| Basic Information | |
|---|---|
| Family ID | F010202 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 307 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MSTAKRPGMPRYLRKPLIARTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Number of Associated Samples | 228 |
| Number of Associated Scaffolds | 307 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.15 % |
| % of genes near scaffold ends (potentially truncated) | 26.38 % |
| % of genes from short scaffolds (< 2000 bps) | 71.99 % |
| Associated GOLD sequencing projects | 205 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.919 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.150 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.876 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.739 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.79% β-sheet: 0.00% Coil/Unstructured: 92.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 307 Family Scaffolds |
|---|---|---|
| PF03331 | LpxC | 44.30 |
| PF12327 | FtsZ_C | 36.16 |
| PF14450 | FtsA | 2.93 |
| PF05258 | DciA | 2.93 |
| PF07517 | SecA_DEAD | 2.28 |
| PF01551 | Peptidase_M23 | 1.63 |
| PF07478 | Dala_Dala_lig_C | 1.63 |
| PF08478 | POTRA_1 | 0.98 |
| PF03884 | YacG | 0.65 |
| PF02581 | TMP-TENI | 0.33 |
| PF00326 | Peptidase_S9 | 0.33 |
| PF02873 | MurB_C | 0.33 |
| PF01960 | ArgJ | 0.33 |
| PF13231 | PMT_2 | 0.33 |
| PF07072 | ZapD | 0.33 |
| PF02517 | Rce1-like | 0.33 |
| PF00154 | RecA | 0.33 |
| PF05673 | DUF815 | 0.33 |
| PF00144 | Beta-lactamase | 0.33 |
| PF01578 | Cytochrom_C_asm | 0.33 |
| PF01746 | tRNA_m1G_MT | 0.33 |
| PF06906 | DUF1272 | 0.33 |
| COG ID | Name | Functional Category | % Frequency in 307 Family Scaffolds |
|---|---|---|---|
| COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 44.30 |
| COG5512 | Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives) | General function prediction only [R] | 2.93 |
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 2.28 |
| COG4775 | Outer membrane protein assembly factor BamA | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG1589 | Cell division septal protein FtsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.98 |
| COG3024 | Endogenous inhibitor of DNA gyrase, YacG/DUF329 family | Replication, recombination and repair [L] | 0.65 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.33 |
| COG4582 | Cell division protein ZapD, interacts with FtsZ | Cell cycle control, cell division, chromosome partitioning [D] | 0.33 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.33 |
| COG3813 | Uncharacterized conserved protein, DUF1272 domain | Function unknown [S] | 0.33 |
| COG2607 | Predicted ATPase, AAA+ superfamily | General function prediction only [R] | 0.33 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.33 |
| COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 0.33 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.33 |
| COG1364 | Glutamate N-acetyltransferase (ornithine transacetylase) | Amino acid transport and metabolism [E] | 0.33 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.33 |
| COG0812 | UDP-N-acetylenolpyruvoylglucosamine reductase | Cell wall/membrane/envelope biogenesis [M] | 0.33 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.33 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.92 % |
| Unclassified | root | N/A | 25.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10141561 | Not Available | 1270 | Open in IMG/M |
| 3300002558|JGI25385J37094_10007067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira oryzae | 3970 | Open in IMG/M |
| 3300002562|JGI25382J37095_10020949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 2534 | Open in IMG/M |
| 3300002886|JGI25612J43240_1025896 | Not Available | 864 | Open in IMG/M |
| 3300002906|JGI25614J43888_10008859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira oryzae | 3259 | Open in IMG/M |
| 3300002906|JGI25614J43888_10060757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 1103 | Open in IMG/M |
| 3300002906|JGI25614J43888_10132810 | Not Available | 654 | Open in IMG/M |
| 3300002911|JGI25390J43892_10010705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2139 | Open in IMG/M |
| 3300002917|JGI25616J43925_10000432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 14899 | Open in IMG/M |
| 3300003152|Ga0052254_1010077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 579 | Open in IMG/M |
| 3300004633|Ga0066395_10154630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1165 | Open in IMG/M |
| 3300004633|Ga0066395_10686988 | Not Available | 607 | Open in IMG/M |
| 3300005163|Ga0066823_10047308 | Not Available | 767 | Open in IMG/M |
| 3300005165|Ga0066869_10003550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 1849 | Open in IMG/M |
| 3300005166|Ga0066674_10022706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 2723 | Open in IMG/M |
| 3300005166|Ga0066674_10190711 | Not Available | 974 | Open in IMG/M |
| 3300005174|Ga0066680_10157901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira oryzae | 1421 | Open in IMG/M |
| 3300005176|Ga0066679_10553157 | Not Available | 750 | Open in IMG/M |
| 3300005177|Ga0066690_10043545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 2703 | Open in IMG/M |
| 3300005177|Ga0066690_10128246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1653 | Open in IMG/M |
| 3300005178|Ga0066688_10080333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1956 | Open in IMG/M |
| 3300005205|Ga0068999_10040744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
| 3300005206|Ga0068995_10000617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 3095 | Open in IMG/M |
| 3300005213|Ga0068998_10147254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 560 | Open in IMG/M |
| 3300005218|Ga0068996_10033272 | Not Available | 922 | Open in IMG/M |
| 3300005332|Ga0066388_102404129 | Not Available | 956 | Open in IMG/M |
| 3300005332|Ga0066388_102713860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 904 | Open in IMG/M |
| 3300005434|Ga0070709_10113682 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300005440|Ga0070705_100619306 | Not Available | 840 | Open in IMG/M |
| 3300005446|Ga0066686_10236870 | Not Available | 1230 | Open in IMG/M |
| 3300005450|Ga0066682_10541598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 737 | Open in IMG/M |
| 3300005518|Ga0070699_100363943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1304 | Open in IMG/M |
| 3300005542|Ga0070732_10004135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 7828 | Open in IMG/M |
| 3300005545|Ga0070695_100209847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1397 | Open in IMG/M |
| 3300005549|Ga0070704_100032029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 3542 | Open in IMG/M |
| 3300005552|Ga0066701_10016885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3525 | Open in IMG/M |
| 3300005555|Ga0066692_10398206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 873 | Open in IMG/M |
| 3300005556|Ga0066707_10058578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 2259 | Open in IMG/M |
| 3300005557|Ga0066704_10228225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1263 | Open in IMG/M |
| 3300005559|Ga0066700_10088159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 2007 | Open in IMG/M |
| 3300005568|Ga0066703_10048502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 2370 | Open in IMG/M |
| 3300005568|Ga0066703_10149122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1404 | Open in IMG/M |
| 3300005586|Ga0066691_10140473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1383 | Open in IMG/M |
| 3300005713|Ga0066905_100267982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1323 | Open in IMG/M |
| 3300005713|Ga0066905_100693443 | Not Available | 873 | Open in IMG/M |
| 3300005764|Ga0066903_104308393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 761 | Open in IMG/M |
| 3300005764|Ga0066903_107410495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 567 | Open in IMG/M |
| 3300005764|Ga0066903_107482582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300005829|Ga0074479_10041960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 18724 | Open in IMG/M |
| 3300005829|Ga0074479_11077273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2211 | Open in IMG/M |
| 3300005830|Ga0074473_10039199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 3270 | Open in IMG/M |
| 3300005833|Ga0074472_11097337 | Not Available | 1678 | Open in IMG/M |
| 3300005836|Ga0074470_10435513 | Not Available | 1444 | Open in IMG/M |
| 3300005875|Ga0075293_1004970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1345 | Open in IMG/M |
| 3300006041|Ga0075023_100023238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1751 | Open in IMG/M |
| 3300006041|Ga0075023_100179376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
| 3300006046|Ga0066652_100563950 | Not Available | 1068 | Open in IMG/M |
| 3300006046|Ga0066652_101303132 | Not Available | 685 | Open in IMG/M |
| 3300006047|Ga0075024_100867983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 510 | Open in IMG/M |
| 3300006050|Ga0075028_100958313 | Not Available | 530 | Open in IMG/M |
| 3300006102|Ga0075015_100936400 | Not Available | 527 | Open in IMG/M |
| 3300006163|Ga0070715_11097716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 501 | Open in IMG/M |
| 3300006172|Ga0075018_10326905 | Not Available | 763 | Open in IMG/M |
| 3300006173|Ga0070716_101239978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 600 | Open in IMG/M |
| 3300006755|Ga0079222_10083471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 1620 | Open in IMG/M |
| 3300006755|Ga0079222_10339867 | Not Available | 1007 | Open in IMG/M |
| 3300006903|Ga0075426_10004619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 9773 | Open in IMG/M |
| 3300006903|Ga0075426_10053195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2893 | Open in IMG/M |
| 3300006903|Ga0075426_10737575 | Not Available | 740 | Open in IMG/M |
| 3300006954|Ga0079219_10045085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1860 | Open in IMG/M |
| 3300007255|Ga0099791_10187109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 974 | Open in IMG/M |
| 3300007258|Ga0099793_10067140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1613 | Open in IMG/M |
| 3300007258|Ga0099793_10261611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 837 | Open in IMG/M |
| 3300007788|Ga0099795_10441165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 598 | Open in IMG/M |
| 3300009038|Ga0099829_10217145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1552 | Open in IMG/M |
| 3300009038|Ga0099829_10964038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 707 | Open in IMG/M |
| 3300009088|Ga0099830_10017782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4556 | Open in IMG/M |
| 3300009088|Ga0099830_10834283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 761 | Open in IMG/M |
| 3300009088|Ga0099830_11759344 | Not Available | 517 | Open in IMG/M |
| 3300009089|Ga0099828_10132641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2188 | Open in IMG/M |
| 3300009089|Ga0099828_10338565 | Not Available | 1355 | Open in IMG/M |
| 3300009089|Ga0099828_10686700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 920 | Open in IMG/M |
| 3300009090|Ga0099827_10042572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 3367 | Open in IMG/M |
| 3300009090|Ga0099827_11030740 | Not Available | 714 | Open in IMG/M |
| 3300009090|Ga0099827_11255413 | Not Available | 644 | Open in IMG/M |
| 3300009090|Ga0099827_11760224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300009137|Ga0066709_101640978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 917 | Open in IMG/M |
| 3300009137|Ga0066709_102357733 | Not Available | 726 | Open in IMG/M |
| 3300009137|Ga0066709_103349185 | Not Available | 583 | Open in IMG/M |
| 3300009678|Ga0105252_10000175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 50541 | Open in IMG/M |
| 3300009792|Ga0126374_11160205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 616 | Open in IMG/M |
| 3300010046|Ga0126384_10895367 | Not Available | 801 | Open in IMG/M |
| 3300010047|Ga0126382_10738572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 831 | Open in IMG/M |
| 3300010301|Ga0134070_10030700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1778 | Open in IMG/M |
| 3300010304|Ga0134088_10499066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 599 | Open in IMG/M |
| 3300010322|Ga0134084_10308414 | Not Available | 590 | Open in IMG/M |
| 3300010329|Ga0134111_10121018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1018 | Open in IMG/M |
| 3300010337|Ga0134062_10469478 | Not Available | 628 | Open in IMG/M |
| 3300010358|Ga0126370_10200199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → unclassified Azospira → Azospira sp. | 1508 | Open in IMG/M |
| 3300010358|Ga0126370_10567056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 973 | Open in IMG/M |
| 3300010359|Ga0126376_10233764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1551 | Open in IMG/M |
| 3300010360|Ga0126372_11297433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 757 | Open in IMG/M |
| 3300010360|Ga0126372_11819469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 653 | Open in IMG/M |
| 3300010361|Ga0126378_12074857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 648 | Open in IMG/M |
| 3300010362|Ga0126377_10332994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1509 | Open in IMG/M |
| 3300010362|Ga0126377_11048345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 883 | Open in IMG/M |
| 3300010362|Ga0126377_13273601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 524 | Open in IMG/M |
| 3300010366|Ga0126379_10454239 | Not Available | 1343 | Open in IMG/M |
| 3300010376|Ga0126381_100763618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1386 | Open in IMG/M |
| 3300010398|Ga0126383_11285645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 822 | Open in IMG/M |
| 3300010398|Ga0126383_12401535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 612 | Open in IMG/M |
| 3300011107|Ga0151490_1646396 | Not Available | 531 | Open in IMG/M |
| 3300011269|Ga0137392_10736227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 816 | Open in IMG/M |
| 3300011271|Ga0137393_11051289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 692 | Open in IMG/M |
| 3300011395|Ga0137315_1003192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1618 | Open in IMG/M |
| 3300011397|Ga0137444_1022090 | Not Available | 901 | Open in IMG/M |
| 3300011401|Ga0153984_1043100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 972 | Open in IMG/M |
| 3300011409|Ga0137323_1002070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5247 | Open in IMG/M |
| 3300011414|Ga0137442_1069725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 737 | Open in IMG/M |
| 3300011420|Ga0137314_1007239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3049 | Open in IMG/M |
| 3300011425|Ga0137441_1006636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2140 | Open in IMG/M |
| 3300011427|Ga0137448_1111871 | Not Available | 743 | Open in IMG/M |
| 3300011431|Ga0137438_1011142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2540 | Open in IMG/M |
| 3300011441|Ga0137452_1005521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3825 | Open in IMG/M |
| 3300011442|Ga0137437_1036894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1674 | Open in IMG/M |
| 3300011442|Ga0137437_1106202 | Not Available | 963 | Open in IMG/M |
| 3300011444|Ga0137463_1000453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 14162 | Open in IMG/M |
| 3300011444|Ga0137463_1004517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 4596 | Open in IMG/M |
| 3300011444|Ga0137463_1006480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3912 | Open in IMG/M |
| 3300011444|Ga0137463_1227882 | Not Available | 696 | Open in IMG/M |
| 3300011444|Ga0137463_1300228 | Not Available | 588 | Open in IMG/M |
| 3300011444|Ga0137463_1339710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 542 | Open in IMG/M |
| 3300012034|Ga0137453_1034096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 872 | Open in IMG/M |
| 3300012040|Ga0137461_1002265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4025 | Open in IMG/M |
| 3300012146|Ga0137322_1051137 | Not Available | 626 | Open in IMG/M |
| 3300012189|Ga0137388_10877463 | Not Available | 830 | Open in IMG/M |
| 3300012189|Ga0137388_11813611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 542 | Open in IMG/M |
| 3300012198|Ga0137364_10027521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3588 | Open in IMG/M |
| 3300012199|Ga0137383_10002735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 10885 | Open in IMG/M |
| 3300012199|Ga0137383_10400832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1005 | Open in IMG/M |
| 3300012199|Ga0137383_10431392 | Not Available | 966 | Open in IMG/M |
| 3300012203|Ga0137399_10276629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Novacetimonas → Novacetimonas maltaceti | 1382 | Open in IMG/M |
| 3300012203|Ga0137399_10530916 | Not Available | 988 | Open in IMG/M |
| 3300012204|Ga0137374_10993939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 607 | Open in IMG/M |
| 3300012206|Ga0137380_10000178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 41362 | Open in IMG/M |
| 3300012206|Ga0137380_10629047 | Not Available | 937 | Open in IMG/M |
| 3300012207|Ga0137381_10976238 | Not Available | 731 | Open in IMG/M |
| 3300012285|Ga0137370_10001408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 10000 | Open in IMG/M |
| 3300012354|Ga0137366_10000107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 42947 | Open in IMG/M |
| 3300012355|Ga0137369_10004026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 15008 | Open in IMG/M |
| 3300012357|Ga0137384_11209319 | Not Available | 600 | Open in IMG/M |
| 3300012359|Ga0137385_10195068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1770 | Open in IMG/M |
| 3300012363|Ga0137390_10206365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1952 | Open in IMG/M |
| 3300012683|Ga0137398_10023654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3376 | Open in IMG/M |
| 3300012685|Ga0137397_10002706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 12319 | Open in IMG/M |
| 3300012918|Ga0137396_10320688 | Not Available | 1146 | Open in IMG/M |
| 3300012922|Ga0137394_10175620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1826 | Open in IMG/M |
| 3300012925|Ga0137419_10508164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 957 | Open in IMG/M |
| 3300012929|Ga0137404_10000349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 30125 | Open in IMG/M |
| 3300012929|Ga0137404_10531331 | Not Available | 1052 | Open in IMG/M |
| 3300012930|Ga0137407_10317798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1427 | Open in IMG/M |
| 3300012930|Ga0137407_11067619 | Not Available | 765 | Open in IMG/M |
| 3300012944|Ga0137410_10001067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 18869 | Open in IMG/M |
| 3300012944|Ga0137410_10008563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 6925 | Open in IMG/M |
| 3300012944|Ga0137410_10934395 | Not Available | 735 | Open in IMG/M |
| 3300012944|Ga0137410_11156661 | Not Available | 664 | Open in IMG/M |
| 3300012944|Ga0137410_11236107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 644 | Open in IMG/M |
| 3300012971|Ga0126369_10383300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1438 | Open in IMG/M |
| 3300012972|Ga0134077_10366036 | Not Available | 617 | Open in IMG/M |
| 3300014318|Ga0075351_1069519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 697 | Open in IMG/M |
| 3300014318|Ga0075351_1164437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 538 | Open in IMG/M |
| 3300014865|Ga0180078_1043048 | Not Available | 742 | Open in IMG/M |
| 3300014876|Ga0180064_1106719 | Not Available | 591 | Open in IMG/M |
| 3300015052|Ga0137411_1018753 | Not Available | 1259 | Open in IMG/M |
| 3300015245|Ga0137409_10099365 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
| 3300015245|Ga0137409_10402917 | Not Available | 1184 | Open in IMG/M |
| 3300015245|Ga0137409_10457442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1097 | Open in IMG/M |
| 3300015264|Ga0137403_10234705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1751 | Open in IMG/M |
| 3300017927|Ga0187824_10035021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1520 | Open in IMG/M |
| 3300017939|Ga0187775_10000006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 53728 | Open in IMG/M |
| 3300017944|Ga0187786_10589236 | Not Available | 520 | Open in IMG/M |
| 3300017959|Ga0187779_10045886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2541 | Open in IMG/M |
| 3300017959|Ga0187779_10097196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 1771 | Open in IMG/M |
| 3300017961|Ga0187778_11007183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 577 | Open in IMG/M |
| 3300017966|Ga0187776_11550933 | Not Available | 510 | Open in IMG/M |
| 3300017974|Ga0187777_10566426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 798 | Open in IMG/M |
| 3300017997|Ga0184610_1011269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2254 | Open in IMG/M |
| 3300017997|Ga0184610_1141164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 787 | Open in IMG/M |
| 3300017999|Ga0187767_10171847 | Not Available | 665 | Open in IMG/M |
| 3300018027|Ga0184605_10001388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 7798 | Open in IMG/M |
| 3300018028|Ga0184608_10000270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 13335 | Open in IMG/M |
| 3300018029|Ga0187787_10056412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1173 | Open in IMG/M |
| 3300018031|Ga0184634_10058831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1608 | Open in IMG/M |
| 3300018031|Ga0184634_10251886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300018032|Ga0187788_10263910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 687 | Open in IMG/M |
| 3300018058|Ga0187766_11312001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 528 | Open in IMG/M |
| 3300018059|Ga0184615_10003090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 8940 | Open in IMG/M |
| 3300018059|Ga0184615_10296686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 902 | Open in IMG/M |
| 3300018063|Ga0184637_10038644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 2898 | Open in IMG/M |
| 3300018064|Ga0187773_10000131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 32571 | Open in IMG/M |
| 3300018064|Ga0187773_10226678 | Not Available | 1009 | Open in IMG/M |
| 3300018068|Ga0184636_1004424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3834 | Open in IMG/M |
| 3300018071|Ga0184618_10005364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 3569 | Open in IMG/M |
| 3300018071|Ga0184618_10101907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1127 | Open in IMG/M |
| 3300018084|Ga0184629_10011465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3461 | Open in IMG/M |
| 3300018433|Ga0066667_10019757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3548 | Open in IMG/M |
| 3300018468|Ga0066662_10953914 | Not Available | 846 | Open in IMG/M |
| 3300018482|Ga0066669_11402996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 633 | Open in IMG/M |
| 3300019249|Ga0184648_1265260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 756 | Open in IMG/M |
| 3300019249|Ga0184648_1457166 | Not Available | 771 | Open in IMG/M |
| 3300019880|Ga0193712_1005343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2597 | Open in IMG/M |
| 3300019886|Ga0193727_1017798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2593 | Open in IMG/M |
| 3300019997|Ga0193711_1000137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 13082 | Open in IMG/M |
| 3300019999|Ga0193718_1001276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5401 | Open in IMG/M |
| 3300020021|Ga0193726_1000194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 83153 | Open in IMG/M |
| 3300020022|Ga0193733_1000011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 110194 | Open in IMG/M |
| 3300020170|Ga0179594_10002817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4097 | Open in IMG/M |
| 3300020170|Ga0179594_10013988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2309 | Open in IMG/M |
| 3300021086|Ga0179596_10002711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4920 | Open in IMG/M |
| 3300021560|Ga0126371_10101147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2872 | Open in IMG/M |
| 3300021560|Ga0126371_11944061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 707 | Open in IMG/M |
| 3300021861|Ga0213853_11331807 | Not Available | 679 | Open in IMG/M |
| 3300022195|Ga0222625_1802966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 912 | Open in IMG/M |
| 3300024330|Ga0137417_1066113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 748 | Open in IMG/M |
| 3300025795|Ga0210114_1016703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 1593 | Open in IMG/M |
| 3300025985|Ga0210117_1062078 | Not Available | 637 | Open in IMG/M |
| 3300026054|Ga0208659_1015841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 579 | Open in IMG/M |
| 3300026285|Ga0209438_1054237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1321 | Open in IMG/M |
| 3300026285|Ga0209438_1058004 | Not Available | 1275 | Open in IMG/M |
| 3300026295|Ga0209234_1000306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 16036 | Open in IMG/M |
| 3300026297|Ga0209237_1090364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1373 | Open in IMG/M |
| 3300026297|Ga0209237_1118338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1120 | Open in IMG/M |
| 3300026304|Ga0209240_1155521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 709 | Open in IMG/M |
| 3300026309|Ga0209055_1000757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 22229 | Open in IMG/M |
| 3300026310|Ga0209239_1204034 | Not Available | 708 | Open in IMG/M |
| 3300026313|Ga0209761_1090729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1554 | Open in IMG/M |
| 3300026315|Ga0209686_1170335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 620 | Open in IMG/M |
| 3300026318|Ga0209471_1023755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3064 | Open in IMG/M |
| 3300026318|Ga0209471_1147825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 974 | Open in IMG/M |
| 3300026319|Ga0209647_1037337 | All Organisms → cellular organisms → Bacteria | 2761 | Open in IMG/M |
| 3300026319|Ga0209647_1068686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 1804 | Open in IMG/M |
| 3300026319|Ga0209647_1150170 | Not Available | 986 | Open in IMG/M |
| 3300026320|Ga0209131_1349444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 549 | Open in IMG/M |
| 3300026328|Ga0209802_1060789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1823 | Open in IMG/M |
| 3300026331|Ga0209267_1203350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 754 | Open in IMG/M |
| 3300026464|Ga0256814_1012929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis | 841 | Open in IMG/M |
| 3300026485|Ga0256805_1039317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 600 | Open in IMG/M |
| 3300026524|Ga0209690_1258217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 548 | Open in IMG/M |
| 3300026528|Ga0209378_1317677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 501 | Open in IMG/M |
| 3300026529|Ga0209806_1049249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1987 | Open in IMG/M |
| 3300026532|Ga0209160_1128204 | Not Available | 1229 | Open in IMG/M |
| 3300026536|Ga0209058_1005175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 10256 | Open in IMG/M |
| 3300026548|Ga0209161_10481464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 548 | Open in IMG/M |
| 3300026555|Ga0179593_1019568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 4707 | Open in IMG/M |
| 3300027573|Ga0208454_1001696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 8473 | Open in IMG/M |
| 3300027643|Ga0209076_1062360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1058 | Open in IMG/M |
| 3300027643|Ga0209076_1125962 | Not Available | 723 | Open in IMG/M |
| 3300027671|Ga0209588_1052131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1323 | Open in IMG/M |
| 3300027765|Ga0209073_10044253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1437 | Open in IMG/M |
| 3300027787|Ga0209074_10280370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 659 | Open in IMG/M |
| 3300027821|Ga0209811_10003075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 5449 | Open in IMG/M |
| 3300027842|Ga0209580_10002667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 7656 | Open in IMG/M |
| 3300027862|Ga0209701_10309764 | Not Available | 904 | Open in IMG/M |
| 3300027874|Ga0209465_10255243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 877 | Open in IMG/M |
| 3300027874|Ga0209465_10292061 | Not Available | 817 | Open in IMG/M |
| 3300027874|Ga0209465_10365026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 723 | Open in IMG/M |
| 3300027875|Ga0209283_10333604 | Not Available | 997 | Open in IMG/M |
| 3300027875|Ga0209283_10367332 | Not Available | 942 | Open in IMG/M |
| 3300027882|Ga0209590_10048433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 2355 | Open in IMG/M |
| 3300027882|Ga0209590_10545545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 747 | Open in IMG/M |
| 3300027910|Ga0209583_10100700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1113 | Open in IMG/M |
| 3300027910|Ga0209583_10632409 | Not Available | 549 | Open in IMG/M |
| 3300028792|Ga0307504_10002050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3951 | Open in IMG/M |
| 3300028802|Ga0307503_10097855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1243 | Open in IMG/M |
| 3300028802|Ga0307503_10175462 | Not Available | 995 | Open in IMG/M |
| 3300031170|Ga0307498_10438539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 522 | Open in IMG/M |
| 3300031226|Ga0307497_10000715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 7838 | Open in IMG/M |
| 3300031421|Ga0308194_10024803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 1354 | Open in IMG/M |
| 3300031640|Ga0318555_10292118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 882 | Open in IMG/M |
| 3300031720|Ga0307469_10000006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 207737 | Open in IMG/M |
| 3300031720|Ga0307469_10014757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 4013 | Open in IMG/M |
| 3300031720|Ga0307469_10054147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 2544 | Open in IMG/M |
| 3300031720|Ga0307469_11068983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 757 | Open in IMG/M |
| 3300031720|Ga0307469_11097502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 747 | Open in IMG/M |
| 3300031820|Ga0307473_10244537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1096 | Open in IMG/M |
| 3300031941|Ga0310912_10223811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1443 | Open in IMG/M |
| 3300031965|Ga0326597_10571366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1216 | Open in IMG/M |
| 3300032163|Ga0315281_10038165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 5996 | Open in IMG/M |
| 3300032163|Ga0315281_10709188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1047 | Open in IMG/M |
| 3300032180|Ga0307471_100469788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Novacetimonas → Novacetimonas maltaceti | 1401 | Open in IMG/M |
| 3300032205|Ga0307472_101457406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 666 | Open in IMG/M |
| 3300032770|Ga0335085_10002339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 35782 | Open in IMG/M |
| 3300033004|Ga0335084_10055543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4087 | Open in IMG/M |
| 3300033433|Ga0326726_10045630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 3831 | Open in IMG/M |
| 3300033500|Ga0326730_1027760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1154 | Open in IMG/M |
| 3300033502|Ga0326731_1020114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1630 | Open in IMG/M |
| 3300033810|Ga0314872_015033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 632 | Open in IMG/M |
| 3300033811|Ga0364924_019025 | Not Available | 1342 | Open in IMG/M |
| 3300033811|Ga0364924_128869 | Not Available | 588 | Open in IMG/M |
| 3300033812|Ga0364926_019924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1198 | Open in IMG/M |
| 3300033813|Ga0364928_0181400 | Not Available | 524 | Open in IMG/M |
| 3300033814|Ga0364930_0337690 | Not Available | 505 | Open in IMG/M |
| 3300034114|Ga0364938_131016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 507 | Open in IMG/M |
| 3300034149|Ga0364929_0002611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4398 | Open in IMG/M |
| 3300034150|Ga0364933_196427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 530 | Open in IMG/M |
| 3300034164|Ga0364940_0213661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 566 | Open in IMG/M |
| 3300034643|Ga0370545_168594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 511 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.47% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.23% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.91% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.93% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.28% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.95% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.63% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.65% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.33% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.33% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.33% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.33% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.33% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011395 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2 | Environmental | Open in IMG/M |
| 3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
| 3300011401 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA068 MetaG | Host-Associated | Open in IMG/M |
| 3300011409 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011425 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2 | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012146 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
| 3300014876 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026054 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026464 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS5 | Environmental | Open in IMG/M |
| 3300026485 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 F6 | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| 3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
| 3300033810 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_101415611 | 3300001661 | Forest Soil | MSTAKRPGMPRYLLRRPLIARTSTSVREPIRTAPVLIR |
| JGI25385J37094_100070673 | 3300002558 | Grasslands Soil | MSTAKRPGMPRYLRKPLIARTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| JGI25382J37095_100209493 | 3300002562 | Grasslands Soil | MSTAKRPGMPRYLRRPLIARTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| JGI25612J43240_10258962 | 3300002886 | Grasslands Soil | MPRYLLRRPLIARTSTSVREPIRTAPVLIRTVAFVPAYLRKRPH* |
| JGI25614J43888_100088595 | 3300002906 | Grasslands Soil | MSTAKRPGMPRYLRKPLIARTGLRLPIQTAPVLIRTVAFVPAYLRKRPH* |
| JGI25614J43888_100607572 | 3300002906 | Grasslands Soil | MSTAKRPGMPRYLLRRPLIARTSTSVREPIRTAPVLIRTVAFVPAYLRKRPH* |
| JGI25614J43888_101328102 | 3300002906 | Grasslands Soil | MSTAKRPGMPRYLRKPLIARTTSVRLPIRPAPVLIRTVAFVPAYLRKRPH* |
| JGI25390J43892_100107053 | 3300002911 | Grasslands Soil | MSTAKRPGMPRYLRKPIIVRTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| JGI25616J43925_1000043215 | 3300002917 | Grasslands Soil | MPRYLRKPLIAKTSVRLXIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0052254_10100772 | 3300003152 | Sediment | MSTAKRIGMPRYLRKPVVARAATPRLPARPTPVLIRTVAFVPAYLRKRAH* |
| Ga0066395_101546302 | 3300004633 | Tropical Forest Soil | MTTAKRPGVPRYLRKTPVARQPVRVSPRPAPVLIRTVAFVPAYLRRRVH* |
| Ga0066395_106869882 | 3300004633 | Tropical Forest Soil | MSTAKRTSMPRYLRKPVIARASAKVKVTARPVPAPVLIRTVAFMPAYLRKRVH* |
| Ga0066823_100473082 | 3300005163 | Soil | MSTAKRPSMPRYLRKPVIARAPVQVAARPAPAPVLIRTVAFVPAYLRRRPH* |
| Ga0066869_100035504 | 3300005165 | Soil | SMPRYLRKPVIARAPVQVAARPAPAPVLIRTVAFVPAYLRRRPH* |
| Ga0066674_100227065 | 3300005166 | Soil | MSTAKRPGMPRYLRKPLIAKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0066674_101907112 | 3300005166 | Soil | MSTAKRPGMPRYLRKPLIVKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0066680_101579011 | 3300005174 | Soil | MSTAKRPGMPRYLRKPLIARTNVRLPIRSAPVLIRTVAFVPAYLRKRPH* |
| Ga0066679_105531572 | 3300005176 | Soil | MSTAKRPGMPRYLRKPLIVRTSVRLPIRTAPVLIRTVAFVPAYVRKRPH* |
| Ga0066690_100435454 | 3300005177 | Soil | MSTAKRPGMPRYLRKPIIVRTSARLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0066690_101282462 | 3300005177 | Soil | MPRYLRKPLIVRTSVRLPIRTAPVLIRTVAFVPAYVRKRPH* |
| Ga0066688_100803331 | 3300005178 | Soil | IPAQASRLGRNHMSTAKRPGMPRYLRKPLIVRTSVRLPIRTAPVLIRTVAFVPAYVRKRPH* |
| Ga0068999_100407442 | 3300005205 | Natural And Restored Wetlands | MRTAKRSGLPRYLRKPMVARAATGPVARIAPVLIRTVAFLPAYQRKRLH* |
| Ga0068995_100006174 | 3300005206 | Natural And Restored Wetlands | MSTAKRPGLRRYLRRPLISRTTGLGLPMRTAPVLIRTVAFMPAYLRRRPH* |
| Ga0068998_101472542 | 3300005213 | Natural And Restored Wetlands | MRTAKRSGLPRYLRKPMVARAATGPVARIAPVLIRTVAFVPAYQRKRLH* |
| Ga0068996_100332722 | 3300005218 | Natural And Restored Wetlands | MRTAKRSGMPRYLRKPMVARAATGPVARIAPVLIRTVAFVPAYQRKRLH* |
| Ga0066388_1024041292 | 3300005332 | Tropical Forest Soil | MSTAKRTSMPRYLRKPVIARASVKVKVTARPVPAPVLIRTVAFMPAYLRKRVH* |
| Ga0066388_1027138602 | 3300005332 | Tropical Forest Soil | MSTAKRASMPRYLRKPLVARAAPSADRAPARPAPVLIRTVAFVPAYLRKRVH* |
| Ga0070709_101136822 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRYLRKPVIAALPRLRFDSPFGRLVLIRTVAFVPAYLRKRPH* |
| Ga0070705_1006193062 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTAKRPGMPRYLRKPIIVRTSVRLPIRTAPVLIRTVAFVPAYLRKR |
| Ga0066686_102368701 | 3300005446 | Soil | MSTAKRTGMPRYLRKPLISRPALRLSARTAPVLIRTVAFVPAYQRKRLH* |
| Ga0066682_105415981 | 3300005450 | Soil | MSTAKRPGMPRYLRKPLIVKTRVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0070699_1003639432 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTAKRPGLPSYLRKPLVMKHVVRLPLKAAPVLIRTVAFMPAYQRKRLH* |
| Ga0070732_100041352 | 3300005542 | Surface Soil | MSTAKRTGLPRYLRKPLLTKPAVRLTVRTAPVLIRTVTFMPAYQRKRLH* |
| Ga0070695_1002098472 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTAKRPGMPRYLRKPLVVRPTVRLPGRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0070704_1000320296 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTAKRPGMPRYMRKPLIARASERLPIRPAPVLIRTVAFVPAYLRKRPH* |
| Ga0066701_100168854 | 3300005552 | Soil | MSTAKRTGMPRYLRKPLVARPELRLAARTAPVLIRTVAFIPAYQRRRLH* |
| Ga0066692_103982062 | 3300005555 | Soil | MPRYLRKPVIARDPVKVQVTGRPAAAPVLIRTVAFVPAYLRKRQH* |
| Ga0066707_100585783 | 3300005556 | Soil | MSTAKRTGMPRYLRKPLVARPELRLAARTAPVLIRTVAFVPAYQRKRLH* |
| Ga0066704_102282251 | 3300005557 | Soil | YLRKPLIARATSVRLPIRPAPMLIRTVAFVPAYLRKRPH* |
| Ga0066700_100881592 | 3300005559 | Soil | MSTAKRPGMPRYLRKPLIARATSVRLPIRPAPVLIRTVAFVPAYLRKRPH* |
| Ga0066703_100485023 | 3300005568 | Soil | MSTAKRPGMPRYLRKPLIARATSVRLPIRPAPMLIRTVAFVPAYLRKRPH* |
| Ga0066703_101491221 | 3300005568 | Soil | MPRYLRKPLIARTSVRLPIRTAPVLIRTVAFVPAYVRKRPH* |
| Ga0066691_101404732 | 3300005586 | Soil | MSTAKRPGMPRYLRKPLIVKTRVRLAIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0066905_1002679822 | 3300005713 | Tropical Forest Soil | MSTAKRPSMPRYLRKPVIARAPVKLEVTARPAPAPVLIRTVAFVPAYLRRRPH* |
| Ga0066905_1006934431 | 3300005713 | Tropical Forest Soil | PLVARAAPSADRAPARPAPVLIRTVAFVPAYLRKRVH* |
| Ga0066903_1043083932 | 3300005764 | Tropical Forest Soil | MSTAKRPSMPRYLRKPAIARAPVKLEVTARPTPAPVLIRTVAFVPAYLRKRIH* |
| Ga0066903_1074104952 | 3300005764 | Tropical Forest Soil | MSTAKRTSMPRYLRKPLVARAAPAAERAPARPAPVLIRTVAFVPAYLRKRVH* |
| Ga0066903_1074825822 | 3300005764 | Tropical Forest Soil | MSTAKRPSMPRYLRKPVIARAATPADRAPARPAPVLIRTVAFVPAYLRKRVH* |
| Ga0074479_100419602 | 3300005829 | Sediment (Intertidal) | MSTAKRIGMPRYLRKPAIARTAAPTVRLPVGPAPVLIRTVAFVPAYLRKRAH* |
| Ga0074479_110772735 | 3300005829 | Sediment (Intertidal) | MSTAKRIGMPRYLRKPVIARTATPTVRLPVGPAPVLIRTVAFVPAYLRKRAH* |
| Ga0074473_100391992 | 3300005830 | Sediment (Intertidal) | MSTAKRTGLPRYLRRPVVAKTPVKIAPRPAPVLIRTVAFVPAYLRKRPH* |
| Ga0074472_110973372 | 3300005833 | Sediment (Intertidal) | MSTAKRPGLPRYLRKPLIARTGVRLAIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0074470_104355131 | 3300005836 | Sediment (Intertidal) | RPLVAKSPVKISPRPAPVLIRTVAFVPAYLRKRPH* |
| Ga0075293_10049702 | 3300005875 | Rice Paddy Soil | VSTAKRPGLPRYLRRPLTARTTGLRLPIRTAPVLIRTVTFMPAYLRRRPH* |
| Ga0075023_1000232384 | 3300006041 | Watersheds | MSTAKRIGMPRYLRKPVIARTPTVRVPVGPAPVLIRTVAFVPAYLRKRAH* |
| Ga0075023_1001793762 | 3300006041 | Watersheds | MRTAKRSSMPRFLRRPPVARVVAPLTATADPVLIRTVAFVPAYLRRRPH* |
| Ga0066652_1005639501 | 3300006046 | Soil | PRYLRKPLIAKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0066652_1013031321 | 3300006046 | Soil | PLVARPELRLAARTAPVLIRTVAFVPAYQRKRLH* |
| Ga0075024_1008679832 | 3300006047 | Watersheds | MSTAKRIGMPRYLRKPVIARTPTVRLAVRPAPVLIRTVAFVPAYLRKRAH* |
| Ga0075028_1009583132 | 3300006050 | Watersheds | MSTAKRPGMPRYLRKPLIARPGALLPARTTPVLVRTVAFLPAYQRKRLH* |
| Ga0075015_1009364002 | 3300006102 | Watersheds | GMPRYLRKPVIARTPTVRLAVRPAPVLIRTVAFVPAYLRKRAH* |
| Ga0070715_110977162 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRYLRKPLIIKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0075018_103269052 | 3300006172 | Watersheds | MSTAKRIGMPRYLRKPVIARTPTVRLAVRPAPVLIRTVAFVPAYLR |
| Ga0070716_1012399782 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTAKRIGMPRYLRKSVIARAAAPAVRLSVRPAPVLIRTVAFVPAYLRKRPH* |
| Ga0079222_100834712 | 3300006755 | Agricultural Soil | MSTAKRPGMPRYLRKPLVVRPAVQLRGRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0079222_103398671 | 3300006755 | Agricultural Soil | MTTAKRPARRYLRKPVVARAAVRLPLRPTPVLIRTVAFMPAYLRKRLH* |
| Ga0075426_100046194 | 3300006903 | Populus Rhizosphere | MSTAKRPGMPRYLRKPLIVRTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0075426_100531954 | 3300006903 | Populus Rhizosphere | MSTAKRPGMPRYLRKPLVVRPAVRLPGRTAPVLIRTV |
| Ga0075426_107375751 | 3300006903 | Populus Rhizosphere | MSTAKRPGMPRYLRKPLVVRTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0079219_100450854 | 3300006954 | Agricultural Soil | SMSTAKRPGMPRYLRKPLVVRPAVRLPGRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0099791_101871093 | 3300007255 | Vadose Zone Soil | MPRYLRKPVIARAPVQVTARPAAAPVLIRTVAFVPAYLRKRQH* |
| Ga0099793_100671402 | 3300007258 | Vadose Zone Soil | MSTAKRPGMPRYLRKPLIARPSTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0099793_102616112 | 3300007258 | Vadose Zone Soil | MPRYLRKPLIARTTSVRLPIRPAPVLIRTVAFVPAYLRKRPH* |
| Ga0099795_104411651 | 3300007788 | Vadose Zone Soil | MSTAKRPGIPRYLRKPLIVKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0099829_102171452 | 3300009038 | Vadose Zone Soil | MPRYLRKPLVARPELRLAARTAPVLVRTVAFVPAYQRKRLH* |
| Ga0099829_109640382 | 3300009038 | Vadose Zone Soil | MPRYLRKPLISRPALRLSARTAPVLIRTVAFVPAYLRKRP |
| Ga0099830_100177822 | 3300009088 | Vadose Zone Soil | MPRYLRKPLISRPALRLSARTAPVLIRTVAFVPAYQRKRLH* |
| Ga0099830_108342832 | 3300009088 | Vadose Zone Soil | MPRYLRKPLVTRPELRLTARTAPVLIRTVTFVPAYQRRRLH* |
| Ga0099830_117593441 | 3300009088 | Vadose Zone Soil | MPRYLRKPLVARPELRLAARTAPVLIRTVAFVPAYQRKRLH* |
| Ga0099828_101326411 | 3300009089 | Vadose Zone Soil | MPRYLRKPLIARTSLRLPIQTAPVLIRTVAFVPAYLRKRPH* |
| Ga0099828_103385652 | 3300009089 | Vadose Zone Soil | MSTAKRPGMPRYLRKPLIARTSLRLPIQTAPVLIRTVAFVPAYLRKRPH* |
| Ga0099828_106867002 | 3300009089 | Vadose Zone Soil | MPRYLRKPLIVRTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0099827_100425723 | 3300009090 | Vadose Zone Soil | MSTAKRPGLPRYLRKPVMAKAGVRLPVRTTPVLIRTVAFMPAYQRKRLH* |
| Ga0099827_110307402 | 3300009090 | Vadose Zone Soil | MSTAKRTGIPRYLRKPLVARPELRLAARTAPVLIRTVAFVPAYQRKRLH* |
| Ga0099827_112554131 | 3300009090 | Vadose Zone Soil | GRLALGGNHMSTAKRTGMPRYLRKPLVTRPELRLTARTAPVLIRTVTFVPAYQRRRLH* |
| Ga0099827_117602242 | 3300009090 | Vadose Zone Soil | MSAGRKSGMPRYLRKSLVAQTAVRLAAPTAPVLIRTVAFVPAYLRKRLH* |
| Ga0066709_1016409782 | 3300009137 | Grasslands Soil | MPRYLRKPLVARPELRLAARTAPVLIRTVAFIPAYQRRRLH* |
| Ga0066709_1023577332 | 3300009137 | Grasslands Soil | MPRYLRKPLIARTNVRLPIRSAPVLIRTVAFVPAYLRKRPH* |
| Ga0066709_1033491852 | 3300009137 | Grasslands Soil | GLGRNQMSTAKRPGMPRYLRKPLIVKTRVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0105252_1000017519 | 3300009678 | Soil | MSTAKRTGLPRYLRKPLIVRTSARLSTRTAPVLIRTVAFVPAYQRRRLH* |
| Ga0126374_111602052 | 3300009792 | Tropical Forest Soil | MPRYLRKPVIARAPVKLEVTARPTPAPVLIRTVAFVPAYLRKRIH* |
| Ga0126384_108953672 | 3300010046 | Tropical Forest Soil | MSTAKRTSMPRYLRKPVIARASVKLKVTARPVPAPVLIRTVAFMPAYLRKRVH* |
| Ga0126382_107385722 | 3300010047 | Tropical Forest Soil | MPRYLRKPVDRTPEPRLVVRPVVRPAPVLIRTVAFMPAYLRKRVH* |
| Ga0134070_100307003 | 3300010301 | Grasslands Soil | MPRYLRKPLIAKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0134088_104990662 | 3300010304 | Grasslands Soil | MSTAKRPGMPRYLRKPLISKTSVPLPLRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0134084_103084142 | 3300010322 | Grasslands Soil | PLIAKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0134111_101210182 | 3300010329 | Grasslands Soil | MPRYLRKPLIVKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0134062_104694782 | 3300010337 | Grasslands Soil | AQASRLGRNHMSTAKRPGMPRYLRKPLIAKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0126370_102001992 | 3300010358 | Tropical Forest Soil | MPRYLRKPVIARAPVKEKVTARPVPAPVLIRTVAFMPAYLRKRVH* |
| Ga0126370_105670562 | 3300010358 | Tropical Forest Soil | MSTAKRTSMPRYLRKPVIARAPVKLEVTARPAPAPVLIRTVAFVPAYLRRRPH* |
| Ga0126376_102337642 | 3300010359 | Tropical Forest Soil | MSTAKRPNMPRYLRKPAVVRAPVKLEVTARPAPAPVLIRTVAFVPAYLRKRPH* |
| Ga0126372_112974332 | 3300010360 | Tropical Forest Soil | MPRYLRKPIIARAPVKEKVTARPVPAPVLIRTVAFMPAYLRKRVH* |
| Ga0126372_118194692 | 3300010360 | Tropical Forest Soil | MSTAKRPNMPRYLRKPVIARAPVKLEVTARPTPAPVLIRTVAFVPAYLRKRIH* |
| Ga0126378_120748572 | 3300010361 | Tropical Forest Soil | MPRYLRKPVIERAPAKLEVTASPRPAPVLIRTVAFVPAYLRKRVH* |
| Ga0126377_103329941 | 3300010362 | Tropical Forest Soil | MPRYLRKPVIERAPVKPEVTARPTPAPVLIRTVAFVPAYLRKRIH* |
| Ga0126377_110483452 | 3300010362 | Tropical Forest Soil | MPRYLRKPLVARAAPAAERAPARPAPVLIRTVAFVPAYLRKRVH* |
| Ga0126377_132736012 | 3300010362 | Tropical Forest Soil | MPRYLRKPVIERAPVKLEVTARPRPAPVLIRTVAFVPAYLRKRAH* |
| Ga0126379_104542392 | 3300010366 | Tropical Forest Soil | MPRYLRKPVIERASVKLEVTAHPRPAPVLIRTVAFMPAYLRKRVH* |
| Ga0126381_1007636181 | 3300010376 | Tropical Forest Soil | MSTAKRPSMPRYLRKPVIERAPVKLEVTASPRPAPVLIRTVAFVPAYLRKRVH* |
| Ga0126383_112856452 | 3300010398 | Tropical Forest Soil | MPRYLRKPAIARAPVKLEVTARPTPAPVLIRTVAFVPAYLRKRIH* |
| Ga0126383_124015352 | 3300010398 | Tropical Forest Soil | MSTAKRTSMPRYLRKPVIARASVKVKVTARPVPAPVLIRTVAFMPAYLRKRIH* |
| Ga0151490_16463962 | 3300011107 | Soil | GESMSIGKRPGVPRYMRKAVVARQTVRIAARTAPVLIRTVAFVPAYLRKRPH* |
| Ga0137392_107362273 | 3300011269 | Vadose Zone Soil | MPRYLRKPLIARTSLRLPIQTAPVLIRTVAFVPAYLRKRP |
| Ga0137393_110512891 | 3300011271 | Vadose Zone Soil | MPRYLRKPLIAKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0137315_10031922 | 3300011395 | Soil | MSTAKRTGVPRYLRKPLIVRTAAKLSARTASVLIRTVAFVPAYQRRRLH* |
| Ga0137444_10220902 | 3300011397 | Soil | GVPRYLRKPLIVRTAAKLSARTAPVLIRTVAFVPAYQRRRLH* |
| Ga0153984_10431002 | 3300011401 | Attine Ant Fungus Gardens | MPRYLRKPLIVKTSVRLPIRAAPVLIRTVAFVPAYLRKRPH* |
| Ga0137323_10020705 | 3300011409 | Soil | MSTAKRMSAGRKSGMPRYLRRSLLVARPAVRLAAPTAPVLIRTVAFVPAYLRKRPH* |
| Ga0137442_10697252 | 3300011414 | Soil | MPRFLRRPLIARASMRLPARADPVLIRTVAFMPAYLRKRPH* |
| Ga0137314_10072395 | 3300011420 | Soil | MSTAKRTGLPRYLRKPLIVRTSAPLSARTAPVLIRTVAFVPAYQRRRLH* |
| Ga0137441_10066362 | 3300011425 | Soil | MSTAKRTGLPRYLRKPLIVRASARVSTRTAPVLIRTVAFVPAYQRRRLH* |
| Ga0137448_11118712 | 3300011427 | Soil | MSTAKRTGVPRYLRKPLIVRTAAKLSARTAPVLIRTVAFVPAYQ |
| Ga0137438_10111422 | 3300011431 | Soil | MSTAKRPGLPRYLRKPLIARTALRLPPNTVPVLIRTVAFLPAYQRKRLH* |
| Ga0137452_10055211 | 3300011441 | Soil | RMSTAKRTGLPRYLRKPLIVRTSARLSARTAPVLIRTVAFVPAYQRRRLH* |
| Ga0137437_10368942 | 3300011442 | Soil | MSTAKRIGMPRYLRKPVIARTTTVRLAVRPAPVLIRTVAFVPAYLRKRAH* |
| Ga0137437_11062021 | 3300011442 | Soil | MPRFLRRPLIARAGMRLPARADPVLIRTVAFIPAYLRKRPH* |
| Ga0137463_10004535 | 3300011444 | Soil | MPRYLLRRPLIAKASAREPIRPAPVLIRTVAFVPAYLRKRPH* |
| Ga0137463_10045171 | 3300011444 | Soil | MSTAKRPGLPRYLRKPILAKEVIRLPAKSAPVLIRTVAFLPAYQRRRLH* |
| Ga0137463_10064802 | 3300011444 | Soil | MSTAKRPGMPRYLRRPLIARPSERLPVRAAPVLIRTVAFVPAYLRKRPH* |
| Ga0137463_12278821 | 3300011444 | Soil | MSTAKRIGMPRYLRKPAIARTATVRLAVRPAPVLIRTVAFVPAYLRKRAH* |
| Ga0137463_13002282 | 3300011444 | Soil | YLRKPVIARAPVKVEVTTRPAAAPVLIRTVAFVPAYLRKRQH* |
| Ga0137463_13397101 | 3300011444 | Soil | MSTAKRIGMPRYLRKPVIARTPTVRLAVRPAPVLIRTVAFVPAYLRKRVH* |
| Ga0137453_10340961 | 3300012034 | Soil | MSTAKRTGVPRYLRKPLIVRTAAKLSARTAPVLIRTVAFVPAYQRRRLH* |
| Ga0137461_10022652 | 3300012040 | Soil | MSTAKRTGVPRYLRRPLIVRNAAKLSARTAPVLIRTVAFVPAYQRRRLH* |
| Ga0137322_10511372 | 3300012146 | Soil | RTGVPRYLRKPLIVRAAAKLSARTASVLIRTVAFVPAYQRRRLH* |
| Ga0137388_108774632 | 3300012189 | Vadose Zone Soil | GMPRYLRKPLIARTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0137388_118136111 | 3300012189 | Vadose Zone Soil | MPRYLRKPLIARTSVRLPIRTAPVLIRTVAFVPAYLRKRP |
| Ga0137364_100275211 | 3300012198 | Vadose Zone Soil | KRPGMPRYLRKPLIVKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0137383_100027352 | 3300012199 | Vadose Zone Soil | MPRYLRKPLIARTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0137383_104008322 | 3300012199 | Vadose Zone Soil | MPRYLRKPLIAKTSLRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0137383_104313922 | 3300012199 | Vadose Zone Soil | HMSTAKRTGMPRYLRKPLVARPELRLAARTAPVLIRTVAFVPAYQRKRLH* |
| Ga0137399_102766291 | 3300012203 | Vadose Zone Soil | MPLYLRKPVIARDPVKVQVTGRPAAAPVLIRTVAFVPAYLRKRQH* |
| Ga0137399_105309161 | 3300012203 | Vadose Zone Soil | LTRYLRKPVIARTPVKVEVTARPAAAPVLIRTVAFVPAYLRKRQH* |
| Ga0137374_109939392 | 3300012204 | Vadose Zone Soil | MPRYLRRPLIARPAPQLAARTAPVLIRTVAFVPAYQRKRLH* |
| Ga0137380_1000017813 | 3300012206 | Vadose Zone Soil | MSTAKRPGLPRYLRRPVMAKAGVRLPVRTTPVLIRTVAFMPAYQRKRLH* |
| Ga0137380_106290471 | 3300012206 | Vadose Zone Soil | RLALGGNHMSTAKRTGMPRYLRKPLVARPELRLAARTAPVLVRTVAFVPAYQRKRLH* |
| Ga0137381_109762381 | 3300012207 | Vadose Zone Soil | KPLIVKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0137370_100014087 | 3300012285 | Vadose Zone Soil | MPRYLRKPLIARPTERLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0137366_1000010734 | 3300012354 | Vadose Zone Soil | MPRYLRKPLIARTSVRLPIRNAPVLIRTVAFVPAYLRKRPH* |
| Ga0137369_100040268 | 3300012355 | Vadose Zone Soil | MSIAKRPGMPRYLRKPLIARTSVRLPIRTAPVLIRTVAFVPAYLRRRPH* |
| Ga0137384_112093192 | 3300012357 | Vadose Zone Soil | RPGMPRYLRKPLIVKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0137385_101950684 | 3300012359 | Vadose Zone Soil | PAQASRLGRNHMSTAKRPGMPRYLRKPLIVKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0137390_102063652 | 3300012363 | Vadose Zone Soil | MPRYLRKPLIVKTRVRLAIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0137398_100236543 | 3300012683 | Vadose Zone Soil | MPRYLRKPLIARTTSVRVPIRPAPVLIRTVAFVPAYLRKRPH* |
| Ga0137397_100027066 | 3300012685 | Vadose Zone Soil | MSTAKRIGMPRYLRKPVITRTAASTVRLAVRPAPVLIRTVAFVPAYLRKRPH* |
| Ga0137396_103206882 | 3300012918 | Vadose Zone Soil | MSTAKRPGMPRYLRKPLIARTTSVRVPIRPAPVLIRTVAFVPAYLRKRPH* |
| Ga0137394_101756203 | 3300012922 | Vadose Zone Soil | MPRYLRKPLIARTTGVRLPIRPAPVLIRTVAFVPAYLRKRPH* |
| Ga0137419_105081642 | 3300012925 | Vadose Zone Soil | MSTAKRPSMPRYLRKPVIARTPVKVEVTARPAAAPVLIRTVAFVPAYLRKRQH* |
| Ga0137404_1000034926 | 3300012929 | Vadose Zone Soil | MPRYLRKPVIARTPVKVEVTARPAAAPVLIRTVAFVPAYLRKRQH* |
| Ga0137404_105313311 | 3300012929 | Vadose Zone Soil | MSTAKRPGMPRYLLRRPLIARTSTSVREPIRTAPVLIRT |
| Ga0137407_103177982 | 3300012930 | Vadose Zone Soil | MPRYLRKPLIARTGLRLPIQTAPVLIRTVAFVPAYLRKRPH* |
| Ga0137407_110676191 | 3300012930 | Vadose Zone Soil | YLRKPLIVKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0137410_100010677 | 3300012944 | Vadose Zone Soil | MSTAKRPSMPRYLRKPLVARAAAPADRAGARPAPVLIRTVAFVPAYLRKRVH* |
| Ga0137410_100085636 | 3300012944 | Vadose Zone Soil | MPRYLRKPVVRTPAPTVRVVVRPAPVLIRTVAFVPAYLRKRVH* |
| Ga0137410_109343951 | 3300012944 | Vadose Zone Soil | MPRYLRKPVIARAPVKLQVTARPVAAPVLIRTVAFVPAYLRKRQH* |
| Ga0137410_111566611 | 3300012944 | Vadose Zone Soil | LRKPLIARTTSVRLPIRPAPVLIRTVAFVPAYLRKRPH* |
| Ga0137410_112361072 | 3300012944 | Vadose Zone Soil | MSTAKRPSMPRYLRKPVVRTPAPTVRVVVRPAPVLIRTVAFVPAYLRKRVH* |
| Ga0126369_103833002 | 3300012971 | Tropical Forest Soil | MSTAKRIGMPRYLRKPVVARAATPRLPVRPAPVLIRTVAFVPAYLRKRAH* |
| Ga0134077_103660362 | 3300012972 | Grasslands Soil | MPRYLRKPLISKTSVQLPLRTAPVLIRTVAFVPAYLRKRPH* |
| Ga0075351_10695191 | 3300014318 | Natural And Restored Wetlands | MSTAKRPGLRRYLRRPLISRTTGLGLPMRTAPVLIRTVAFMPAYLRRR |
| Ga0075351_11644371 | 3300014318 | Natural And Restored Wetlands | MSTAKRIGMPRYLRKPAIARTAAPTVRLPVAPAPVLIRTV |
| Ga0180078_10430482 | 3300014865 | Soil | MSTAKRTGVPRYLRKPLIVRTAAKLSARTASVLIRTVAFVPA |
| Ga0180064_11067191 | 3300014876 | Soil | PRYLRKPLIVRTSAPLSARTAPVLIRTVAFVPAYQRRRLH* |
| Ga0137411_10187533 | 3300015052 | Vadose Zone Soil | PRYLRKPLVARAAAPADRAGARPAPVLIRTVAFVPAYLRKRVH* |
| Ga0137409_100993652 | 3300015245 | Vadose Zone Soil | MSTAKRIGMPRYLRKPVIARAPAVRLPVRPAPVLIRTVAFVPAYLRKRVH* |
| Ga0137409_104029172 | 3300015245 | Vadose Zone Soil | MSTAKRMSAGRKSGMPRYLRKSLVAQTAVRLAAPTAPVLIRTVAFVPAYLRKRLH* |
| Ga0137409_104574422 | 3300015245 | Vadose Zone Soil | MPRYLRKSLISRPALPPSARTAPVLIRTVAFVPAYQRKRLH* |
| Ga0137403_102347051 | 3300015264 | Vadose Zone Soil | MSTAKRTGVRRYLRKPVAARAVVRLPVRPAPVLIRTVAFVPGYLRKRLH* |
| Ga0187824_100350212 | 3300017927 | Freshwater Sediment | MSTGKRPSMPRYLRKPAIVRAPVKLEVTARPVPAPVLIRTVAFVPAYLRKRPH |
| Ga0187775_1000000620 | 3300017939 | Tropical Peatland | MSTAKRIGMPRYLRKPVVARAAAPRLPARPTPVLIRTVAFVPAYLRKRAH |
| Ga0187786_105892361 | 3300017944 | Tropical Peatland | MSTAKRTGMPRYLRKPVAARAATQRLPARPAPVLIRTVAFVPAYLRKRAH |
| Ga0187779_100458862 | 3300017959 | Tropical Peatland | MSTAKRIGMPRYLRKPVVARAAAPRLPARPAPVLIRTVAFVPAYLRRRAH |
| Ga0187779_100971962 | 3300017959 | Tropical Peatland | MSTAKRIGMPRYLRKPVVARAAAPAVRLPVRPAPVLIRTVAFVPAYLRKRPH |
| Ga0187778_110071831 | 3300017961 | Tropical Peatland | MSTAKRSNMPRYLRKPAVVRAPVKLEVTARPAPAPVLIRTVAFVP |
| Ga0187776_115509331 | 3300017966 | Tropical Peatland | MSTAKRSSVRRYLRKPAIARASDPVAARPAPAPVLIRTVAFVPAYLRKRLH |
| Ga0187777_105664262 | 3300017974 | Tropical Peatland | MSTAKRIGMPRYLRKPVVARAAAPRLPARPAPVLIRTVAFVPAYLRKRAH |
| Ga0184610_10112692 | 3300017997 | Groundwater Sediment | MSTAKRTGIPRYLRKPLVARPALPLAARTAPVLIRTVAFVPAYQRKRLH |
| Ga0184610_11411642 | 3300017997 | Groundwater Sediment | MPRYLRKPLIVKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0187767_101718471 | 3300017999 | Tropical Peatland | SKQTEGGSVTTAKRPGVRRYIRKPLIARATVRLPARPAPVLIRTVAFVPAYLRKRLH |
| Ga0184605_100013886 | 3300018027 | Groundwater Sediment | MSTAKRPGMPRYLRKPLIARTTSVRLPIRPAPVLIRTVAFVPAYLRKRAH |
| Ga0184608_100002708 | 3300018028 | Groundwater Sediment | MSTAKRPGMPRYLRKPLIVKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0187787_100564122 | 3300018029 | Tropical Peatland | MSTAKRSSVRRYLRKPAIARAADPVTTRPAPAPVLIRTVAFVPAYLRKRLH |
| Ga0184634_100588311 | 3300018031 | Groundwater Sediment | MSTAKRTGMPRYLRKPLVARPELRLAARTPPVLIRTVAFVPAYQRKRLH |
| Ga0184634_102518862 | 3300018031 | Groundwater Sediment | MSTAKRTGMPRYLRKPLVARPGLRLAARTAPVLIRTVAFLPAYQRKRLH |
| Ga0187788_102639102 | 3300018032 | Tropical Peatland | MSTAKRIGMPRYLRKPVVARAAAPRLPARPTPVLIRTVAFVPAYLRTRAH |
| Ga0187766_113120012 | 3300018058 | Tropical Peatland | MSTAKRIGMPRYLRKPVVARAATPRLPARPAPVLIRTVAFVPAYLRKRAH |
| Ga0184615_100030905 | 3300018059 | Groundwater Sediment | MSTAKRIGVPRYLRKPLIVRTAAKLSARTDSVLIRTVAFVPAYQRRRLH |
| Ga0184615_102966862 | 3300018059 | Groundwater Sediment | MSTAKRPGLPRYLRKPLIARTVLRLPSNTVPVLIRTVAFLPTYQRKRLH |
| Ga0184637_100386445 | 3300018063 | Groundwater Sediment | MSTAKRTGVPRYLRKPLIVRTAAKLSARTAPVLIRTVAFVPAYQRRRLH |
| Ga0187773_100001317 | 3300018064 | Tropical Peatland | MSTAKRTGPRRYLRRPPAPATTGLRASLRTGPVLIRTVAFMPAYLRRRPH |
| Ga0187773_102266782 | 3300018064 | Tropical Peatland | MSTAKRSSVRRYLRKPAIARASDPVAARPAPAPVLIRTVAFVPAYLRKR |
| Ga0184636_10044243 | 3300018068 | Groundwater Sediment | MSTAKRIGVPRYLRKPLIVRTAAKLSARTASVLIRTVAFVPAYQRRRLH |
| Ga0184618_100053645 | 3300018071 | Groundwater Sediment | MSTAKRPGMPRYLRKPLIARTSVRPPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0184618_101019072 | 3300018071 | Groundwater Sediment | MPRYLRKPLIARTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0184629_100114651 | 3300018084 | Groundwater Sediment | GVPRYLRKPLIVRTAAKLSARTASVLIRTVAFVPAYQRRRLH |
| Ga0066667_100197573 | 3300018433 | Grasslands Soil | MSTAKRPGMPRYLRKPLIAKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0066662_109539142 | 3300018468 | Grasslands Soil | MPRYLRKPLIARTNVRLPIRSAPVLIRTVAFVPAYLRKRPH |
| Ga0066669_114029961 | 3300018482 | Grasslands Soil | MSTAKRPGMPRYLRKPLIVKTRVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0184648_12652602 | 3300019249 | Groundwater Sediment | MSTAKRTGVPRYLRKPLIVRTAAKLSARTASVLIRTVAFVPAYQRRRLH |
| Ga0184648_14571661 | 3300019249 | Groundwater Sediment | MSTAKRIGVPRYLRKPLIVRTAAKLSARTASVLIRTVAFVPAYQR |
| Ga0193712_10053435 | 3300019880 | Soil | MSTAKRPGMPRYLLRRPLIARTSTSVREPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0193727_10177982 | 3300019886 | Soil | MSTAKRPGMPRYLLRRPLIARASTSVREPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0193711_10001378 | 3300019997 | Soil | MSTAKRPGMPRYLRRPLIAKPSVREPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0193718_10012762 | 3300019999 | Soil | MSTAKRTGMPRYLRKPLIVRTSERLPIRPAPVLIRTVAFVPAYLRKRPH |
| Ga0193726_100019460 | 3300020021 | Soil | MSTAKRPGIPHYLRKPLIARHGARLLPARTTPVLVRTVAFLPAYQRKRLH |
| Ga0193733_100001175 | 3300020022 | Soil | MSTAKRPGMPRYLRRPLIARTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0179594_100028174 | 3300020170 | Vadose Zone Soil | MSTAKRPSMPRYLRKPIIARTPVKVEVTARPAAAPVLIRTVAFVPAYLRKRQH |
| Ga0179594_100139881 | 3300020170 | Vadose Zone Soil | MSTAKRPGMPRYLRKPLIARTTSVRLPIRPAPVLIRTVAFVPAYLRKRPPP |
| Ga0179596_100027113 | 3300021086 | Vadose Zone Soil | MSTAKRTGMPRYLRKPLVARPELRLAARTAPVLVRTVAFVPAYQRKRLH |
| Ga0126371_101011472 | 3300021560 | Tropical Forest Soil | MSTAKRPSMPRYLRKPVIARAPVKEKVTARPVPAPVLIRTVAFMPAYLRKRVH |
| Ga0126371_119440612 | 3300021560 | Tropical Forest Soil | MPRYLRKPVIERAPVKLEVTASPRPAPVLIRTVAFVPAYLRKRVH |
| Ga0213853_113318071 | 3300021861 | Watersheds | KRIGMPRYLRKPVIARTPTVRLAVRPAPVLIRTVAFVPAYLRKRAH |
| Ga0222625_18029661 | 3300022195 | Groundwater Sediment | TAKRPGMPRYLRKPLIARTSVRPPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0137417_10661132 | 3300024330 | Vadose Zone Soil | MSTAKRPGMPRYLRKPLIARTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0210114_10167032 | 3300025795 | Natural And Restored Wetlands | MSTAKRTGLPRYLRRPLVAKSPVKISPRPAPVLIRTVAFVPAYLRKRPH |
| Ga0210117_10620782 | 3300025985 | Natural And Restored Wetlands | PAQAGRLGQGESMRTAKRSGLPRYLRKPMVTRTATSPLQRTAPVLIRTVAFVPAYQRKRL |
| Ga0208659_10158412 | 3300026054 | Natural And Restored Wetlands | MRTAKRSGMPRYLRKPMVARAATGPVARIAPVLIRTVAFVPAYQRKRLH |
| Ga0209438_10542373 | 3300026285 | Grasslands Soil | RPGMPRYLLRRPLIARTSTSVREPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0209438_10580041 | 3300026285 | Grasslands Soil | MSTAKRPGIPRYLRKPLIVKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0209234_100030617 | 3300026295 | Grasslands Soil | MSTAKRPGMPRYLRKPLIVRTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0209237_10903641 | 3300026297 | Grasslands Soil | GRNHMSTAKRPGMPRYLRRPLIARTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0209237_11183382 | 3300026297 | Grasslands Soil | MSTAKRTGMPRYLRKPLISRPALRLSARTAPVLIRTVAFVPAYQRKRLH |
| Ga0209240_11555211 | 3300026304 | Grasslands Soil | MSTAKRPGMPRYLRKPLIARTGLRLPIQTAPVLIRTVAFVPAYLRKRPH |
| Ga0209055_10007579 | 3300026309 | Soil | MSTAKRPGMPRYLRKPLIARTNVRLPIRSAPVLIRTVAFVPAYLRKRPH |
| Ga0209239_12040342 | 3300026310 | Grasslands Soil | RPGMPRYLRKPLIARTRVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0209761_10907291 | 3300026313 | Grasslands Soil | RTGMPRYLRKPLISRPALRLSARTAPVLIRTVAFVPAYQRKRLH |
| Ga0209686_11703351 | 3300026315 | Soil | MSTAKRPGMPRYLRKPIIVRTSVRLPIRTAPVLIRTV |
| Ga0209471_10237552 | 3300026318 | Soil | MSTAKRPGMPRYLRKPIIVRTSARLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0209471_11478252 | 3300026318 | Soil | MSTAKRPGMPRYLRKPLIVRTSVRLPIRTAPVLIRTVAFVPAYVRKRPH |
| Ga0209647_10373374 | 3300026319 | Grasslands Soil | MSTAKRPGMPRYLRKPLIARTTSVRLPIRPAPVLIRTVAFVPAYLRKRPH |
| Ga0209647_10686864 | 3300026319 | Grasslands Soil | MSTAKRIGMPRYLRKPVIARAPAVRLPVRPAPVLIRTVAFVPAYLRKRVH |
| Ga0209647_11501702 | 3300026319 | Grasslands Soil | MPRFLRRPLIARAGTRLPARTDPVLIRTVAFMPAYLRKRPH |
| Ga0209131_13494442 | 3300026320 | Grasslands Soil | MSTAKRPGMPRYLLRRPLIARTSTSAREPIRTAPVLIRTVAF |
| Ga0209802_10607891 | 3300026328 | Soil | GMPRYLRRPLIARTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0209267_12033502 | 3300026331 | Soil | MSTAKRPGMPRYLRKPIIVRTSARLPIRTAPVLIRTVAFVPAYVRKRPH |
| Ga0256814_10129292 | 3300026464 | Sediment | STAKRIGMPRYLRKPVIARTTAVRLPVQPAPVLIRTVAFVPAYLRKRAH |
| Ga0256805_10393172 | 3300026485 | Sediment | MSTAKRIGMPRYLRKPVIARTTAVRLPVQPAPVLIRTVAFVPAYLRKRAH |
| Ga0209690_12582171 | 3300026524 | Soil | MSTAKRTGMPRYLRKPLVARPELRLAARTAPVLIRTVAFIPAYQRRRLH |
| Ga0209378_13176772 | 3300026528 | Soil | MSTAKRTGMPRYLRKPLVARPELRLAARTAPVLIRTVAFVP |
| Ga0209806_10492492 | 3300026529 | Soil | MSTAKRPGMPRYLRKPLIARATSVRLPIRPAPMLIRTVAFVPAYLRKRPH |
| Ga0209160_11282044 | 3300026532 | Soil | YLRKPLIARATSVRLPIRPAPMLIRTVAFVPAYLRKRPH |
| Ga0209058_100517510 | 3300026536 | Soil | MSTAKRPGMPRYLRRPLIARSSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0209161_104814642 | 3300026548 | Soil | MSTAKRPGMPRYLRKPLIARATSVRLPIRPAPMLIRTVAFVPA |
| Ga0179593_10195684 | 3300026555 | Vadose Zone Soil | MSTAKRPGMPRYLLRRPLIARTSTSAREPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0208454_10016963 | 3300027573 | Soil | MSTAKRTGLPRYLRKPLIVRTSARLSTRTAPVLIRTVAFVPAYQRRRLH |
| Ga0209076_10623602 | 3300027643 | Vadose Zone Soil | MSTAKRPGMPRYLRKPLIARTSTSERLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0209076_11259622 | 3300027643 | Vadose Zone Soil | MPRYLRKPLIARTTSVRLPIRPAPVLIRTVAFVPAYLRKRPH |
| Ga0209588_10521312 | 3300027671 | Vadose Zone Soil | MSTAKRPGMPRYLRKPLIARPSTSVRLPIRTAPVLIRTVAFVHAYLRKRPH |
| Ga0209073_100442532 | 3300027765 | Agricultural Soil | MSTAKRPGMPRYLRKPLVVRPAVRLPGRTAPVLIRTVAFVPAYLRKRPH |
| Ga0209074_102803702 | 3300027787 | Agricultural Soil | MSTAKRPGMPRYLRKPLVVRPAVRLPGRTAPVLIRTVAFV |
| Ga0209811_100030752 | 3300027821 | Surface Soil | MSTAKRPSMPRYLRKPVIARAPVQVAARPAPAPVLIRTVAFVPAYLRRRPH |
| Ga0209580_100026672 | 3300027842 | Surface Soil | MSTAKRTGLPRYLRKPLLTKPAVRLTVRTAPVLIRTVTFMPAYQRKRLH |
| Ga0209701_103097641 | 3300027862 | Vadose Zone Soil | MSTAKRTGMPRYLRKPLVARPELRLAARTAPVLIRTVAFVPAYQRKRLH |
| Ga0209465_102552432 | 3300027874 | Tropical Forest Soil | MTTAKRPGVPRYLRKTPVARQPVRVSPRPAPVLIRTVAFVPAYLRKRVH |
| Ga0209465_102920611 | 3300027874 | Tropical Forest Soil | MSTAKRTSMPRYLRKPVIARASVKVKVTARPVPAPVLIRTVAFMPAYLRKRVH |
| Ga0209465_103650261 | 3300027874 | Tropical Forest Soil | MSTAKRIGMPRYLRKPVVARPAAPRLPARPAPVLIRTVAFVPAYLRK |
| Ga0209283_103336041 | 3300027875 | Vadose Zone Soil | KPLIARTSLRLPIQTAPVLIRTVAFVPAYLRKRPH |
| Ga0209283_103673321 | 3300027875 | Vadose Zone Soil | MSTAKRPGMPRYLRKPLIARTSLRLPIQTAPVLIRTVAFVPAYLRKRPH |
| Ga0209590_100484332 | 3300027882 | Vadose Zone Soil | MSTAKRPGLPRYLRKPVMAKAGVRLPVRTTPVLIRTVAFMPAYQRKRLH |
| Ga0209590_105455452 | 3300027882 | Vadose Zone Soil | MSTAKRMSAGRKSGMPRYLRKSLVAQTAVRLAAPTAPVLIRTVAFVPAYLRKRLH |
| Ga0209583_101007003 | 3300027910 | Watersheds | MRTAKRSSMPRFLRRPPVARVVAPLTATADPVLIRTVAFVPAYLRRRPH |
| Ga0209583_106324092 | 3300027910 | Watersheds | MSTAKRIGMPRYLRKPVIARTTTVRLAVRPAPVLIRTVAFVPAYLRKRAH |
| Ga0307504_100020505 | 3300028792 | Soil | MSTAKRTGLPRYLRKPLIVRTAARLSARTAPVLIRTVAFVPAYQRKRLH |
| Ga0307503_100978552 | 3300028802 | Soil | MSTAKRIGMPRYLRKPVIARAPVQVAARPAPAPVLIRTVAFVPAYLRKRPH |
| Ga0307503_101754622 | 3300028802 | Soil | MSTAKRPSMPRYLRKPVIARAPVKVEVTARPAPAPVLIRTVAFVPAYLRKRQH |
| Ga0307498_104385391 | 3300031170 | Soil | MSTAKRPSMPRYLRKPVVRTPAPTVRLVVRPAPVLIRTVAF |
| Ga0307497_100007158 | 3300031226 | Soil | MSTAKRPSMPRYLRKPLIARAATPADRAPARPAAVLIRTVAFVPAYLRKRAH |
| Ga0308194_100248033 | 3300031421 | Soil | PGMPRYLRKPLIVKTSVRLPIRTAPVLIRTVAFVPAYLRKRPH |
| Ga0318555_102921182 | 3300031640 | Soil | MSTAKRPSMPRYLRKPVIARAPVKLEATARPTPAPVLIRTVAFVPAYLRKRIH |
| Ga0307469_1000000674 | 3300031720 | Hardwood Forest Soil | MSTAKRTGVRRYLRKPVAARVAVRLPVRPAPVLIRTVAFVPGYLRKRLH |
| Ga0307469_100147572 | 3300031720 | Hardwood Forest Soil | MSTAKRPGMPRYLRKPLIVKTSVRLPIRAAPVLIRTVAFVPAYLRKRPH |
| Ga0307469_100541472 | 3300031720 | Hardwood Forest Soil | MSTAKRPSMPRYLRKPVVRTPAPTVRVVVRPAPVLIRTVAFVPAYLRKRVH |
| Ga0307469_110689832 | 3300031720 | Hardwood Forest Soil | MSTAKRPSMPRYLRKPVIARAPVQVTARPAAAPVLIRTVAFVPAYLRKRQH |
| Ga0307469_110975022 | 3300031720 | Hardwood Forest Soil | MSTAKRPGVRRYLRKPVVAREGVRLPIRTAPVLIRTVAFVPAYLRKRLH |
| Ga0307473_102445372 | 3300031820 | Hardwood Forest Soil | MSTAKRPSMPRYLRKPVIARAPVQVTVRPVAAPVLIRTVAFVPAYLRKRQH |
| Ga0310912_102238111 | 3300031941 | Soil | FMSTAKRPSMPRYLRKPVIARAPVKLEATARPTPAPVLIRTVAFVPAYLRKRIH |
| Ga0326597_105713662 | 3300031965 | Soil | MSTAKRTGLPRYLRRPLVAKSPVKISPRPAPVLIRTVAFIPAYLRKRPH |
| Ga0315281_100381652 | 3300032163 | Sediment | MRTAKRPGLPRYLRRPMIAKAPVQSPLRTSPVLIRTVAFVPAWQRKRLH |
| Ga0315281_107091882 | 3300032163 | Sediment | MSTAKRPGLPRYLRRPLIARTAHQLPPNAVPVLIRTVAFLPTYQRKRLH |
| Ga0307471_1004697882 | 3300032180 | Hardwood Forest Soil | MSTAKRIGLPRYLRKPVVARAAAPAVRLPVRPAPVLIRTVAFVPAYLRKRAH |
| Ga0307472_1014574062 | 3300032205 | Hardwood Forest Soil | MSTAKRASMPRYLRKPVIARDPVKVQVTGRPAAAPVLIRTVAFVPAYLRKRQH |
| Ga0335085_100023397 | 3300032770 | Soil | MSTAKRIGMPRYLRKPVVARAAAPRLPARPAPVLIRTVAFVPGYLRKRAH |
| Ga0335084_100555432 | 3300033004 | Soil | MSTAKRIGMPRYLRKPVIARTPTVRLAVRPAPVLIRTVAFVPAYLRKRAH |
| Ga0326726_100456306 | 3300033433 | Peat Soil | MSTAKRSSVRRYLRKPVIARASDQVTARPAPAPVLIRTVAFVPAYLRKRLH |
| Ga0326730_10277602 | 3300033500 | Peat Soil | MSTAKRIGMPRYLRKPVIARTAAVRLPVQPAPILIRTVAFVPAYLRKRAH |
| Ga0326731_10201141 | 3300033502 | Peat Soil | MSTAKRIGMPRYLRKPVIARTAAVRLPVQPAPILIRTVAFVP |
| Ga0314872_015033_3_107 | 3300033810 | Peatland | MSTAKRSVVRRYLRKPLIARATVRLPARPAPVLIR |
| Ga0364924_019025_1167_1316 | 3300033811 | Sediment | MSTAKRTGMPRYLRKPLISRPAPRLPARTAPVLIRTVAFVPAYQRKRLH |
| Ga0364924_128869_1_108 | 3300033811 | Sediment | KPLISRPAPRLPARTAPVLIRTVAFVPAYQRKRLH |
| Ga0364926_019924_216_341 | 3300033812 | Sediment | MPRYLRKPLVARPALPLAARTAPVLIRTVAFVPAYQRRRLH |
| Ga0364928_0181400_354_479 | 3300033813 | Sediment | MPRYLRKPLVARPELRLAARTPPVLIRTVAFVPAYQRKRLH |
| Ga0364930_0337690_329_505 | 3300033814 | Sediment | RPTKFGRKSMSTAKRTGVPRYLRKPLIVRTAAKLSARTASVLIRTVAFVPAYQRRRLH |
| Ga0364938_131016_364_507 | 3300034114 | Sediment | MSTAKRTGMPRYLRKPLVARPALPLAARTAPVLIRTVAFVPAYQRKRL |
| Ga0364929_0002611_2639_2809 | 3300034149 | Sediment | MSTAKRMSAGRKSGMPRYLRRSLLVARPAVRLAAPTAPVLIRTVAFVPAYLRKRPH |
| Ga0364933_196427_415_528 | 3300034150 | Sediment | MSTAKRPGMPRYLRRPLIAKTSVREPIRTAPVLIRTVA |
| Ga0364940_0213661_359_484 | 3300034164 | Sediment | MPRYLRKPLVARPALPLAARTAPVLIRTVAFVPAYQRKRLH |
| Ga0370545_168594_3_152 | 3300034643 | Soil | MSTAKRISVPRYLRKPLIVRTAAKLSARTASVLIRTVAFVPAYQRRRLH |
| ⦗Top⦘ |