSWYLTIDRSAPARA* |
Ga0075029_1005305782 | 3300006052 | Watersheds | RIAGGSVAAAAGVVCLSYGVYGWAAFFLALAALNLAGGSWYLNIARSASART* |
Ga0075017_1009859013 | 3300006059 | Watersheds | CLSYAAYGWAAFFLVVGVLNLAGGYWYISIARSAPPRA* |
Ga0070765_1001100134 | 3300006176 | Soil | GGSLAAAAGLICLGYGVYGWTAFFLVIAALNLAGGYWYLTIARSTSAQA* |
Ga0070765_1001106892 | 3300006176 | Soil | VVCLAYGVYGWAAFFLVLGTLNLADGYWYLTVARSTSAAA* |
Ga0070765_1007605883 | 3300006176 | Soil | GGSLAAAAGLICLGYGVYGWTAFFLVIAALNLAGGYWYLSIARSTSAQA* |
Ga0070765_1021001951 | 3300006176 | Soil | GVVCLSYGVYGWAAFFLVLAALNFAGGSWYITIDRSAPART* |
Ga0070765_1022287531 | 3300006176 | Soil | YGVHGWAAFFLVIATLNLAGGSWYLAIDRSAPARA* |
Ga0075521_101120441 | 3300006642 | Arctic Peat Soil | CLSYAAYGWAAFFLVLGVLNLAGGYWYITIVRSAPPRA* |
Ga0079222_120635401 | 3300006755 | Agricultural Soil | TGSICLAYSVYGWAAFFLLLGALNLAGGYWYLTIARSRSAQA* |
Ga0075425_1021855543 | 3300006854 | Populus Rhizosphere | AAAGVVCLAYGVYPWAAFFLILGALNLGGGYWYLTIDRSASART* |
Ga0063777_14060751 | 3300006861 | Peatlands Soil | AGVVCLSYGVYGWAAFFLVIAALNLAGGCWYLTIARSASART* |
Ga0075434_1004357112 | 3300006871 | Populus Rhizosphere | AGLICLAYGAYAWAAFFLLLGALNLGGGYWYLTIARSRSARA* |
Ga0073928_101565134 | 3300006893 | Iron-Sulfur Acid Spring | VAAAAGVVCLSYGVYGWAAFFGVIAALNLAGGSWYLTIDRSASART* |
Ga0075424_1016881993 | 3300006904 | Populus Rhizosphere | AGGSVATGAGVVCLSYGVYRWAAFFLVLGALNLGGGYWYLTIDRSASARA* |
Ga0075423_114207411 | 3300009162 | Populus Rhizosphere | VAAAAGVICLSYGVKGWAAFFLIIGALNLAGGSWYITIDRSAPA* |
Ga0116222_11605902 | 3300009521 | Peatlands Soil | AAIAGVVCLSYAAYGWAAFFLVVGVLNLAGGYWYITIARSTPPQA* |
Ga0105237_111786771 | 3300009545 | Corn Rhizosphere | AAAGVICLSYGVKGWAAFFLIIGALNLAGGSWYITIDRSAPA* |
Ga0105238_127939951 | 3300009551 | Corn Rhizosphere | LVCLSFGVYGWATFFLALGTFNLAGGSWYLTLARSASARP* |
Ga0116106_12556891 | 3300009645 | Peatland | VAAAAGIVCLSYSVYGWAAFFLVLGALNLAGGCWYLTIARSESART* |
Ga0116215_10318923 | 3300009672 | Peatlands Soil | AAAGLVCLSYGVYGWAAFFLIIGALNLAGGYWYITIARSARRAH* |
Ga0116215_14825442 | 3300009672 | Peatlands Soil | VCLSYGVYGWAAFFLVLAALNIGGGSWYLTIARSAPART* |
Ga0116224_102225422 | 3300009683 | Peatlands Soil | IAGGSVAAAAGVVCLSYGVYGWAAFFLVLGALNLAGGCWYITIARSASART* |
Ga0116216_103404482 | 3300009698 | Peatlands Soil | SYGAYGWAALFLVLGALNLAGGYWYLTIAGSASART* |
Ga0116217_101335611 | 3300009700 | Peatlands Soil | MRIAGGGVTGAAGVVCLSYGVYGWAAFFLVIAALNLAGGCWYLTIA |
Ga0116134_12264751 | 3300009764 | Peatland | YGVYGWAAFFLVLGTLNLAGGYWYLTVARSASART* |
Ga0116219_104776651 | 3300009824 | Peatlands Soil | AVCLSYGVYGWAAFFLVVAALNLAVGYWELTIARSASARS* |
Ga0126380_110628623 | 3300010043 | Tropical Forest Soil | YGVYGWAAFFLVLAAANLAGGYWELTIARSASART* |
Ga0126384_120293012 | 3300010046 | Tropical Forest Soil | IAGGSVAAAAGLICLAYGVHGWAAFFLVLAAANLAGGYWELTIARSASART* |
Ga0126373_103213882 | 3300010048 | Tropical Forest Soil | VAAGAGLVCLSYGVYGWAAFFLVVGALNLAGGYWYLTIDRSASALTGV* |
Ga0126373_104079223 | 3300010048 | Tropical Forest Soil | GSAAAAAGVVCLAYGAYGWATFFAVLAAPNLAGGYWYLTIDRSASART* |
Ga0126373_121785521 | 3300010048 | Tropical Forest Soil | RAYGWAAFFLAIGSVNIAGGCWELSIDRSAADRT* |
Ga0126373_126529562 | 3300010048 | Tropical Forest Soil | RIGGGSVAAAAGLICLAYGVYAWAAFFLVLASLNLAGGYWFLTIARRARART* |
Ga0074044_107381812 | 3300010343 | Bog Forest Soil | GSVAAAAGVVCLSYGVYGWAAFFLVIAALNFAGGYWYITVARSAPART* |
Ga0074044_111563602 | 3300010343 | Bog Forest Soil | AAAAGVICLGYGVYGWAAFFLAVAAAHLAGGYWFLTIDRSAPART* |
Ga0126370_103703291 | 3300010358 | Tropical Forest Soil | MRIAGGSVAAAAGLICLSYGVYGWAAFFLVLAVLNLAGGNWYLTIDRSASAQS* |
Ga0126370_108920422 | 3300010358 | Tropical Forest Soil | LVCLSYGVYGWATFFLVVGALNLAGGYWYLTIDRSAPALT* |
Ga0126372_105165022 | 3300010360 | Tropical Forest Soil | MRIAGGSVAAAAGLICLSYGVYGWAAFFLVLAALNLAGGNWYLTIDRSASARS* |
Ga0126378_105505991 | 3300010361 | Tropical Forest Soil | RIAGGSVAAAAGVVCLSYRVYGWAAFFLVLAALNLAGGSWYLTIARSASA* |
Ga0126378_107647162 | 3300010361 | Tropical Forest Soil | SYGVYGWAAFFLVLAALNLAGGYWFLTIDGSDPARI* |
Ga0126379_118949861 | 3300010366 | Tropical Forest Soil | CLSYGVYGWAAFFLVLAALNLAGGYWYLTIARSASART* |
Ga0134128_101774221 | 3300010373 | Terrestrial Soil | SVATAAGFVCLSYGVNGWAAFFLVLGTQNLSGGFWFPTVTRSASVRTGGAG* |
Ga0134128_126779281 | 3300010373 | Terrestrial Soil | AGGGVAAAGGLVCLSFGVYGWANVFLALGTFNLAGGSWYLTLARSASARP* |
Ga0134128_127338262 | 3300010373 | Terrestrial Soil | GGSVAAAAGVICLSYGVKGWAAFFLIIGALNLAGGSWYITIDRSAPA* |
Ga0126381_1023319831 | 3300010376 | Tropical Forest Soil | LICLSYQAYPWAAFFLVIAALNFAGGSWYVSIDNSKSPRT* |
Ga0126381_1027589822 | 3300010376 | Tropical Forest Soil | CLAYGVYPWAAFFLVIAALNLAGGYWYLTIARPASART* |
Ga0126381_1039823351 | 3300010376 | Tropical Forest Soil | AGIVCLAYGVYGWAAFFLVIAAANLAGGYWYLTIDRSAPARI* |
Ga0126381_1047970812 | 3300010376 | Tropical Forest Soil | VAGLICLAYGVLGWAAFFLVLAAANLAGGYWELTIAGSASART* |
Ga0134126_107457542 | 3300010396 | Terrestrial Soil | MAGGGVAGVAGVVCLSYGANKWSAFFLVLAALNLAGGYWYITLARSAPHRV* |
Ga0126383_118509271 | 3300010398 | Tropical Forest Soil | YGVYGWAAFFLVLAALNLAGGYWYLTIARSASART* |
Ga0126347_15875253 | 3300010867 | Boreal Forest Soil | LGYNAYGWAAFFLVLGALNLAGGSWFLNVDRSASART* |
Ga0126350_106688302 | 3300010880 | Boreal Forest Soil | LAYSAWGWAAFFLVIAGLNLAGGSWYLSIARSRAARA* |
Ga0138542_1144402 | 3300011035 | Peatlands Soil | LSYGVYGWAAFFLVIAALNLAGGCWYLTIARSASART* |
Ga0150983_112887433 | 3300011120 | Forest Soil | VAAAAGVICLSYGVYAWAAFFLVIGALNLAGGSWYLSIARSEPART* |
Ga0150983_126201241 | 3300011120 | Forest Soil | HIAGGSLAAAAGLICLGYGVYGWTAFFLVIAALNLAGGYWYLTIARSTSAQA* |
Ga0150983_127270462 | 3300011120 | Forest Soil | YGAYAWAAFFLVIGALNLAGGYWYLTIDRSAPART* |
Ga0150983_135555033 | 3300011120 | Forest Soil | GLICLGYGVYGWAGFFLVIAALNLAGGYWYLSIARSTSAQA* |
Ga0150983_165236322 | 3300011120 | Forest Soil | GVICLSYGVYGWAAFFLVVAALNLAGGYWYLTVAHSVPART* |
Ga0137382_102104353 | 3300012200 | Vadose Zone Soil | GVICLSYGVYGWAAFFLVLAALNLAGGYWYLTIARSASARA* |
Ga0137379_107901162 | 3300012209 | Vadose Zone Soil | YGVSGWAAFFLVLAALNFAGGSWYIIIDRSAPART* |
Ga0137370_106687852 | 3300012285 | Vadose Zone Soil | VVCLSYGVSGWAAFFLVIGALNLAGGSWYITIARTVPART* |
Ga0157342_10052393 | 3300012507 | Arabidopsis Rhizosphere | AAAAGVICLSYGVKGWAAFFLIIGALNLAGGSWYITIDRSAPA* |
Ga0164303_100731572 | 3300012957 | Soil | AGFVCLSYGVNGWAAFFLVLGTQNLSGGFWFATVTRSASVRTGGAG* |
Ga0126369_112483012 | 3300012971 | Tropical Forest Soil | MRIAGGSVAAAAGLICLSYGVYGWAAFFLVLAALNVAGGYWYLTIDAERAMVVPCV* |
Ga0157373_105388793 | 3300013100 | Corn Rhizosphere | RVYGWAAFFLALGALNLAGGYWYMTLARSASARP* |
Ga0181524_101261142 | 3300014155 | Bog | VGLICLAYSGYGWAALFLVIAALNIAWGCWDLAIARSASAGR |
Ga0181532_104347182 | 3300014164 | Bog | AGVVCLSYAAYGWAAFFLVVGVLNLAGGYWEITIARSSPPRA* |
Ga0182018_101658812 | 3300014489 | Palsa | GVYAWAAFFLVIAAANLAGGSWYLNIARSESAAT* |
Ga0181536_100967374 | 3300014638 | Bog | CLAYGGYGWAAFFLVVAALNIAWGGWDLAIARSAAART* |
Ga0157377_100437561 | 3300014745 | Miscanthus Rhizosphere | TRIAGGSVAAAAGVICLSYGVKGWAAFFLIIGALNLAGGSWYITIDRSAPA* |
Ga0182033_113068412 | 3300016319 | Soil | AGGSVAAAAGVVCLAYGVHGWAAFFLIIASLNLAGGYWYLTITRSACPQT |
Ga0182033_116273152 | 3300016319 | Soil | FGGCAAAGAGLICLAYGVHGWAAFFLVIAALNLAGGYWELAVARSASARA |
Ga0182035_109388551 | 3300016341 | Soil | VAGGSVAAGAGIVCLSYGVYGWAAFFLALGALNLAGGYWYLTIDGSAPAGT |
Ga0182034_108192102 | 3300016371 | Soil | AGGILGVAAGLICLSYGVYGWAAFFLVLGALNLAGGYWFLSIARSASART |
Ga0182040_108949541 | 3300016387 | Soil | AYGVYGWAAFFLVVGALNLAGGYWYLSIDRSAPART |
Ga0182039_122303272 | 3300016422 | Soil | CLSYGVYGWAAFFLVLGALNLAGGYWYLTIARSAPSRA |
Ga0182038_100814001 | 3300016445 | Soil | GGSVAAGAGVICLSYGVYGWATFFLVIGALNLAGGSWYLTIDNSAPA |
Ga0182038_112198422 | 3300016445 | Soil | AAGLICLSYGVYGWAAFFLVLGALNLAGGSWFLTIARSAPTRT |
Ga0182038_115941003 | 3300016445 | Soil | GGSVAAGAGVICLSYGVYGWATFFLVIGALNLAGGSWYLSIDNSAPA |
Ga0187812_11295602 | 3300017821 | Freshwater Sediment | CLSYGVYGWAAFFLVLAALNLAGGSWYLTIARSASART |
Ga0187807_13317291 | 3300017926 | Freshwater Sediment | SAYAWAAFFLVVGVLDLAVGYWFLTIARSAAYRAAFSG |
Ga0187806_12797461 | 3300017928 | Freshwater Sediment | AGLICLSYGVYGWAAFFLVLGALNLAGGSWYLTIARPASART |
Ga0187809_101462221 | 3300017937 | Freshwater Sediment | RIFGGSAAGAAGVVCLSYRVYGWAAFFLAIGALNLGGGYWYLTIDRSAPPPT |
Ga0187808_100643723 | 3300017942 | Freshwater Sediment | LSYGVSGWAAFFLVIAALNLGGGYWYLTIARSASAAT |
Ga0187879_103713772 | 3300017946 | Peatland | GVVCLSYGVYGWAAFFLVLGVLNLAGGYWYITVARARVSE |
Ga0187847_101461492 | 3300017948 | Peatland | ASAICLGYGVYSWAAFFLAIGALNLAGGAWYFSVANSTPRSA |
Ga0187847_105366742 | 3300017948 | Peatland | GSIAVAASAVCLSYSVYGWAAFFLVIGALNLAGGYWYITIARSAPARA |
Ga0187817_104564981 | 3300017955 | Freshwater Sediment | AGVVCLSYGVDGWAAFFLVLGALNLAGGCWYLTIARPAPDRT |
Ga0187783_100650573 | 3300017970 | Tropical Peatland | VAGIICLSYGVFAWAAFFLVIAALNFGGGSWYLSIVRSTPART |
Ga0187805_101229553 | 3300018007 | Freshwater Sediment | GGGVATAAGIICLSYSVYGWAAFFLVLAALALAGGSWYLSIDRSARART |
Ga0187875_102121611 | 3300018035 | Peatland | AAGLICLSYGVYGWAAFFLVVATLSLAAGYWYLTIARSASART |
Ga0187883_104282442 | 3300018037 | Peatland | ICLSYAAYGWAAFFLVVGALNLAGGYWELTIARSQSLRA |
Ga0187855_101278572 | 3300018038 | Peatland | LICLSYAAYGWAAFFLVVGALNLAGGYWELTIARSQSLRA |
Ga0187890_108010571 | 3300018044 | Peatland | RIAGGSVAAAAGVICLSYGVYGWAAFFLVIAALNFAGGYWYLSVARSAPARA |
Ga0187765_101239283 | 3300018060 | Tropical Peatland | AGGGVAAAAGVVCLSYDVYGWAAFFLVIAALNLAGGIWYLAIARSASAPG |
Ga0187765_104356312 | 3300018060 | Tropical Peatland | IAGGSIAVGAGLICLAYGVYGWAAFFLVIGGLNLAGGYWYLTIDRARSARI |
Ga0187774_102218472 | 3300018089 | Tropical Peatland | AAAAGIVCLSYAAHGWAAFFLVIAALNLAVGYWELTIARSPSSRTRPAGQ |
Ga0210399_105970062 | 3300020581 | Soil | SVATAAGVICLSYGVYGWAAFFLVIGALNLAGGSWYLTIDRSASAAA |
Ga0210399_107139932 | 3300020581 | Soil | CLAYGVYGWAAFFLILAALNLAGGYWYLTVARSASART |
Ga0210401_108471942 | 3300020583 | Soil | MGIWVGVVGFTCLTYGAYGWAGFFLVLGALALAGGYWYLTIDRSGPTRT |
Ga0210401_114346982 | 3300020583 | Soil | YRAYGWAAYFLVIAALSLAGGSWYLSIDRTVSARA |
Ga0210404_104792381 | 3300021088 | Soil | TRIFGGSVAAAAGVICLSYDVYGWAAFFLVIGALNLGGGYWYLTVDRSAPART |
Ga0210388_102408833 | 3300021181 | Soil | VVCLAYGVYGWAAFFLVLGTLNLAGGYWYLTVARSTSAAT |
Ga0210388_118094981 | 3300021181 | Soil | YSAWGWAAFFLVIAALNYGGGAWYLSILRSRTAHA |
Ga0210385_104889002 | 3300021402 | Soil | CLSYGVYGWAAFFLVVAALNLAGGSWYVTIARSASART |
Ga0210385_114824922 | 3300021402 | Soil | AACFGCLAYGVHGWAAFFLVIGALNLGGGYWYLTVDRSALART |
Ga0210385_115502262 | 3300021402 | Soil | CLPYGVYGWAAFFLALAAGNFAGGSWYLTIDRSAAAQA |
Ga0210397_110333551 | 3300021403 | Soil | AGAGVICLSYGVYGWAAFFLALAAGNFAGGSWYLTIDRSAAART |
Ga0210397_112071252 | 3300021403 | Soil | GSIACGAGVICLAYGVYGWAAFFLVIGGLNLGAGYWDLTIVRSGPARTWA |
Ga0210387_114272011 | 3300021405 | Soil | AGAGVICLAYGVYGWAAFFLALAAGNFAGGSWYLSIDRSAAAGA |
Ga0210386_101260023 | 3300021406 | Soil | MGIWVGVVGLTCLTYGAYGWAAFFLVLGALALAGGYWYLTIDRSGPTRT |
Ga0210386_117164722 | 3300021406 | Soil | RIFGGSAAAAAGVVCLAYGVHGWAAFFLVIGALNLGGGYWYLTVDRSALART |
Ga0210383_100089177 | 3300021407 | Soil | VCLAYGVYGWAAFFLVLAALHLAGGYWYLTIDRSVSA |
Ga0210383_107598512 | 3300021407 | Soil | RIFGGSAAGAAGVVCLSYRVYGWAAFFLAIGALNLGGGYWYLTIDRSAAAPT |
Ga0210394_111636201 | 3300021420 | Soil | TAGVICLSYGAYGWAALFLVGAALSLVCGYWYLTIDPSARART |
Ga0210394_118644092 | 3300021420 | Soil | GHIAGGSLQAAAGLVCLAYDADGWAAFFLTISALNLAGGYWYLTIDATTAPVT |
Ga0210391_102821232 | 3300021433 | Soil | CLSYGVYSWAAFFLVIAALNLAGGSWYLTIARSASGPA |
Ga0210391_107084101 | 3300021433 | Soil | AGAGVICLSYGVYGWAAFFLALAAGNFAGGSWYLSIDRSASARA |
Ga0210390_101877361 | 3300021474 | Soil | MGIWVGVVGFTCLTYGAYGWAGFFLVLGALALAGGYWYLTIDRSGPART |
Ga0210390_105182981 | 3300021474 | Soil | GGMVAAAAGVICLSYGVYGWAAFFLVVAALNLAGGYWYLTVAHSVPART |
Ga0210390_110523631 | 3300021474 | Soil | VAAAAGVICLSYGVYGWAAFFLVVAALNFAGGYWYLTVARSAPART |
Ga0210402_120280041 | 3300021478 | Soil | TRIFGGSVAAAAGVVCLAYGVHGWAAFFLVIGALNLGGGYWYLTVDRSALART |
Ga0126371_100716775 | 3300021560 | Tropical Forest Soil | AAAAGLICLSYGVYGWAAFFLIIGALNLAGGSWYLTIDRSASART |
Ga0126371_102905531 | 3300021560 | Tropical Forest Soil | IAGGCLAAIAGVICLSYGVYGWAAFFLVVGALNLAGGSWYLTIDRSASART |
Ga0126371_110012941 | 3300021560 | Tropical Forest Soil | AGLICLSYGVYGWAAFFLVIGALNLAGGCWYLSIVPSESP |
Ga0242669_10308782 | 3300022528 | Soil | ICLSYGVYGWAAFFLVVAALNLAGGYWYLTVAHSVPART |
Ga0242660_10636482 | 3300022531 | Soil | VCLSYGVYGWAAFFLVLAALNLAGGSWYLAIDRSASART |
Ga0222756_10014863 | 3300022709 | Soil | GSIACGAGVICLAYGVYGWAAFFLVIGGLNLGAGYWDLAIVRSGPARTWA |
Ga0222756_10391342 | 3300022709 | Soil | AGGIAAAAAGVICLSYGVFGYAALFLVVAALNLAGGYWYLTVAHSVPART |
Ga0242665_100644101 | 3300022724 | Soil | GAGVICLSYGVYGWAAFFLVVAGLNLAGGYWDITIARSAPART |
Ga0208194_10748362 | 3300025412 | Peatland | IGGSVAAAAGLTCAAYGAYGWAAFFLVIGALNLAGGYWFVTIARSAAGRT |
Ga0208821_10521492 | 3300025432 | Peatland | VAVVVGLICLAYSGYGWAALFLVIAALNIAWGCWDLAIARSAAART |
Ga0208714_10192964 | 3300025527 | Arctic Peat Soil | AAVAGFICLAYGGYGWAAFFLVVGALSIAHGCWDLAIARSASART |
Ga0208589_11061711 | 3300025634 | Arctic Peat Soil | CLSYGVYGWAAFFGVIAALNLAGGSWYITIDRSASART |
Ga0209385_11230581 | 3300025650 | Arctic Peat Soil | VGVGIGAFILSYSAYGWAALFLVIGALNLACGYWYLTVARSASART |
Ga0207647_102068733 | 3300025904 | Corn Rhizosphere | MCLSYGVKGWAAFFLIIGALNLAGGSWYITIDRSAPA |
Ga0207699_101972081 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGCVAAAAGVICLSYGVYGWAAFFLILAALNLAGGYWFLTIARSASART |
Ga0207684_100350348 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ICLAYGVYGWAAFFLVLAAGNLAGGYWYLTIDRSASART |
Ga0207693_110152372 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | CLAYGAYGWAAFFLLLGALNLAGGYWYLTIARSRSARA |
Ga0207665_107987301 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GGCVAAAAGVICLSYGVYGWAAFFLILAALNLAGGYWFLTIARSASART |
Ga0209871_10828091 | 3300026217 | Permafrost Soil | SVAAAAGVVCLSYGVYGWAAFFLVLGALNLAGGSWFITIARSASART |
Ga0209648_102503583 | 3300026551 | Grasslands Soil | MPAWPAGVICLAYGAYAWAAFFLVIGALNLAGGYWYLTIDRSAQART |
Ga0207853_10169531 | 3300026947 | Tropical Forest Soil | LAYVGYAWAAFFLVLAALAFAGGFWYLATARSSSLRA |
Ga0208366_10041461 | 3300027073 | Forest Soil | GVICLAYGAYAWAAFFLVIGALNLAGGYWYLTIDRSAPART |
Ga0209420_10880391 | 3300027648 | Forest Soil | AGVICVAYEAYDWAAFFLAIGALNLGGGYWYLTIDRSAAAPA |
Ga0209007_10242721 | 3300027652 | Forest Soil | LAYDAYDWAAFFLVVGALNLAGGGWYVTVARSEAART |
Ga0209799_11027731 | 3300027654 | Tropical Forest Soil | TRIAGGSLAAAAGVVCLAYGVYGWAAFFLGIGAANLAGGYWYLTIDRSAPART |
Ga0208565_10209603 | 3300027662 | Peatlands Soil | GLVCLSYGVYGWAAFFLIIGALNLAGGYWYITIARSARRAH |
Ga0209517_102806302 | 3300027854 | Peatlands Soil | MRIAGGGVTGAAGVVCLSYGVYGWAAFFLVIAALNLAGGCWYLTIARS |
Ga0209693_102278143 | 3300027855 | Soil | VCLAYGVNGWAAFFLAIAALNLAGGYWYLTIDRSATVPA |
Ga0209465_102632662 | 3300027874 | Tropical Forest Soil | LVCLSYGVYGWAAFFLVVGALNLAGGYWYLTIDRSAPALT |
Ga0209169_101609652 | 3300027879 | Soil | LMRIAGGSVAAGAGVICLSYGVYGWAAFFLALAAGNFAGGSWYLTIDRSAAART |
Ga0209380_100594501 | 3300027889 | Soil | VAAAAGVICLSYSVYGWAAFFLVIAALNLAGGSWYLSIARSASART |
Ga0209068_106529942 | 3300027894 | Watersheds | VTAGLVCLSYAAYGWAAFLLAVGVLNLAAGRWYTAIARSSPPRA |
Ga0209624_101476363 | 3300027895 | Forest Soil | FICLSHGAYGWAAFFLVIGALNLAGGSWYLTIDRSASARI |
Ga0209006_111268831 | 3300027908 | Forest Soil | VVCLAYGVHGWAAFFLVIGALNLGGGYWYLTVDRSAPART |
Ga0307293_101374992 | 3300028711 | Soil | TRIAGGGVAAAAGVVCLSYGVNGWAAFFLVLGALNFAGGSWYITIARSAPAGT |
Ga0302231_102358851 | 3300028775 | Palsa | WVAHIAGGSVAAAAGVICLGYGVYGWAAFFLAVAAAHLAGGYWFLTIDRSAPART |
Ga0302232_105294652 | 3300028789 | Palsa | AAAAGVVCLSYGVYGWAAFFGVLGALNPGGGYWYITIARSGPARA |
Ga0302226_101371661 | 3300028801 | Palsa | AGGTVAAAAGVVCLSYGVYGWAAFFLVLAALNLAGGYWYITIARSASART |
Ga0302229_105104132 | 3300028879 | Palsa | AGGAVAAAAGVICLSYGVYGFAALFLVLGALNLAGGWWYITIARSEPAPA |
Ga0308309_100341824 | 3300028906 | Soil | VVCLAYGVYGWAAFFLVLGTLNLADGYWYLTVARSTSAAA |
Ga0308309_108195671 | 3300028906 | Soil | AGGSLAAAAGLICLGYGVYGWTAFFLVIAALNLAGGYWYLSIARSTSAQA |
Ga0311340_106346672 | 3300029943 | Palsa | GASGATAGRAAFFLALGAVNLGGGYWHLTVDRSASARA |
Ga0311371_106169412 | 3300029951 | Palsa | VCLAYDADGWAAFFLTISALNLAGGYWYLTIDATTTPVT |
Ga0311339_102647591 | 3300029999 | Palsa | MVSIVGGSVAAAAGVVCLSYGVYGWAAFFGVLGALNPGGGYWYITIARSGPARA |
Ga0311338_100691361 | 3300030007 | Palsa | AAGLVCLAYSADGWAAFFLAIAALNLAGGYWYLTIDRSASART |
Ga0302178_101598392 | 3300030013 | Palsa | AAAAGVVCLSYDVCGWAAFFLNVGALDLAGGSWYITIAHSASART |
Ga0302177_105321551 | 3300030053 | Palsa | IAGGSVAAAAGVICLSYGVYGWAAFFLVIGALNLAGGSWYLTIARSASARA |
Ga0302196_103972001 | 3300030225 | Bog | IGAAAGGLCLAYSAVGWAAFFLAIGLANLACGSWYIHIARATIA |
Ga0310037_103508661 | 3300030494 | Peatlands Soil | AIAGVVCLSYAAYGWAAFFLVVGVLNLAGGYWYITIARSTPPQA |
Ga0311357_101002585 | 3300030524 | Palsa | AAAAGVVCLSYGAYGWAAFFLVLGALNLAGGYWYLTIARSQAARA |
Ga0311357_113068012 | 3300030524 | Palsa | AGGAVAAAAGVVCLSYGVYGFAALFLVLGALNLAGGWWYITIARSEPAPA |
Ga0311355_109086213 | 3300030580 | Palsa | IRLAGGAVAATAGVICLSYGVYGFAALFLVLGALNLAGGWWYITIARSEPAPA |
Ga0210253_109888532 | 3300030603 | Soil | VCLAYDADGWAAFFLTISALNLAGGYWYLTIDATT |
Ga0311356_105192872 | 3300030617 | Palsa | VSIVGGSVAAAAGVVCLSYGVYGWAAFFGVLGALNPGGGYWYITIARSGPARA |
Ga0311356_118858231 | 3300030617 | Palsa | AYSVWGWAAFFLVIAALNFGGGAWYLSIVRARTARA |
Ga0310038_104730572 | 3300030707 | Peatlands Soil | ICLAYGGYGWAAFFLVVAALSIAHGCWDLAIARSASART |
Ga0265460_130943072 | 3300030740 | Soil | RIAGGSVAAGAGLICLAYGVYGWAAFFLVVAALNFGGGYWYLSIDRSAPART |
Ga0265461_113669612 | 3300030743 | Soil | VCLAYDADGWAAFFLTISALNLAGRYWYLTIDATTTPVT |
Ga0265773_10361031 | 3300031018 | Soil | ICLAYGVYGWAAFFLILGALNLAGGSWYLSIARSASSRA |
Ga0302325_125057301 | 3300031234 | Palsa | VVCLSYGVYGWAAFFLVIGALNLAGGYRYLTIARSTSTRN |
Ga0302324_1020854241 | 3300031236 | Palsa | MAGGCVAAAAGLICLSYGVYGWAAFFLAIAALNLGGGSWYLTLARSAPARP |
Ga0302326_109701241 | 3300031525 | Palsa | RIAGGSVAAAAAVVCLSYGVYEWAAFFLALGALNIAGGYWYITIARSAPPRA |
Ga0302326_119211962 | 3300031525 | Palsa | VAAGASVICFSYAVYGWAAFFGVIAALNLAGGSWYITIDRSAAA |
Ga0318541_107194721 | 3300031545 | Soil | RIAGGSVAAAAGIVCLSYGVHGWAAFFLVLAALNLAGGYWYLTITRSASART |
Ga0318528_104816241 | 3300031561 | Soil | RIAGGTVAAAAGVVCLSYGVYGWAAFFLVLAALNLAGGYWYLTIARSAPARPV |
Ga0318515_103564091 | 3300031572 | Soil | VMRVFGGCAAAGAGLICLAYGVHGWAAFFLVIAALNLAGGYWELAVARSASARA |
Ga0307374_106521922 | 3300031670 | Soil | YGVYGWAAFFLVLGALNLAGGSWYINIARSASPRT |
Ga0307373_105266303 | 3300031672 | Soil | ILSYSAYGWAAFFLVLEALNLAAGYWYLTITRSASPRT |
Ga0310686_1054538782 | 3300031708 | Soil | ATAGVICLSYVAYGWGAFFLVGAALALVCGYWYLTIDPSARART |
Ga0310686_1128739802 | 3300031708 | Soil | RIAGSFVAATAGVVCLSYAAYGWGAFFLVVGVLNLAGGYWYITIARSSPPRA |
Ga0310686_1143875175 | 3300031708 | Soil | ATAGVICLAYGVYGWAAFFLVLGALNLAGGFWYLTITRSASART |
Ga0318496_105496703 | 3300031713 | Soil | RVAGGSVAAGAGVVCLSYGVYGWAAFFLVIGALNLAGGSWYLTIDRSASART |
Ga0318496_108040831 | 3300031713 | Soil | VYGWAAFFLIIGALNLAGGYWYLTIPRSGRQCLAG |
Ga0307476_106091731 | 3300031715 | Hardwood Forest Soil | AGVVCLAYGAYPWAAFFLILGALNLGGGYWYLTIDRSASAQA |
Ga0310813_101821013 | 3300031716 | Soil | AAVGVVCLSYRVYGWAAFFLALGALNLAGGYWYMTLARSASARP |
Ga0318493_104258852 | 3300031723 | Soil | ICLAYDVYGWAAFFLVLGALNLGGGYWYLTIDRSVPART |
Ga0318493_106869521 | 3300031723 | Soil | SYGVYGWAAFFLVLGALNLAGGYWFLSIARSASART |
Ga0306918_104376252 | 3300031744 | Soil | AAAAVVCLAYGVYGWATFFLGLGALNLAGGSWYLTIARSAPART |
Ga0306918_113622121 | 3300031744 | Soil | GSVAAAAGVICLAYGVYGWAAFFLVVGALNLAGGYWYLSIDRSAPART |
Ga0318494_100319341 | 3300031751 | Soil | FGGMHTVGGGVAAAAAVVCLAYGVYGWATFFLGLGALNLAGGSWYLTIARSAPART |
Ga0318494_102616771 | 3300031751 | Soil | SYGVYGWAAFFLVLGALNLAGGYWYLTIARSASARA |
Ga0318554_107525242 | 3300031765 | Soil | AAAAGVVGLSHGVCGWAAFFLAIGVLNLAGGYWYLTIPRSAFART |
Ga0318547_108401292 | 3300031781 | Soil | LGYGVYGWAAFFLILAALNLAGGCWYITIDRSASARA |
Ga0318523_104591541 | 3300031798 | Soil | GVVCLSYGVYGWAAFFLVLAALNLAGGYWYLTIARSAPARPV |
Ga0318568_105815092 | 3300031819 | Soil | RVAGGSVAAGAGIVCLSYGVYGWAAFFLALGALNLAGGYWYLTIDGSAPAGT |
Ga0318499_100757723 | 3300031832 | Soil | GLICLSYGVYGWAAFFLVLGALNLAGGYWYLTIARSASARA |
Ga0318499_103038552 | 3300031832 | Soil | VAASAGVVCLSYGVYGWAAFFLVLAALNLAGGYWYLTIARSAPARPV |
Ga0318495_104163892 | 3300031860 | Soil | TVAASAGVVCLSYGVYGWAAFFLVLAALNLAGGYWYLTIARSAPARPV |
Ga0306925_106277521 | 3300031890 | Soil | SYGVHGWAAFFLVLAALNLAGGYWYLTITRSASART |
Ga0318551_104848431 | 3300031896 | Soil | LICLSYDVYGWAAFFLVIGALNLAGGYWFLTVDRSAPART |
Ga0318520_106632292 | 3300031897 | Soil | CLSSGVYGWAAFFLVLGALNLAGGYWYLTIARSASARA |
Ga0310916_107290441 | 3300031942 | Soil | AAVVCLAYGVYGWATFFLGLGALNLAGGSWYLTIARSAPART |
Ga0310916_109784512 | 3300031942 | Soil | ICLSYGVYGWAAFFLVLGALNLAGGYWFLSIARSASART |
Ga0306922_109324892 | 3300032001 | Soil | AVVCLAYGVYGWATFFLGLGALNLAGGSWYLTIARSAPART |
Ga0318569_100820353 | 3300032010 | Soil | ATRIAGGIVAAAAGVVCLSYGVYGWATFFLVVGALNLAGGSWYLTVARSAPART |
Ga0318569_105167332 | 3300032010 | Soil | SYGVYGWAAFFLVLAALNLAGGYWYLTIARSAPARPV |
Ga0318569_106077581 | 3300032010 | Soil | IVCLSYGVHGWAAFFLVLAALNLAGGYWYLTITRSASART |
Ga0318507_101584572 | 3300032025 | Soil | RIAGGSVAAAAGVICLAYGVYGWAAFFLVLAALNLAGGYWYLTIARSAPARPV |
Ga0318549_102475271 | 3300032041 | Soil | AYGVHGWAAFFLVIAALNLAGGYWELAVARSASARA |
Ga0318505_102013311 | 3300032060 | Soil | ICLSYGVYGWATFFLVIGALNLAGGSWYLTIDNSAPA |
Ga0318505_106353791 | 3300032060 | Soil | ILGTAAGLICLSYGVYGWAAFFLVLGALNLAGGYWYLTIARSASARA |
Ga0318504_105999051 | 3300032063 | Soil | LAYSVYGWAAFFLVLGALNLAGGYWFLTIARSRSVRT |
Ga0318513_102240481 | 3300032065 | Soil | LICLSYGVYGWAAFFLVLGALNLAGGYWYLTIARSASARA |
Ga0318513_103979412 | 3300032065 | Soil | LICLSYDVYGWAAFFLVIGALNLAGGYWFLTVDRSAPARS |
Ga0318514_101417172 | 3300032066 | Soil | AYGVYGWAAFFLVLAALNLAGGYWYLTIARSASART |
Ga0308173_114301571 | 3300032074 | Soil | VCLAYGAYGWAALFLVIGALNLAGGYWYLTIARSSPART |
Ga0318525_102435691 | 3300032089 | Soil | MHTVGGGVAAAAAVVCLAYGVYGWATFFLGLGALNLAGGSWYLTIARSAPART |
Ga0318525_104211461 | 3300032089 | Soil | VAAAASLICLSYGVYGWAAFFLVIGALNLAGGYWFLTIARSASARA |
Ga0318525_107373231 | 3300032089 | Soil | VVAAAAGVVCLWYGAYAWAAFFLALGALDLGGGYWYLTIAGSAAAREARTGD |
Ga0318577_101224451 | 3300032091 | Soil | TVAASAGVVCLSYGVYGWAAFFMVLAALNLAGGYWYLTIARSAPARPV |
Ga0316040_1102553 | 3300032121 | Soil | VAAAAGVVCLSYGVYGWAAFFLVLAALNLSGGYWYTTIARSAPART |
Ga0311301_115993871 | 3300032160 | Peatlands Soil | IAGGIVAAVPGLICLSYGVYGWAAFFLALAALNLAGGYWFLTIARSAPTRTWA |
Ga0311301_116351072 | 3300032160 | Peatlands Soil | IAGGTIAAAAGVICLAYGVYAWAAFFLIIGALNLAGGSWYLTIARSEPART |
Ga0311301_116532472 | 3300032160 | Peatlands Soil | FGGSLAAAAGVVCLAYGVYGWAAFFLVVGALNLAGGYWYITIARSASART |
Ga0307470_104434401 | 3300032174 | Hardwood Forest Soil | AGGSIAAAAGIVCLAYGAYPWAAFFLILGALNLGGGYWYLTIDRSASART |
Ga0307471_1008852193 | 3300032180 | Hardwood Forest Soil | SVQAAAGLVCLSYRVYGWAAFFLVIASLNLAGGYWYLTIDRSASARA |
Ga0306920_1014215192 | 3300032261 | Soil | CLSYGVYGWAAFFLVLGALNLAGGYWYLTIARSASARA |
Ga0348332_108253462 | 3300032515 | Plant Litter | VCAAAGLICLSFGVHSWAAFFLVLGALHLAGGSWYLTIARSASART |
Ga0348332_140843392 | 3300032515 | Plant Litter | YGVYGWAAFFLVIAALNLAGGYWYLSVARSAPARTWT |
Ga0335085_114560702 | 3300032770 | Soil | VVCLSYGVYGWAAFFLVLASLNLAGGYWYLTITRSASPQT |
Ga0335079_100485681 | 3300032783 | Soil | LSYDAYGWAAFFLVLASLNLAGGYWYLTITRSACPQT |
Ga0335079_103769241 | 3300032783 | Soil | VICLAYGAYGWAAFFLVIAALNLAGGYWFLTIARSASART |
Ga0335070_115035612 | 3300032829 | Soil | AAGIICLAYGVYGWAAFFLVIGALNLGGGYWYLTIDRSVHA |
Ga0335081_106835871 | 3300032892 | Soil | AAAGIICLGYGVYGWAAFFLVIGALNLAGGYWYLTIDRSASARA |
Ga0335081_120731251 | 3300032892 | Soil | VFILSYSAYGWAALFLVLGALNLAGGYWYLTIARSSSGRT |
Ga0335081_121082562 | 3300032892 | Soil | RMADAAAGSVYGWAAFFLVLGTLNLAGGYWYITVARSAPART |
Ga0335081_122241832 | 3300032892 | Soil | VAGLICLSYSAYAWAAFFLIIGALNLGGGYWELTLARDTPART |
Ga0335074_101355616 | 3300032895 | Soil | MTPFTIPPVAGLICLSYGVYGWAAFFLAIEALHVAGGFWYLSIAGSAPARA |
Ga0335074_101953601 | 3300032895 | Soil | GTIQAAAGLICLSYGAHGWAAFFLGIAALNLAGGIWYLSIASSASASASAPA |
Ga0335074_108027222 | 3300032895 | Soil | GTMRVAGGSVAALAGFICLAYGVYGWAAFFLAIGAANFAGGCWYLSIHTSAPGQP |
Ga0335074_108103802 | 3300032895 | Soil | MAGGGVAAAAGVICLSYAAYGWAAFFLAIAALNLAGGYWYLTIAR |
Ga0335074_112148652 | 3300032895 | Soil | GGSVAAAAGLICLSYGVYGWAAFFLLVAALNLAGGFWYLTIDHSARART |
Ga0335075_100352519 | 3300032896 | Soil | MTPFTIPPVAGLICLSYGVYGWAAFFLAIEALHVAGGFWYLSVAGSAPARA |
Ga0335075_102911373 | 3300032896 | Soil | MNAPGAGVACLSYRVYGWAAFFLVIGGLNIAGGYWYLTIDRSASAGS |
Ga0335075_104493661 | 3300032896 | Soil | LSYGVSGWAAFFLVLGALNLAGGSWYLTVSRSGSART |
Ga0335072_103474662 | 3300032898 | Soil | MNAPGAGVACLSYRVYGWAAFFLVIGGLNLAGGYWYLTIDRSASAGS |
Ga0335073_103242334 | 3300033134 | Soil | GLICLSYGVYGWAAFFLVIAGLNLAGGCWYLTIARSASARS |
Ga0335073_103548844 | 3300033134 | Soil | VAATAGLICLSYGVYGWAAFFLVVAALNLGGGCWYLTIDRSAAARA |
Ga0335073_109253841 | 3300033134 | Soil | VLAAAGVICLSYGVYGWAAFLLVLGALNLAGGSWYLTVARSASARA |
Ga0335073_112160871 | 3300033134 | Soil | HIAGGSVLAAAGFICLSYGVYGWAAFFLAFGALNLAGGFWYLTVARSATVRT |
Ga0335073_115323811 | 3300033134 | Soil | ICLSYQVYGWAAFFLVIGGLHIAGGYWYLTIDRTASAGA |
Ga0318519_108267572 | 3300033290 | Soil | YSVYGWAAFFLVLGALNLAGGYWFLTIARSRSVRT |
Ga0316212_10129941 | 3300033547 | Roots | CLAYNAYGWAAFFLVVAALDIAWGYWDLGIDRSART |
Ga0370483_0081560_43_198 | 3300034124 | Untreated Peat Soil | MAGGSIAAAAGLICLSYGVYGWAAFFLVVAALSLAAGYWYLTIARSASART |
⦗Top⦘ |