| Basic Information | |
|---|---|
| Family ID | F009828 |
| Family Type | Metagenome |
| Number of Sequences | 312 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MNFEFSPAEQAFAEEVRGFLRAHPPETFPVDGMDAGYGSGAHSR |
| Number of Associated Samples | 243 |
| Number of Associated Scaffolds | 312 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 37.62 % |
| % of genes near scaffold ends (potentially truncated) | 98.40 % |
| % of genes from short scaffolds (< 2000 bps) | 91.99 % |
| Associated GOLD sequencing projects | 227 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.167 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (13.782 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.718 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.910 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.39% β-sheet: 0.00% Coil/Unstructured: 73.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 312 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 23.40 |
| PF01979 | Amidohydro_1 | 10.90 |
| PF01243 | Putative_PNPOx | 7.69 |
| PF00106 | adh_short | 2.24 |
| PF02776 | TPP_enzyme_N | 2.24 |
| PF12867 | DinB_2 | 2.24 |
| PF01850 | PIN | 1.92 |
| PF13414 | TPR_11 | 1.92 |
| PF02738 | MoCoBD_1 | 1.92 |
| PF01738 | DLH | 1.60 |
| PF01569 | PAP2 | 1.28 |
| PF01370 | Epimerase | 1.28 |
| PF11716 | MDMPI_N | 1.28 |
| PF04909 | Amidohydro_2 | 1.28 |
| PF02826 | 2-Hacid_dh_C | 1.28 |
| PF02880 | PGM_PMM_III | 1.28 |
| PF01402 | RHH_1 | 1.28 |
| PF00892 | EamA | 1.28 |
| PF01436 | NHL | 1.28 |
| PF00496 | SBP_bac_5 | 1.28 |
| PF02146 | SIR2 | 0.96 |
| PF00881 | Nitroreductase | 0.96 |
| PF00589 | Phage_integrase | 0.96 |
| PF01636 | APH | 0.96 |
| PF13649 | Methyltransf_25 | 0.96 |
| PF13241 | NAD_binding_7 | 0.64 |
| PF04879 | Molybdop_Fe4S4 | 0.64 |
| PF02771 | Acyl-CoA_dh_N | 0.64 |
| PF00665 | rve | 0.64 |
| PF13147 | Obsolete Pfam Family | 0.64 |
| PF00561 | Abhydrolase_1 | 0.32 |
| PF02464 | CinA | 0.32 |
| PF01266 | DAO | 0.32 |
| PF07883 | Cupin_2 | 0.32 |
| PF08241 | Methyltransf_11 | 0.32 |
| PF00590 | TP_methylase | 0.32 |
| PF01965 | DJ-1_PfpI | 0.32 |
| PF13560 | HTH_31 | 0.32 |
| PF00528 | BPD_transp_1 | 0.32 |
| PF02777 | Sod_Fe_C | 0.32 |
| PF01909 | NTP_transf_2 | 0.32 |
| PF13174 | TPR_6 | 0.32 |
| PF13458 | Peripla_BP_6 | 0.32 |
| PF13432 | TPR_16 | 0.32 |
| PF04392 | ABC_sub_bind | 0.32 |
| PF14226 | DIOX_N | 0.32 |
| COG ID | Name | Functional Category | % Frequency in 312 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 23.40 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 1.28 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 1.28 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.64 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.64 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.64 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.64 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.64 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.32 |
| COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 0.32 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.32 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.17 % |
| Unclassified | root | N/A | 20.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig05205 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1960 | Open in IMG/M |
| 2199352025|deepsgr__Contig_6786 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 816 | Open in IMG/M |
| 3300000443|F12B_10010488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 707 | Open in IMG/M |
| 3300000564|RepKanNP_BrdU_F12BDRAFT_1003864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 922 | Open in IMG/M |
| 3300000953|JGI11615J12901_10007649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300000955|JGI1027J12803_100210509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
| 3300000955|JGI1027J12803_106007548 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300001372|YBBDRAFT_1097761 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300002558|JGI25385J37094_10071229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1108 | Open in IMG/M |
| 3300002908|JGI25382J43887_10426063 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
| 3300002912|JGI25386J43895_10141680 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300003371|JGI26145J50221_1008055 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300004114|Ga0062593_102307530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300004267|Ga0066396_10059810 | Not Available | 632 | Open in IMG/M |
| 3300004281|Ga0066397_10082320 | Not Available | 645 | Open in IMG/M |
| 3300004633|Ga0066395_10532688 | Not Available | 681 | Open in IMG/M |
| 3300005168|Ga0066809_10196542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300005171|Ga0066677_10061316 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300005171|Ga0066677_10441184 | Not Available | 745 | Open in IMG/M |
| 3300005174|Ga0066680_10009965 | All Organisms → cellular organisms → Bacteria | 4830 | Open in IMG/M |
| 3300005177|Ga0066690_10029240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3187 | Open in IMG/M |
| 3300005180|Ga0066685_11025070 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300005280|Ga0065696_1348937 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 556 | Open in IMG/M |
| 3300005295|Ga0065707_10704893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
| 3300005330|Ga0070690_100579888 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005332|Ga0066388_100163884 | All Organisms → cellular organisms → Bacteria | 2815 | Open in IMG/M |
| 3300005332|Ga0066388_101389756 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300005332|Ga0066388_101622231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1140 | Open in IMG/M |
| 3300005332|Ga0066388_101966874 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005334|Ga0068869_100432707 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300005345|Ga0070692_10193996 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1185 | Open in IMG/M |
| 3300005353|Ga0070669_101075602 | Not Available | 692 | Open in IMG/M |
| 3300005356|Ga0070674_100544114 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300005444|Ga0070694_101612057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 551 | Open in IMG/M |
| 3300005445|Ga0070708_100176350 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| 3300005445|Ga0070708_100217205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1792 | Open in IMG/M |
| 3300005445|Ga0070708_100591679 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005445|Ga0070708_101667046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300005454|Ga0066687_10632727 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 636 | Open in IMG/M |
| 3300005457|Ga0070662_101357769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300005467|Ga0070706_100330002 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300005467|Ga0070706_100792336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300005467|Ga0070706_101658971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
| 3300005468|Ga0070707_101996541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300005468|Ga0070707_102210591 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005518|Ga0070699_100048728 | All Organisms → cellular organisms → Bacteria | 3667 | Open in IMG/M |
| 3300005518|Ga0070699_100244039 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300005518|Ga0070699_100363768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1304 | Open in IMG/M |
| 3300005518|Ga0070699_101740013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300005540|Ga0066697_10245774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1060 | Open in IMG/M |
| 3300005544|Ga0070686_100240987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1317 | Open in IMG/M |
| 3300005546|Ga0070696_100570588 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300005547|Ga0070693_101119829 | Not Available | 601 | Open in IMG/M |
| 3300005554|Ga0066661_10237615 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1129 | Open in IMG/M |
| 3300005555|Ga0066692_10160743 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300005555|Ga0066692_10171822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1343 | Open in IMG/M |
| 3300005555|Ga0066692_10946648 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005557|Ga0066704_10703855 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005557|Ga0066704_10834592 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 572 | Open in IMG/M |
| 3300005558|Ga0066698_10128789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1694 | Open in IMG/M |
| 3300005558|Ga0066698_10418410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300005559|Ga0066700_11149182 | Not Available | 507 | Open in IMG/M |
| 3300005560|Ga0066670_10448444 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005561|Ga0066699_10825949 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005561|Ga0066699_11045621 | Not Available | 564 | Open in IMG/M |
| 3300005563|Ga0068855_101250747 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300005574|Ga0066694_10220819 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 899 | Open in IMG/M |
| 3300005598|Ga0066706_10293558 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300005598|Ga0066706_10478806 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300005617|Ga0068859_102309880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300005713|Ga0066905_101198188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 679 | Open in IMG/M |
| 3300005713|Ga0066905_102124204 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
| 3300005764|Ga0066903_102397341 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300005764|Ga0066903_105176233 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300005829|Ga0074479_10413344 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 571 | Open in IMG/M |
| 3300005841|Ga0068863_100854140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 909 | Open in IMG/M |
| 3300005844|Ga0068862_100206517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1773 | Open in IMG/M |
| 3300005844|Ga0068862_101153072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 772 | Open in IMG/M |
| 3300005981|Ga0081538_10167807 | Not Available | 963 | Open in IMG/M |
| 3300006031|Ga0066651_10646428 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006034|Ga0066656_10389105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300006046|Ga0066652_100866221 | Not Available | 863 | Open in IMG/M |
| 3300006173|Ga0070716_101085015 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 638 | Open in IMG/M |
| 3300006196|Ga0075422_10007028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3569 | Open in IMG/M |
| 3300006196|Ga0075422_10183025 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300006791|Ga0066653_10705097 | Not Available | 522 | Open in IMG/M |
| 3300006796|Ga0066665_11654036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300006797|Ga0066659_10353580 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300006845|Ga0075421_102004089 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 617 | Open in IMG/M |
| 3300006852|Ga0075433_10072882 | All Organisms → cellular organisms → Bacteria | 3020 | Open in IMG/M |
| 3300006853|Ga0075420_100819226 | Not Available | 802 | Open in IMG/M |
| 3300006854|Ga0075425_100208159 | All Organisms → cellular organisms → Bacteria | 2248 | Open in IMG/M |
| 3300006854|Ga0075425_100325367 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300006871|Ga0075434_100138741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2451 | Open in IMG/M |
| 3300006871|Ga0075434_100351665 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300006871|Ga0075434_101186681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 775 | Open in IMG/M |
| 3300006871|Ga0075434_102203827 | Not Available | 555 | Open in IMG/M |
| 3300006876|Ga0079217_11204042 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300006894|Ga0079215_11081322 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300006904|Ga0075424_102048766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
| 3300006914|Ga0075436_100641158 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300006914|Ga0075436_101418356 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300007004|Ga0079218_12132283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
| 3300007076|Ga0075435_101232700 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300009011|Ga0105251_10629948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 511 | Open in IMG/M |
| 3300009012|Ga0066710_101479251 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300009012|Ga0066710_102738126 | Not Available | 701 | Open in IMG/M |
| 3300009090|Ga0099827_11659371 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300009090|Ga0099827_11885304 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
| 3300009094|Ga0111539_12936236 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300009100|Ga0075418_12079980 | Not Available | 619 | Open in IMG/M |
| 3300009137|Ga0066709_103047209 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
| 3300009147|Ga0114129_10450112 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300009153|Ga0105094_10637705 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 623 | Open in IMG/M |
| 3300009156|Ga0111538_12904931 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009162|Ga0075423_10475703 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300009792|Ga0126374_10024860 | All Organisms → cellular organisms → Bacteria | 2702 | Open in IMG/M |
| 3300009792|Ga0126374_10985279 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 660 | Open in IMG/M |
| 3300009795|Ga0105059_1021071 | Not Available | 717 | Open in IMG/M |
| 3300009797|Ga0105080_1017704 | Not Available | 715 | Open in IMG/M |
| 3300009804|Ga0105063_1027120 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300009804|Ga0105063_1040763 | Not Available | 634 | Open in IMG/M |
| 3300009816|Ga0105076_1016093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1280 | Open in IMG/M |
| 3300010043|Ga0126380_10180686 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300010043|Ga0126380_11235706 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 646 | Open in IMG/M |
| 3300010043|Ga0126380_11733259 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010046|Ga0126384_10105503 | All Organisms → cellular organisms → Bacteria | 2089 | Open in IMG/M |
| 3300010047|Ga0126382_10057182 | All Organisms → cellular organisms → Bacteria | 2320 | Open in IMG/M |
| 3300010047|Ga0126382_11486115 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 622 | Open in IMG/M |
| 3300010047|Ga0126382_11772375 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
| 3300010047|Ga0126382_12120974 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010301|Ga0134070_10425551 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
| 3300010303|Ga0134082_10073090 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300010304|Ga0134088_10233160 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300010336|Ga0134071_10772180 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010336|Ga0134071_10798310 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
| 3300010358|Ga0126370_10407660 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1119 | Open in IMG/M |
| 3300010358|Ga0126370_11901912 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
| 3300010359|Ga0126376_12657755 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
| 3300010360|Ga0126372_10220487 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1599 | Open in IMG/M |
| 3300010360|Ga0126372_10358835 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300010360|Ga0126372_11184611 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300010362|Ga0126377_10619481 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1128 | Open in IMG/M |
| 3300010362|Ga0126377_12631173 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 578 | Open in IMG/M |
| 3300010362|Ga0126377_12949472 | Not Available | 549 | Open in IMG/M |
| 3300010391|Ga0136847_12583892 | Not Available | 1223 | Open in IMG/M |
| 3300010391|Ga0136847_12741351 | Not Available | 1147 | Open in IMG/M |
| 3300010398|Ga0126383_12071768 | Not Available | 656 | Open in IMG/M |
| 3300010399|Ga0134127_10365089 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300010399|Ga0134127_11189547 | Not Available | 829 | Open in IMG/M |
| 3300010401|Ga0134121_10793594 | Not Available | 909 | Open in IMG/M |
| 3300010401|Ga0134121_12133958 | Not Available | 596 | Open in IMG/M |
| 3300011271|Ga0137393_11150883 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 659 | Open in IMG/M |
| 3300012096|Ga0137389_10770577 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300012096|Ga0137389_11809024 | Not Available | 507 | Open in IMG/M |
| 3300012189|Ga0137388_11371491 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 646 | Open in IMG/M |
| 3300012199|Ga0137383_11221652 | Not Available | 539 | Open in IMG/M |
| 3300012202|Ga0137363_11416339 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012203|Ga0137399_10181371 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300012205|Ga0137362_11241086 | Not Available | 630 | Open in IMG/M |
| 3300012205|Ga0137362_11579740 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012206|Ga0137380_11706895 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012349|Ga0137387_10048204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2832 | Open in IMG/M |
| 3300012358|Ga0137368_10017656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 6894 | Open in IMG/M |
| 3300012362|Ga0137361_11670088 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
| 3300012363|Ga0137390_11281571 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012582|Ga0137358_10764378 | Not Available | 644 | Open in IMG/M |
| 3300012909|Ga0157290_10088370 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300012918|Ga0137396_10549724 | Not Available | 855 | Open in IMG/M |
| 3300012925|Ga0137419_11246162 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012929|Ga0137404_10421966 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1179 | Open in IMG/M |
| 3300012929|Ga0137404_11616421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 601 | Open in IMG/M |
| 3300012930|Ga0137407_10633880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1004 | Open in IMG/M |
| 3300012930|Ga0137407_10844762 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 865 | Open in IMG/M |
| 3300012944|Ga0137410_10372702 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300012971|Ga0126369_10403173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1406 | Open in IMG/M |
| 3300012972|Ga0134077_10347923 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012976|Ga0134076_10321038 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 675 | Open in IMG/M |
| 3300013306|Ga0163162_10166749 | All Organisms → cellular organisms → Bacteria | 2326 | Open in IMG/M |
| 3300014157|Ga0134078_10549844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 545 | Open in IMG/M |
| 3300014254|Ga0075312_1060771 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 733 | Open in IMG/M |
| 3300014325|Ga0163163_11993477 | Not Available | 640 | Open in IMG/M |
| 3300014326|Ga0157380_11378965 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 755 | Open in IMG/M |
| 3300014883|Ga0180086_1050971 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300014885|Ga0180063_1231115 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 593 | Open in IMG/M |
| 3300015053|Ga0137405_1337867 | All Organisms → cellular organisms → Bacteria | 2414 | Open in IMG/M |
| 3300015359|Ga0134085_10279816 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300015359|Ga0134085_10333185 | Not Available | 672 | Open in IMG/M |
| 3300015372|Ga0132256_100295812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1702 | Open in IMG/M |
| 3300015372|Ga0132256_101447000 | Not Available | 798 | Open in IMG/M |
| 3300016319|Ga0182033_10416229 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300017656|Ga0134112_10076911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1235 | Open in IMG/M |
| 3300017656|Ga0134112_10271998 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300017656|Ga0134112_10455153 | Not Available | 536 | Open in IMG/M |
| 3300017659|Ga0134083_10109590 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300017930|Ga0187825_10437257 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018051|Ga0184620_10160057 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 732 | Open in IMG/M |
| 3300018052|Ga0184638_1001030 | All Organisms → cellular organisms → Bacteria | 8244 | Open in IMG/M |
| 3300018066|Ga0184617_1176811 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 633 | Open in IMG/M |
| 3300018071|Ga0184618_10454322 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300018075|Ga0184632_10397830 | Not Available | 579 | Open in IMG/M |
| 3300018076|Ga0184609_10483288 | Not Available | 566 | Open in IMG/M |
| 3300018077|Ga0184633_10574577 | Not Available | 535 | Open in IMG/M |
| 3300018078|Ga0184612_10602797 | Not Available | 520 | Open in IMG/M |
| 3300018079|Ga0184627_10566717 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_2_68_13 | 576 | Open in IMG/M |
| 3300018082|Ga0184639_10486582 | Not Available | 625 | Open in IMG/M |
| 3300018422|Ga0190265_11357209 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 827 | Open in IMG/M |
| 3300018422|Ga0190265_11612654 | Not Available | 760 | Open in IMG/M |
| 3300018433|Ga0066667_12175551 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300018468|Ga0066662_12430459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300018482|Ga0066669_11172743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 693 | Open in IMG/M |
| 3300019487|Ga0187893_10288747 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300019487|Ga0187893_10311061 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1115 | Open in IMG/M |
| 3300019879|Ga0193723_1036247 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1475 | Open in IMG/M |
| 3300020170|Ga0179594_10083794 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300021178|Ga0210408_10378282 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300021178|Ga0210408_10647731 | Not Available | 834 | Open in IMG/M |
| 3300025155|Ga0209320_10209334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 844 | Open in IMG/M |
| 3300025324|Ga0209640_10526677 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300025326|Ga0209342_11113050 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
| 3300025549|Ga0210094_1097538 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
| 3300025910|Ga0207684_11014397 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300025937|Ga0207669_11467587 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300025957|Ga0210089_1020566 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300025961|Ga0207712_10525104 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300025961|Ga0207712_10616600 | Not Available | 940 | Open in IMG/M |
| 3300026001|Ga0208000_100141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2174 | Open in IMG/M |
| 3300026018|Ga0208418_1026070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1 | 607 | Open in IMG/M |
| 3300026035|Ga0207703_10074998 | All Organisms → cellular organisms → Bacteria | 2802 | Open in IMG/M |
| 3300026277|Ga0209350_1137815 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
| 3300026285|Ga0209438_1025839 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
| 3300026298|Ga0209236_1190262 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 791 | Open in IMG/M |
| 3300026310|Ga0209239_1230306 | Not Available | 645 | Open in IMG/M |
| 3300026322|Ga0209687_1185945 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 646 | Open in IMG/M |
| 3300026325|Ga0209152_10045885 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300026326|Ga0209801_1221296 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 741 | Open in IMG/M |
| 3300026328|Ga0209802_1115626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1186 | Open in IMG/M |
| 3300026332|Ga0209803_1130252 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300026335|Ga0209804_1076616 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300026354|Ga0257180_1030814 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300026514|Ga0257168_1071823 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300026529|Ga0209806_1012015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4637 | Open in IMG/M |
| 3300026532|Ga0209160_1035109 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3099 | Open in IMG/M |
| 3300026536|Ga0209058_1180496 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300026536|Ga0209058_1296004 | Not Available | 557 | Open in IMG/M |
| 3300026537|Ga0209157_1127722 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300026537|Ga0209157_1306534 | Not Available | 580 | Open in IMG/M |
| 3300026759|Ga0207527_104743 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300027360|Ga0209969_1014151 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300027364|Ga0209967_1009637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1341 | Open in IMG/M |
| 3300027384|Ga0209854_1044292 | Not Available | 760 | Open in IMG/M |
| 3300027646|Ga0209466_1056596 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300027655|Ga0209388_1216995 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027684|Ga0209626_1153988 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300027695|Ga0209966_1055312 | Not Available | 850 | Open in IMG/M |
| 3300027722|Ga0209819_10170450 | Not Available | 761 | Open in IMG/M |
| 3300027748|Ga0209689_1023489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3769 | Open in IMG/M |
| 3300027748|Ga0209689_1054238 | All Organisms → cellular organisms → Bacteria | 2230 | Open in IMG/M |
| 3300027875|Ga0209283_10826450 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300027876|Ga0209974_10032184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1738 | Open in IMG/M |
| 3300027880|Ga0209481_10233787 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300027880|Ga0209481_10532288 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300027882|Ga0209590_10142060 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300027903|Ga0209488_11207945 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 509 | Open in IMG/M |
| 3300027910|Ga0209583_10500803 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 600 | Open in IMG/M |
| 3300028380|Ga0268265_11505935 | Not Available | 676 | Open in IMG/M |
| 3300028592|Ga0247822_10507068 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300028803|Ga0307281_10093550 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1003 | Open in IMG/M |
| 3300028812|Ga0247825_10181880 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300028812|Ga0247825_10500604 | Not Available | 865 | Open in IMG/M |
| 3300028889|Ga0247827_10439804 | Not Available | 802 | Open in IMG/M |
| 3300030006|Ga0299907_10592548 | Not Available | 863 | Open in IMG/M |
| 3300030619|Ga0268386_10803387 | Not Available | 601 | Open in IMG/M |
| 3300030620|Ga0302046_11332869 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300031170|Ga0307498_10069103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300031229|Ga0299913_10775347 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 933 | Open in IMG/M |
| 3300031548|Ga0307408_101495223 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300031548|Ga0307408_102278254 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031549|Ga0318571_10367002 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
| 3300031562|Ga0310886_10095966 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300031720|Ga0307469_12511685 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031723|Ga0318493_10217527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1013 | Open in IMG/M |
| 3300031731|Ga0307405_10428640 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300031740|Ga0307468_100355905 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300031740|Ga0307468_101641597 | Not Available | 602 | Open in IMG/M |
| 3300031770|Ga0318521_10563846 | Not Available | 687 | Open in IMG/M |
| 3300031781|Ga0318547_11063046 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
| 3300031794|Ga0318503_10168605 | Not Available | 708 | Open in IMG/M |
| 3300031819|Ga0318568_10768521 | Not Available | 598 | Open in IMG/M |
| 3300031820|Ga0307473_11283632 | Not Available | 547 | Open in IMG/M |
| 3300031847|Ga0310907_10579037 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031862|Ga0315280_10371655 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 673 | Open in IMG/M |
| 3300031890|Ga0306925_11209346 | Not Available | 757 | Open in IMG/M |
| 3300031901|Ga0307406_10337811 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300031901|Ga0307406_11159051 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300031910|Ga0306923_10556638 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300031945|Ga0310913_10564575 | Not Available | 807 | Open in IMG/M |
| 3300031995|Ga0307409_100458231 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300031995|Ga0307409_100537469 | Not Available | 1145 | Open in IMG/M |
| 3300032002|Ga0307416_103226493 | Not Available | 546 | Open in IMG/M |
| 3300032076|Ga0306924_10032808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5652 | Open in IMG/M |
| 3300032122|Ga0310895_10206770 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300032126|Ga0307415_101287810 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300032174|Ga0307470_11413279 | Not Available | 575 | Open in IMG/M |
| 3300032180|Ga0307471_100152432 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300032770|Ga0335085_11431906 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300033433|Ga0326726_11720953 | Not Available | 611 | Open in IMG/M |
| 3300033501|Ga0326732_1022995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1066 | Open in IMG/M |
| 3300033513|Ga0316628_100934473 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1149 | Open in IMG/M |
| 3300033513|Ga0316628_101762886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 824 | Open in IMG/M |
| 3300033812|Ga0364926_125377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.53% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.32% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.32% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.32% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.32% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.32% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.32% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.32% |
| Switchgrass Rhizosphere Bulk Soil | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil | 0.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.32% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.32% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.64% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.64% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.64% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.64% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.64% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.64% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.64% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000564 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005280 | Switchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soil | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300009797 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026001 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 (SPAdes) | Environmental | Open in IMG/M |
| 3300026018 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026759 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033501 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fraction | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0205.00000640 | 2166559005 | Simulated | MDFEFSPDEQAFAHEVRAFLVTHPPETFAVDGMDAGYGSGAHSRPSCALSPTRGG |
| deepsgr_00905390 | 2199352025 | Soil | MDFEFSPDEQAFAHEVRAFLVTHPPETFAVDGMDAGYGSGA |
| F12B_100104882 | 3300000443 | Soil | MDFDFTDAERAFAEEVRRFLRENPPEAFAIDGMDAGYGSGANS |
| RepKanNP_BrdU_F12BDRAFT_10038641 | 3300000564 | Soil | MDFDFTDAERAFAEEVRGFLRANPPETFAIDGMDAGYGS |
| JGI11615J12901_100076491 | 3300000953 | Soil | MDFAFSDEERAFADEVRDFVAANPLERFPLDGMDA |
| JGI1027J12803_1002105092 | 3300000955 | Soil | MNFDFTEAEQAFAEEVRRFLRANPPETFPVDGMDAGYGSGSNSRAFMKA |
| JGI1027J12803_1060075481 | 3300000955 | Soil | MDFGFTTEEQAFAEEVRAFLRANPPESFPETGMDAG |
| YBBDRAFT_10977612 | 3300001372 | Marine Estuarine | MDFEFGPDEQAFAHEVRGFLRAHPPETFAVDGMDAGYGSGAHSRPFLKALADEAGSP* |
| JGI25385J37094_100712292 | 3300002558 | Grasslands Soil | MNFDFTEAEQAFAEEVRLFLRANPPETFPIDGMDAGYGSGAHSRAFL |
| JGI25382J43887_104260631 | 3300002908 | Grasslands Soil | MEFGFSVTEQRFAEEVRTFLRDHPLDRFPLDGMDAGYGSGAHSRAFMRALGERGWISMCW |
| JGI25386J43895_101416802 | 3300002912 | Grasslands Soil | MDFAYTADEQAFAAEVRRFLASHPPDRFAVDGMDAGYGSGSHSRPFLRALXDQ |
| JGI26145J50221_10080551 | 3300003371 | Arabidopsis Thaliana Rhizosphere | MDFGRSADEQAFADEVRAFLRAHPPATFPADGTDAGYGSGAHSRAFLG |
| Ga0062593_1023075302 | 3300004114 | Soil | MNFDFTEAEQAFADEVRRFLRANPPETFAVDGMDAGYGSGANSRAFIKALAAQGWISMCW |
| Ga0066396_100598102 | 3300004267 | Tropical Forest Soil | MNFDFTAAEQAFAEEVRQFVRANPPDTFPIDGMDAGYGSG |
| Ga0066397_100823201 | 3300004281 | Tropical Forest Soil | MDFDFTDGERAFAEEVRGFLRANPPETFAIDGMDAGYGSGAN |
| Ga0066395_105326882 | 3300004633 | Tropical Forest Soil | MDFDFTDGERAFAEEVRGFLRANPPETFAIDGMDAGYGSGANSRAFL |
| Ga0066809_101965422 | 3300005168 | Soil | MVTFVTMHLGFSAEETAFAEEVRAFLRRHPPDTFPPDGMDAGYGSGA |
| Ga0066677_100613163 | 3300005171 | Soil | MNFDFTEAEQAFAEEVRRFLRANPPETFPVDGMDAGYGSGSNSRAFMKALG |
| Ga0066677_104411842 | 3300005171 | Soil | MNFDFTEAEQAFADEVRRFIRANPPDTFAVDGMDAGYGSG |
| Ga0066680_100099656 | 3300005174 | Soil | MEFGFSPAETAFAEEVRGFLREQPLERFPVDGMDAGYGSGAHSRAFMKAL |
| Ga0066690_100292406 | 3300005177 | Soil | MSVNFDFTAAEQTFADEVRRFLRATPPETFPVDGMDAGYGSG |
| Ga0066685_110250701 | 3300005180 | Soil | MNFDFTESEQAFAEEVRLFLRANPPETFPIDGMDAGYGSGAHSRAFL |
| Ga0065696_13489372 | 3300005280 | Switchgrass Rhizosphere Bulk Soil | MDFGRSGPEQAFADEVRAFLQAHPPDTVPPTDGTDAGYGSGAHSRTFT |
| Ga0065707_107048931 | 3300005295 | Switchgrass Rhizosphere | MDFAFTPAETAFAEEVRAFLRDNPVDRFPLDGMDAGYGSGAHSRAFMQALAVRG |
| Ga0070690_1005798883 | 3300005330 | Switchgrass Rhizosphere | MDFAFTDDERAFAEDVRRFLRAHPLERFAVEGMDAGYGSGAHS |
| Ga0066388_1001638841 | 3300005332 | Tropical Forest Soil | MNFDFTEAEQAFAEEVRLFIRANPPDTFPIDGMDAGYGSG |
| Ga0066388_1013897563 | 3300005332 | Tropical Forest Soil | MDFDFSPDEQAFADEVRGFLRAHPPERFPVDGMDAGYGSGAHSRAFLR |
| Ga0066388_1016222311 | 3300005332 | Tropical Forest Soil | MEFGFSPAEQAFAEEVRAFLRANPLDRFALDGMDAGYGSGAHSRAFMKALGERGWISMCW |
| Ga0066388_1019668741 | 3300005332 | Tropical Forest Soil | MDFAFTADERAFAEDVRRFLRAHPLESFPLEGMDAGYGSGAHSRAFM |
| Ga0068869_1004327072 | 3300005334 | Miscanthus Rhizosphere | MLTFVTMHLGFSAEETAFAEEVRAFLRRHPPGTFSPDGMDAGYGSGAVSRAFLLALGAEGYLRM |
| Ga0070692_101939962 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFGLSDAEQAFADEVRAFLRAQPPDTFAEDGTDAGYRSGAHSRAFTRALGE |
| Ga0070669_1010756021 | 3300005353 | Switchgrass Rhizosphere | MDFDFTVGERAFAEEVRGFLRANPPETFAIDGMDAGYGSGAN |
| Ga0070674_1005441141 | 3300005356 | Miscanthus Rhizosphere | MDFAFTDDERAFAEDVRRFLRAHPLERFAVEGMDAGYGSGAHSRAF |
| Ga0070694_1016120571 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFGHSAAEQAFAEEVRAFLRAHPPDTFPPDGTDAGYGSGA |
| Ga0070708_1001763501 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFEFSPAERAFTEEVRGFLRAHPPETFPIDGMDAGYGSGAHSRPFLRALAD |
| Ga0070708_1002172053 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFDFTEAEQAFAEEVRRFLRANPPETFPVDGMDAGYGSGSNSRAFMKALGAQGWISMCW |
| Ga0070708_1005916793 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFALTDEERAFAEEVRRFLRAHPPESFAVDGMDAGYGSGA |
| Ga0070708_1016670461 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFDFTEAEQAFADEVRRFLRANPPETFAVDGMDAGYGSGA |
| Ga0066687_106327271 | 3300005454 | Soil | MEFGFSAAEQTFAEDVRRFLRDNPLDRFPLDGMDAGYGSGA |
| Ga0070662_1013577692 | 3300005457 | Corn Rhizosphere | MNFDFTEAEQAFADEVRRFLRANPPETFAIDGMDAGYGSGANS |
| Ga0070706_1003300021 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VDFTLTDEEHAFAENVRRFLRAHPPESFAVDGMDAGYGSGA |
| Ga0070706_1007923361 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFDFTAAEQTFADEVRRFLRATSPETFPVDGMDAGYGSGSNSRAFMKALGAQGWISMCW |
| Ga0070706_1016589711 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTFVTMHLGFSAEEAAFAEEVRAFLRRHPPDTFPPDGMDAGYGSGA |
| Ga0070707_1019965412 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFDFTEAEQAFAEEVRRFLRATPPETFPVDGMDAGYGSGSNSRAFMKALGAQGWISMCWPKA |
| Ga0070707_1022105911 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFGHSAAEQAFAEEVRAFLRAHPPDTFPPDGTDAGYGSGAH |
| Ga0070699_1000487285 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFARTAEEEVFASGVRRFLAAHPPESFARDGMDAGYGSGAHSREFLAALAAQGWL |
| Ga0070699_1002440393 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFDFTEAEQAFAEEVRRFLRGNAPETFPIDGMDAGYGSGAHSRAFLKA |
| Ga0070699_1003637682 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFDFTAAEQTFADEVRRFLRATPPETFPVDGMDAGYGSGSNSRAFMKALGAQGWISMCW |
| Ga0070699_1017400132 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MEFGFPADAEVFREEIRAFIREHPPAAFPEDGMDAGYGSGAHSHAFM |
| Ga0066697_102457742 | 3300005540 | Soil | MNFDFTEAEQAFADEVRRFLRATPPETFPVDGMDAGYGSGSNSRAFMKALGAQGWISMCWPK |
| Ga0070686_1002409871 | 3300005544 | Switchgrass Rhizosphere | MLTFVTMHLGFSAEETAFAEEVRAFLRRHPPGTFSPDGMDAGYGSGAVSRAFLVALGAEGYL |
| Ga0070696_1005705881 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFGFSAAETAFADEVRRFLGEHPPARYPVDGMDAGYGSGAHSR |
| Ga0070693_1011198291 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFDFTEAEQAFADEVRRFLRANPPETFAVDGMDAGYGSGANSRAFIKALA |
| Ga0066661_102376152 | 3300005554 | Soil | MEFEFSAAEQAFAEDVRRFLRDNPLDRFPLDGMDAGYGSGAH |
| Ga0066692_101607433 | 3300005555 | Soil | MEFGFSAAEQAFAEDVRRFLRDNALDRFPLDGMDAGYGSGAHSRAFMRALAERGWISMCW |
| Ga0066692_101718221 | 3300005555 | Soil | MNFDFTEAEQAFADEVRRFLRANPPETFAVDGMDAGYGSGANSRAF |
| Ga0066692_109466481 | 3300005555 | Soil | VEFGWSADERAFAEEVRSFLRAHPPADFPSDGMDAGY |
| Ga0066704_107038551 | 3300005557 | Soil | MEFTLTAEEQTFASEVRGFLRDHPLAQFPLDGMDAGYGSGANSKAFIRALAE |
| Ga0066704_108345921 | 3300005557 | Soil | MNFDFSEAEQAFVEEVRRFLRANPLETFPVDGMDAGYGSGANSRAFLKALGAQGWLSM |
| Ga0066698_101287891 | 3300005558 | Soil | MNFDFTEAEQAFADEVRRFLRATPPETFPVDGMDAGYGSGSNSRAFMKALGAQGWISMCW |
| Ga0066698_104184101 | 3300005558 | Soil | MNFDFTEAEQAFADEVRRFIRANPPDTFAVDGMDAGYGSGANSR |
| Ga0066700_111491821 | 3300005559 | Soil | MEFALTAEEQAFASEVRGFLRDHPLRQFPLDGMDAGYGSGANSKAFIRAL |
| Ga0066670_104484441 | 3300005560 | Soil | MDFAYTADEQAFAAEVRRFLASHPPDRFAVDGMDAGYGSGSHSRPFLRALA |
| Ga0066699_108259491 | 3300005561 | Soil | MEFARTPDEAAFAEDVREFLRAHPPEACAIDGMDAGYGSGAHSREFLAALGAR |
| Ga0066699_110456212 | 3300005561 | Soil | MDFTLTAHEQAFAADVRGFLRDHPLSEFPVDGMDAGYGSGANSKAFI |
| Ga0068855_1012507471 | 3300005563 | Corn Rhizosphere | MEFGFSGDELAFADDVRRFVRAHPPADYPHDGMDAGYGSGAHSHAFLRALAAEGWMSMTWPRAF |
| Ga0066694_102208192 | 3300005574 | Soil | MEFEFSAAEQAFAEDVRRFLRDNPLDRFPLDGMDAGYGSGAHSRAFMRALAERGWIS |
| Ga0066706_102935582 | 3300005598 | Soil | MEFGFTAEEQAFAEEVRAFLRAHPVESFPEDGMDAGYGSGPHSRAFL |
| Ga0066706_104788062 | 3300005598 | Soil | MDFTFTADEQAFAAEVRRFLRDHPPSAFPADGMDAGY |
| Ga0068859_1023098801 | 3300005617 | Switchgrass Rhizosphere | MEFGFSDDEVAFAEEVRRFLRAHPPADYPHDGMDAGYGSGAHS |
| Ga0066905_1011981882 | 3300005713 | Tropical Forest Soil | MNFDFTAAEHAFADEVRRFIRANPPETFAVDGMDAGYGSGA |
| Ga0066905_1021242041 | 3300005713 | Tropical Forest Soil | MDFAFTADERAFAEDVRRFLRAHPPESFPLEGMDAG |
| Ga0066903_1023973411 | 3300005764 | Tropical Forest Soil | MDLGFTAEEQAFADEVRAFLRANPPDRFPETGMDAGYGSGP |
| Ga0066903_1051762332 | 3300005764 | Tropical Forest Soil | MDFEFSPDEQAFAEEVRGFLRAHPPERFPVDGMDAGYGSGAHSRAFLRALAE |
| Ga0074479_104133441 | 3300005829 | Sediment (Intertidal) | MDFGLSGPEQAFADEVRAFLHAHPPETFPEDGTDAGYGSGAHSRVFTQALGERGWLSMGW |
| Ga0068863_1008541401 | 3300005841 | Switchgrass Rhizosphere | MLTFVTMHLGFSAEETAFAEEVRAFLRRHPPDTFPPDGMDAGYGSGAVSRAFLLALGAEGYLRM |
| Ga0068862_1002065173 | 3300005844 | Switchgrass Rhizosphere | MDFDFTVGERAFAEEVRGFLRANPPETFAIDGMDAGYGSGANS |
| Ga0068862_1011530721 | 3300005844 | Switchgrass Rhizosphere | MNFDFTEAEQAFADEVRRFLRANPPETFAVDGMDAGYGSGAN |
| Ga0081538_101678072 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MEFGFSADEEAFRQEVQQFLRHNPPDSFPEDGMDAGYGSGAHS |
| Ga0066651_106464281 | 3300006031 | Soil | MHFEFSPAERAFAEEVRGFLRAHPPETFPIDGMDAGYGSGAHSRPFLRALADQGWLS |
| Ga0066656_103891052 | 3300006034 | Soil | MNFDFTEAEQAFADEVRRFIRANPPDTFAVDGMDAGYGSGANS |
| Ga0066652_1008662212 | 3300006046 | Soil | MDYALTEPERLFAEEVRRFLRAHPPETFPIDGMDAGYGSG |
| Ga0070716_1010850152 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFDFTEAEQGFADEVRRFLRASPPDTFAIDGMDAGYG |
| Ga0075422_100070281 | 3300006196 | Populus Rhizosphere | MNFDFTEAERAFAEEVRGFLRANPPEAFAIDGMDAGYGSGANSR |
| Ga0075422_101830251 | 3300006196 | Populus Rhizosphere | MEFAFTAEEQAFREDIRQFLRDHPPEHFAHEGMDAGYGSGA |
| Ga0066653_107050971 | 3300006791 | Soil | MEFTLTADEQAFASDVRGFLRDRPLTEFPVDGMDAGYGSG |
| Ga0066665_116540361 | 3300006796 | Soil | MDFAYTADEQAFAAEVRRFLAEHPPDRFAVDGMDA |
| Ga0066659_103535801 | 3300006797 | Soil | MEFAFTADEQAFREDIRQFLQDYPPEHFAHEGMDAGYGSGAH |
| Ga0075421_1020040891 | 3300006845 | Populus Rhizosphere | MEFGFSAAEQAFAEEVRAFLRANPLDRFALDGMDAGYGSGAHSRAFMKALGERGWISMCWPE |
| Ga0075433_100728824 | 3300006852 | Populus Rhizosphere | VEFGFTPAEEAFREEVRRFVDEHPAQRYPLEGMDAGYGSGAHSRAFM |
| Ga0075420_1008192263 | 3300006853 | Populus Rhizosphere | MEFSFTADEAAFREEVRAFLRRHPPENFPVEGMDAGYGSGAHSHAFLQKLAEQG |
| Ga0075425_1002081591 | 3300006854 | Populus Rhizosphere | MDFGFSPAEQAFAEEVRAFLRANPLDRFALDGMDAGYGSGAHSR |
| Ga0075425_1003253673 | 3300006854 | Populus Rhizosphere | MNFDFTAAEQAFADEVRRFIRANPPETFAVDGMDAGYGSGANSR |
| Ga0075434_1001387414 | 3300006871 | Populus Rhizosphere | MEFSFTDEERAFADEVREFLAANPLARFPLDGMDAGYGSGAH |
| Ga0075434_1003516652 | 3300006871 | Populus Rhizosphere | MEFTLTAEEQAFASEVRGFLRDHPLEQFPLDGMDAGYGSGANSKAFIRALAEHGWISMCWPKAF |
| Ga0075434_1011866811 | 3300006871 | Populus Rhizosphere | MDFDFTDGERAFAEEVRGFLHANPPETFAVDGMDAGYGSGANSRAFLR |
| Ga0075434_1022038272 | 3300006871 | Populus Rhizosphere | VEFGFTPAEEAFREEVRRFVDEHPAQRYPLEGMDAGYGSGAHSRAFMA |
| Ga0079217_112040422 | 3300006876 | Agricultural Soil | MDFAFSASERAFAEEVRGFVAANPVERFPLEGMDAGYGSGAHSRAFM |
| Ga0079215_110813221 | 3300006894 | Agricultural Soil | MEFAFSASERAFAEEVRGFLAAKPVERFALEGMDAG |
| Ga0075424_1020487662 | 3300006904 | Populus Rhizosphere | MDFDFTDGERAFAEEVRGFLHANPPETFAVDGMDAGYGSGAN |
| Ga0075436_1006411581 | 3300006914 | Populus Rhizosphere | MDFARTAEEEVFASDVRRFLAAHPPESFALDGMDAGYGSGA |
| Ga0075436_1014183561 | 3300006914 | Populus Rhizosphere | MEFGFSAEEQAFARDVRRFLAEHPPERYPLDGVDAGYGSGAH |
| Ga0079218_121322831 | 3300007004 | Agricultural Soil | MEFAFSASERAFAEEVRGFLAANPVERFALEGMDAGYGSGAHSRAFMRALADRGWI |
| Ga0075435_1012327001 | 3300007076 | Populus Rhizosphere | MEFAFTAEEQAFREDIRQFLRDYPPEHFAHEGMDAGYGSGAHSHAFLRQLGARGW |
| Ga0105251_106299481 | 3300009011 | Switchgrass Rhizosphere | MVTFVTMHLGFSAEEAAFAEEVRAFLRRHPPDTFPPDGMDAGYGSGAVSRAFLRALGAEGYLRMA |
| Ga0066710_1014792512 | 3300009012 | Grasslands Soil | VNFEFSPAERAFAEEVRGFLRAHPPETFPVDGMDAGYGSGA |
| Ga0066710_1027381262 | 3300009012 | Grasslands Soil | MDFSFTADEQAFAAEVRQFLREHPLSAFPADGMDAGYGSGAN |
| Ga0099827_116593712 | 3300009090 | Vadose Zone Soil | MNFEFSPAEQAFAEEVRGFLRAHPPETFPVDGMDAGYGSG |
| Ga0099827_118853041 | 3300009090 | Vadose Zone Soil | MDFEFSPDEQAFAHEVRAFLVTHPPETFAVDGMDAGYGSGAHSRPFLRALADQGWLTM |
| Ga0111539_129362362 | 3300009094 | Populus Rhizosphere | MEFAFTAEEQAFREDIRQFLRDHPPEQFAHEGMDAGYGSGAHSHAFL |
| Ga0075418_120799802 | 3300009100 | Populus Rhizosphere | MNFDFTEAEQTFGDEVRRFLGANPPDTFPVDGMDAGYGSGANSRAFMQALGAQ |
| Ga0066709_1030472092 | 3300009137 | Grasslands Soil | MNFDFSEAEQAFAEEVRRFLRANPLETFPVDGMDAG |
| Ga0114129_104501121 | 3300009147 | Populus Rhizosphere | VEFGFPADAEEFREEIRGFLREHPPARFPLDGMDAGYGSGAHSRAFMRELGRRGW |
| Ga0105094_106377051 | 3300009153 | Freshwater Sediment | MDFGLSGPEQAFAEEVRAFLHAHPPETFPEDGTDAGYGSGGHSR |
| Ga0111538_129049311 | 3300009156 | Populus Rhizosphere | MEFAFTADEQAFREDIRQFLRDHPPEQFAREGMDAGYGSGAHSHAFLRQL |
| Ga0075423_104757031 | 3300009162 | Populus Rhizosphere | MEFAFTAEEQAFREDIRQFLRDHPPEQFAHEGMDAGYGSGAHSHAFLR |
| Ga0126374_100248601 | 3300009792 | Tropical Forest Soil | MDFEFSPDEQAFAEEIRGFLRAHPPERFPVDGMDAGYGSGAHSRAFLSALAERGWL |
| Ga0126374_109852791 | 3300009792 | Tropical Forest Soil | MNFQFSPDEQAFAEEIRGFLRAHPPGSYSIDGMDAGYGSG |
| Ga0105059_10210712 | 3300009795 | Groundwater Sand | MNFDFTEAEQAFAEEVRLFLRANPPETFPIDGMDAGYGSGAHSRAFLRALGAQGW |
| Ga0105080_10177041 | 3300009797 | Groundwater Sand | MDFDFTDSERAFAEEVRRFLRANPPETFPIDGMDAGYGSGANSRA |
| Ga0105063_10271202 | 3300009804 | Groundwater Sand | MEFEFAREEQAFRDEVRRFVAAHPAAHFPLDGMDAGYGSGAHSRAFLQALAAHG |
| Ga0105063_10407631 | 3300009804 | Groundwater Sand | MNFAFTEAEQAFAEEVRLFLHANPPETFPIDGMDAGYGSGAHSRAF |
| Ga0105076_10160931 | 3300009816 | Groundwater Sand | MNFAFTEAEQAFAEEVRLFLHANPPETFPIDGMDAGYGSGAHSRAFLRALGAQG |
| Ga0126380_101806861 | 3300010043 | Tropical Forest Soil | VEFGFTPAEEAFREEVRRFVDEHPAQGYPLEGMDAGYGSGAHSRAFMAELG |
| Ga0126380_112357062 | 3300010043 | Tropical Forest Soil | MNFQFSPDEQAFAEEIRGFLRAHPPGSYSIDGMDAGYGSGAHSHAF |
| Ga0126380_117332591 | 3300010043 | Tropical Forest Soil | VEFGFSSAETAFAEEVRAFLRRHPPETFPRDGMDAGYGSGAASRAFLRALGAQGWL |
| Ga0126384_101055036 | 3300010046 | Tropical Forest Soil | MDFSLGDEERAFVQEVRRFLHAHPPAAFPHDGMDAGYG |
| Ga0126382_100571821 | 3300010047 | Tropical Forest Soil | MDFEFSPDEQAFAEEVRGFLRAHPPERFPVDGMDAGYGSGAH |
| Ga0126382_114861151 | 3300010047 | Tropical Forest Soil | MDFEFSPDEQAFAEEVRGFLRTHPVDQFPVDGMDAGYG |
| Ga0126382_117723752 | 3300010047 | Tropical Forest Soil | MNFDFTAAEHAFADEVRRFIRANPPETFAVDGMDAGYGSGANSRAFMRALGAQGWLSMCW |
| Ga0126382_121209741 | 3300010047 | Tropical Forest Soil | MDFGFSAEETAFREEVRAFLRRDPAETFPRDGMDAGYGSGAVSRAFLRAL |
| Ga0134070_104255511 | 3300010301 | Grasslands Soil | MEFEFSAAEQAFAEDVRRFLRDNPLDRFPLDGMDAGYGSGAHSRAFMRALAERGWISMCW |
| Ga0134082_100730901 | 3300010303 | Grasslands Soil | MDFAYTADEQAFAAEVTRFLAEHPPDRFAVDGMDAGYGSGSHSRPFLRALADQG |
| Ga0134088_102331602 | 3300010304 | Grasslands Soil | MHFEFSPAERAFAEEVRSFLRAHPPETFPIDGMDAGYGSGAHSRPFLRA |
| Ga0134071_107721802 | 3300010336 | Grasslands Soil | MDFALTADEQAFAVEVKRFLAEHPPERFAADGMDAGYGSGAHSRPFLRALAEQGWLSM |
| Ga0134071_107983102 | 3300010336 | Grasslands Soil | MNFDFTEAEQAFAEEVRRFLRGNAPETFPIDGMDAGYGSGAHSRAF |
| Ga0126370_104076603 | 3300010358 | Tropical Forest Soil | MDFEFSPDEQAFAEEVRGFLRAHPPERFPVDGMDAGYGSGAHSRAFLRALA |
| Ga0126370_119019121 | 3300010358 | Tropical Forest Soil | MDFEFSPDEQAFAEEIRGFLRAHPPERFPVDGMDAGYGSGAHSRAFLSAL |
| Ga0126376_126577552 | 3300010359 | Tropical Forest Soil | MDFDFSPDEQAFADEVRGFLRAHPPERFPVDGMDAGYGSGAHSR |
| Ga0126372_102204873 | 3300010360 | Tropical Forest Soil | MEFGFSPAEQAFAEEVRAFLRANPLDRFALDGMDAGYGSGAHSRAFMKALGERGWI |
| Ga0126372_103588351 | 3300010360 | Tropical Forest Soil | MDFDFSPDEQAFADEVRGFLRAHPPERFPVDGMDAGYGSGAH |
| Ga0126372_111846111 | 3300010360 | Tropical Forest Soil | MDFSLGDEERVFVQEVRRFLHAHPPAAFPHDGMDAGYGSGAHSRPF |
| Ga0126377_106194811 | 3300010362 | Tropical Forest Soil | MNFQFSPDEQAFAEEVRGFLRAHPPGSYSIDGMDAGYGSGAHSHAFLRALAD |
| Ga0126377_126311731 | 3300010362 | Tropical Forest Soil | MDFGLSADERAFAHEVRDFLRAHPPETFPEDGTDAGYGSGAHSHAF |
| Ga0126377_129494721 | 3300010362 | Tropical Forest Soil | VDFAFTPEERAFAAHVRRFLADHPLSGFAHDGMDAGYGSGANSR |
| Ga0136847_125838921 | 3300010391 | Freshwater Sediment | MEFGFTHEERAFAEDVRRFLAVHPPSQFPIDGMDAGYGSSAHSRAFLKALGERGWISMCWPDT |
| Ga0136847_127413512 | 3300010391 | Freshwater Sediment | MEFGFTHEEQAFAEDVRRFLADHPPSEFPVDGMDAGYGSGAHSRAFLK |
| Ga0126383_120717681 | 3300010398 | Tropical Forest Soil | MNFDFTEAEQAFAEEVRRFIRANPLDTFPIDGMDAGYGSGANSRAFMRALGAQGWLSMC |
| Ga0134127_103650894 | 3300010399 | Terrestrial Soil | MDFAFTADERAFAEEVRRFLRAQPLESFPLEGMDAGYGSGAHSRAFMRALGARGWLSMGW |
| Ga0134127_111895471 | 3300010399 | Terrestrial Soil | MNFDFTEAEHAFAEEVRGFLRANPPESFAIDGMDAGYGSGANSRAF |
| Ga0134121_107935941 | 3300010401 | Terrestrial Soil | MLTFVTMHLGFSAEEIAFAEEVRAFLRRHPPDTFPPDGMDAGYGSGAVSRAFLRALGAEGYLRM |
| Ga0134121_121339582 | 3300010401 | Terrestrial Soil | MEFAFTADEEAFARDVRRFLAEHPPERYPLDGTDAGYGSGAHSRAFMQALGAQGWL |
| Ga0137393_111508832 | 3300011271 | Vadose Zone Soil | MEFGFSAAEQAFAEDVRRFLRDNRLDSFPLDGMDAGYGSGAHSRAFMR |
| Ga0137389_107705771 | 3300012096 | Vadose Zone Soil | MEFGFTAEEQAFAEEVRAFLRAHPPQSFPEDGMDAGYGSGPHSRAFLE |
| Ga0137389_118090241 | 3300012096 | Vadose Zone Soil | MEFALTAEERAFASEVRGFLSDHPLAQFPLDGMDAGYGSGANSK |
| Ga0137388_113714912 | 3300012189 | Vadose Zone Soil | MEFAFTAEEQAFREDIRQFLRDHPPEHFAHEGMDAGYGSGAHSHAFMRQ |
| Ga0137383_112216522 | 3300012199 | Vadose Zone Soil | MEFALTAEEQAFASEARGFLRDHPLRQFPLDGMDAGYGSGANS |
| Ga0137363_114163392 | 3300012202 | Vadose Zone Soil | VGGAPEREALVNFELSPAEQAFAEEVRGFLRAHPPDTFPVDGMDAGYGSGAHSRTFLRAL |
| Ga0137399_101813713 | 3300012203 | Vadose Zone Soil | MDFGHSAVEQTFADEVRAFLRAHPPDTFPPDGTDAGYGSGAHSRP |
| Ga0137362_112410862 | 3300012205 | Vadose Zone Soil | MDFGHSAVEQTFADEVRAFLRARPPDTFPPDGTDAGYGSGAHSRAFTAALGERGWLS |
| Ga0137362_115797402 | 3300012205 | Vadose Zone Soil | MLTAALMRFEFSPAERAFAEEVRDFLRAPPPETFPIDGMDAGYGSGAHSRPFLRALA |
| Ga0137380_117068951 | 3300012206 | Vadose Zone Soil | VNFELSPDEHAFAEEVRGFLRARPPESFPVDGMDAGY |
| Ga0137387_100482046 | 3300012349 | Vadose Zone Soil | MDFDFNDGERTFAVEVRRFLRANPPETFAIDGMDAGYGSGANSRAFLKALGA |
| Ga0137368_100176561 | 3300012358 | Vadose Zone Soil | MNFEFSPDEQAFAHEVRAFLVTHPPETFAVDGMDA |
| Ga0137361_116700881 | 3300012362 | Vadose Zone Soil | MEFAFTEPERLFADEVRRFLRAHPPETFPLDGMDAGYGSGANSKAFIRALAAQGWITMCWPTA |
| Ga0137390_112815712 | 3300012363 | Vadose Zone Soil | VNFELSPGEQAFAEEVRGFLRAHPPESFPVDGMDAGYGSGA |
| Ga0137358_107643781 | 3300012582 | Vadose Zone Soil | MDFGYSAAEEAFAEEVRAFLRAHPPDTFPPDGTDAGYGSGAHSRA |
| Ga0157290_100883702 | 3300012909 | Soil | MDFGRSADEQAFADEVSAFLRAHPPETFPADGTDAGYGSGAHS |
| Ga0137396_105497242 | 3300012918 | Vadose Zone Soil | MEFAFTEPERLFAEDVRRFLRAHPPESFPVDGMDAGYGS |
| Ga0137419_112461622 | 3300012925 | Vadose Zone Soil | VGGDPEREALVNFEFSPAEQAFAEEVRGFLRANPPETFRVDGMDAGYGSG |
| Ga0137404_104219661 | 3300012929 | Vadose Zone Soil | MDFGLSDAEQAFADEVRAFLRAHPPDTFPEDGTDAGYGSG |
| Ga0137404_116164211 | 3300012929 | Vadose Zone Soil | MDFGRSGPEQAFADEVRAFLQAHPPDTFPEDGTDAGYG |
| Ga0137407_106338801 | 3300012930 | Vadose Zone Soil | MNFDFTEAEQAFADEVRRFLRANPPETFAVDGMDA |
| Ga0137407_108447622 | 3300012930 | Vadose Zone Soil | MEFGFSAAEQAFAEDVRRFLRDNALDRFPLDGMDAGYGSGAHSRAFMRALA |
| Ga0137410_103727021 | 3300012944 | Vadose Zone Soil | VGGDSEREALVNFEFSPAEQSFAGEVRAFLRAHPPETFPVDGMDAGYGSGAHSRAFLR |
| Ga0126369_104031733 | 3300012971 | Tropical Forest Soil | MDFDFTDGERAFAEKVRSFLLANPPETFAIDGMDAGYGSGSNSRAFLRALGAQGWL |
| Ga0134077_103479231 | 3300012972 | Grasslands Soil | MDFAYTADEQVFAAEVRRFLASHPPDRFAVDGMDAGYGSGSHSRPFLRALADQG |
| Ga0134076_103210381 | 3300012976 | Grasslands Soil | MDFEFSPDEQAFAHEVRAFLVTHPPETFAVDGMDAGYGS |
| Ga0163162_101667496 | 3300013306 | Switchgrass Rhizosphere | MDFAFTADERAFAEEVRRFLRAQPLESFPLEGMDAGYGSGAHSRAFMRALGARGWLS |
| Ga0134078_105498441 | 3300014157 | Grasslands Soil | MEFGFSPAETAFAEEVRGFLREQPLERFPVDGMDAGYGSG |
| Ga0075312_10607711 | 3300014254 | Natural And Restored Wetlands | MEFGFSAEEEAFRQEVRQFLQEHPPEHYPEDGMDAGYGSGAHSHAF |
| Ga0163163_119934771 | 3300014325 | Switchgrass Rhizosphere | MLTFVTMHLGFSAEEAAFAEEVRAFLRRHPPDTFPPDGMDAGYGSG |
| Ga0157380_113789652 | 3300014326 | Switchgrass Rhizosphere | MDFGLSDAEQAFADEVRAFLRAQPPDTFAEDGTDAG |
| Ga0180086_10509712 | 3300014883 | Soil | MDFARTAEEQAFAEDVRRFLSAHPPESFAVDGMDAGYGSG |
| Ga0180063_12311152 | 3300014885 | Soil | MDFGLSGLEQAFADEVRAFLHAHPPETFPEDGTDAGYGSG |
| Ga0137405_13378674 | 3300015053 | Vadose Zone Soil | MNFEFSPDEQAFAHEVRAFLVTHPPETFAVDGMDAGYGSGAHSRPFL |
| Ga0134085_102798161 | 3300015359 | Grasslands Soil | MHFEFSPAERAFAEEVRGFLRAHPPETFPIDGMDAGYGSGAHSRPFLRAL |
| Ga0134085_103331852 | 3300015359 | Grasslands Soil | MDFDFNDAERTFAEEVRRFLRANPPETFAIDGMDAGYGSGANSRAFLKALGAQGWLSMCW |
| Ga0132256_1002958123 | 3300015372 | Arabidopsis Rhizosphere | MDFDFTDGERAFAEKVRGFLRANPPETFAIDGMDAGYGSGANSRAFLRALGAQGWLTMCWPKAH |
| Ga0132256_1014470001 | 3300015372 | Arabidopsis Rhizosphere | VEFGFSPEEQAFREEVRGFLRDNPPERFPEDGMDAGYGSGAHSRPFMQA |
| Ga0182033_104162291 | 3300016319 | Soil | MEFAFTAAEQTFREDIRQFLRDHPPEQFAHEGMDAGYGSGAHSHAFLRQ |
| Ga0134112_100769111 | 3300017656 | Grasslands Soil | MNFDFTEAEQAFAEEVRLFLRANPPETFPIDGMDAGYGSGAHS |
| Ga0134112_102719981 | 3300017656 | Grasslands Soil | MDFAFTADEQAFAAGVKRFLAEQPPEGFAVDGTDAGYGSGSYSHAFLRALA |
| Ga0134112_104551531 | 3300017656 | Grasslands Soil | MDFDFNDAERTFAEEVRRFLRANPPETFAIDGMDAGYGSSANSRAFLK |
| Ga0134083_101095901 | 3300017659 | Grasslands Soil | MDFAFTADEQAFAAGVKRFLAEHPPERFAVDGMDAGYGSGSHSRPFL |
| Ga0187825_104372572 | 3300017930 | Freshwater Sediment | MDFGRSAGEQAFAHEVCDFLRAHPPETFALDGTDAGYGSGA |
| Ga0184620_101600572 | 3300018051 | Groundwater Sediment | MDFGRSGPEQAFADEVRAFLQAHPPDTFPEDGTDAGYGSGAHSR |
| Ga0184638_10010301 | 3300018052 | Groundwater Sediment | MNFDFTEAEQAFAEEVRLFLRANPPETFPIDGMDAGYGSG |
| Ga0184617_11768111 | 3300018066 | Groundwater Sediment | MDFGRSGPEQAFADEVRAFLRAHPPDTFPEDGTDAGYGSGAHSR |
| Ga0184618_104543222 | 3300018071 | Groundwater Sediment | VEFAFTDEEEAFREEVRLFVAEHPPERYPLDGMDAGYGSGAHSHAFMAELGARGWL |
| Ga0184632_103978302 | 3300018075 | Groundwater Sediment | MEFAFTAEEQAFREDVRRFVAEHRPERYPLDGMDAGYGSGAHSRAFMAELGAHGWL |
| Ga0184609_104832881 | 3300018076 | Groundwater Sediment | MEFAFTAEEQAFREEVRGFIAEHPPERYPLDGMDAGYGSGAHSRAFMAELGAQGWL |
| Ga0184633_105745771 | 3300018077 | Groundwater Sediment | MEFGFTHEERAFADDVRRFLADHPPSQFPVDGMDAGYGSGAHSRAFLKALGDRGWISM |
| Ga0184612_106027971 | 3300018078 | Groundwater Sediment | MEFAFTAEEQAFREDVRRFVAEHPPERYPLDGMDAGYGSGAHSRAFMAE |
| Ga0184627_105667171 | 3300018079 | Groundwater Sediment | MNFDFTEAEQAFAEEVRLFLRANPPETFPIDGMDAGYGSGAHSRAFLRALGAQ |
| Ga0184639_104865821 | 3300018082 | Groundwater Sediment | MEFSFTHEERAFADDVRRFLADHPPSQFPIDGMDAGYGSGAHSRAFL |
| Ga0190265_113572092 | 3300018422 | Soil | MDFGLSGPEQAFADEVRAFLHAHPPDTFQEDGTDAGYGSGA |
| Ga0190265_116126542 | 3300018422 | Soil | MVWSKCGGDLMDFALTPGEQAFAGEVRDFLRRHPPEQFHHDGMDAGYGSGAISRAFLLALAA |
| Ga0066667_121755512 | 3300018433 | Grasslands Soil | MSVNFDFTAAEQTFADEVRRFLRATPPETFPVDGMDAGYGSGSNSRAFMKALG |
| Ga0066662_124304592 | 3300018468 | Grasslands Soil | MDFAYTADEQAFAAEVRRFLAEHPPDRFAVDGMDAGYGSGSHSRPFLRALADQ |
| Ga0066669_111727431 | 3300018482 | Grasslands Soil | MEFEFSAAEQAFAEDVRRFLRDNPLDRFPLDGMDAGYGSGAHSRAFMRALAERGWISMCWPEA |
| Ga0187893_102887471 | 3300019487 | Microbial Mat On Rocks | MDFGRSVDEEAFAGEVRAFLREHPPASFPEDGVDAGYGSGAHSRPFMRALGRR |
| Ga0187893_103110611 | 3300019487 | Microbial Mat On Rocks | MDFGLSGPEEAFADEVRAFLRAHPPERLPEDGTDAGYGSG |
| Ga0193723_10362471 | 3300019879 | Soil | MNFGHSGPEQAFADEVRAFLRAHPPDTFPEDGTDAGYGSGAHSRTFTRALG |
| Ga0179594_100837941 | 3300020170 | Vadose Zone Soil | MDFAYTADEQAFAAEVRRFLAEHPPDRFAVDGMDAGYG |
| Ga0210408_103782821 | 3300021178 | Soil | MDFGYSAAEEAFAEEVRAFLRAHPPDAFPPDGTDAGYGSGAHS |
| Ga0210408_106477311 | 3300021178 | Soil | MDFGYSAAEGAFAEEVRAFLRAHPPDAFPPDGTDAGYGSGAHSRAFTAA |
| Ga0209320_102093342 | 3300025155 | Soil | MDFTLTAEEETFAADVRRFLRDHPPERFPLDGMDAGYGSGAHSRAFLKELGARGWL |
| Ga0209640_105266771 | 3300025324 | Soil | MDFGLSPAEQAFAEEVRDFLRAHPPETFPEDGTDAGYGSGAHSRPFTQA |
| Ga0209342_111130501 | 3300025326 | Soil | MDFTLTAEEETFAEDVRRFLRDHPPERFPLDGMDAG |
| Ga0210094_10975382 | 3300025549 | Natural And Restored Wetlands | MDFEFGPDEQAFAHEVRGFLRAHPPETFAVDGMDAGYGSGAHSRPFLKALAD |
| Ga0207684_110143972 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VDFTLTDEEHAFAENVRRFLRAHPPESFAVDGMDAGYGSGAHSRELLA |
| Ga0207669_114675872 | 3300025937 | Miscanthus Rhizosphere | MNFDFTEAEQAFADEVRRFLRANPPETFAVDGMDAGYGSGANSRAFMKALAAQGWISMCW |
| Ga0207665_1000244217 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFGHSAAEQAFAEEVRAFLRAHPPDIFPPDGTDAG |
| Ga0210089_10205662 | 3300025957 | Natural And Restored Wetlands | VEFGFSADEQAFREEVRGFLRDNPPERFPEDGMDAGYGSGAHSRPFMQALGARGW |
| Ga0207712_105251041 | 3300025961 | Switchgrass Rhizosphere | MNFDFTEAEHAFAEEVRGFLRANPPETFAIDGMDAGYGSGAESRAFMKA |
| Ga0207712_106166002 | 3300025961 | Switchgrass Rhizosphere | MDFDFTVGERAFAEEVRGFLRANPPETFAIDGMDA |
| Ga0208000_1001411 | 3300026001 | Rice Paddy Soil | MDFGLSGPEQAFADEVRAFIRAHPPEGFPVEGTDAGY |
| Ga0208418_10260702 | 3300026018 | Natural And Restored Wetlands | MDFGYSPAEQAFATEVRSFLRARPPERFASDGTDAGYGSGPHSKAFMRALGERGW |
| Ga0207703_100749981 | 3300026035 | Switchgrass Rhizosphere | MEFAFTAEEQAFRENIRQFLRDHPPEHFAHEGMDAGYGSGAHLHAFLGQLGARGWLSMC |
| Ga0209350_11378152 | 3300026277 | Grasslands Soil | MNFDFTEAEQAFAEEVRRFLRANPPETFPVDGMDAGYGSGS |
| Ga0209438_10258391 | 3300026285 | Grasslands Soil | MDFGYSAAEQAFAEEVRAFLRAHPPDTFPPDGTDAGYGSGAHSRP |
| Ga0209236_11902622 | 3300026298 | Grasslands Soil | MEFGFSPAETAFAEEVRGFLREQPLERFPVDGMDAGYGSGA |
| Ga0209239_12303062 | 3300026310 | Grasslands Soil | MEFAFTADEQAFARDVRAFLAAHPPERYPLDGVDAGYGSGAHSRAF |
| Ga0209687_11859451 | 3300026322 | Soil | MEFGFSAAEQAFAEDVRRFLRDNALDRFPLDGMDAGYGS |
| Ga0209152_100458853 | 3300026325 | Soil | MDFAYTADEQAFAAEVRRFLASHPPDRFAVDGMDAGYGSGSHSRPFLRALAEQGWLSMTW |
| Ga0209801_12212962 | 3300026326 | Soil | MEFGFSAAEQAFAEDVRRFLRDNALDRFPLDGMDAGYGSGAHSRAFMRALAER |
| Ga0209802_11156262 | 3300026328 | Soil | MNFDFTEAEQAFAEEVRRFLRANPPETFPVDGMDAGYGSGSNSRAFMKALGAQGWIS |
| Ga0209803_11302521 | 3300026332 | Soil | MDFAFTADEQAFAAGVKRFLAEHPPERFAVDGTDAGYGS |
| Ga0209804_10766163 | 3300026335 | Soil | MNFDFTEAEQAFADEVRRFIRANPPDTFAVDGNSGSFK |
| Ga0257180_10308141 | 3300026354 | Soil | MDFGYSAAEQAFAEEVRAFLRAHPPDTFPPDGTDAGYGSGAHSRPFTAAL |
| Ga0257168_10718232 | 3300026514 | Soil | MDFGHSAVEQTFADEVRAFLRAHPPDTFPPDGTDAGYGSGAHSRAFTAALGERGWL |
| Ga0209806_10120151 | 3300026529 | Soil | MDFAYTADEQAFAAEVRRFLASHPPDRFAVDGMDAGYGSGSHSRPFLR |
| Ga0209160_10351091 | 3300026532 | Soil | MHFEFSPAERAFAEEVRSFLRAHPPETFPIDGMDAGYGSGAHSRPFLRAL |
| Ga0209058_11804963 | 3300026536 | Soil | MDFAYTADEQAFAAEVRRFLASHPPDRFAVDGMDAGYGSGSHSRPFLRAL |
| Ga0209058_12960041 | 3300026536 | Soil | MEFAFTADEQAFARDVRAFLAAHPPERYPLDGVDAGYGSGAHSRAFMHALG |
| Ga0209157_11277223 | 3300026537 | Soil | MDFAYTADEQAFAAEVRRFLASHPPDRFAVDGMDAGYGSGSHSR |
| Ga0209157_13065341 | 3300026537 | Soil | MNFDFTAAEQTFADEVRRFLRATPPETFPVDGMDAGYGSGSNSRAFMK |
| Ga0207527_1047431 | 3300026759 | Soil | MDFGRSADEQAFADEVRAFLRAHPPATFPADGTDAGYGSGAHSRAFLGALGE |
| Ga0209969_10141512 | 3300027360 | Arabidopsis Thaliana Rhizosphere | MDFGRSADEQAFADEVRAFLRAHPPATFPADGTDAGYGS |
| Ga0209967_10096373 | 3300027364 | Arabidopsis Thaliana Rhizosphere | MDFGRSADEQAFADEVRAFLRAHPPATFPADGTDAGYGSGAHSRAFLGA |
| Ga0209854_10442921 | 3300027384 | Groundwater Sand | MNFDYTDAERAFADQVRRFLRANPPETFPLDGMDAGYGSGATSRAFLKALGAQGWLAMCWPT |
| Ga0209466_10565962 | 3300027646 | Tropical Forest Soil | MDFAFTADERAFADEVRRFLRAHPLDSFPLEGMDAGYGSGAHSRAFLRA |
| Ga0209388_12169951 | 3300027655 | Vadose Zone Soil | MDFGHSAVEQTFADEVRAFLRAHPPDTFPPDGTDAGYGSG |
| Ga0209626_11539881 | 3300027684 | Forest Soil | MDFGYSAAEQAFAAEVRAFLRAHPPEAFPPDGTDAGLMAW |
| Ga0209966_10553122 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MDFAFTDAEAVFAEEVRRFLAVNPVERFPLDGIDAGY |
| Ga0209819_101704502 | 3300027722 | Freshwater Sediment | MEFAFTAEEQAFREDVRRFVAEHPGERFSLDGMDAGYGSGAHSRAF |
| Ga0209689_10234891 | 3300027748 | Soil | MSVNFDFTAAEQTFADEVRRFLRATPPETFPVDGMDAGYGSGSNSRAFMKALGAQGW |
| Ga0209689_10542384 | 3300027748 | Soil | MNFDFTEAEQAFAEEVRRFLRANPPETFPVDGMDAGYGSGSNSRAFMKALGAQGW |
| Ga0209283_108264502 | 3300027875 | Vadose Zone Soil | MDFGYSAAEQAFAEEVRAFLRAHPPDTFPPDGTDAGYGSG |
| Ga0209974_100321843 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MDFGRSADEQAFADEVRAFLRAHPPATFPADGTDAGYGSGAHSRAFLGALG |
| Ga0209481_102337873 | 3300027880 | Populus Rhizosphere | MDFAFTDAEAAFAEEVRRFLAVNPVERFPLDGIDAGYGSGAH |
| Ga0209481_105322882 | 3300027880 | Populus Rhizosphere | MEFTFTAEEHAFAEDVRRFIREHPPADFPVDGMDAGYGSGANSKAFIQALAA |
| Ga0209590_101420602 | 3300027882 | Vadose Zone Soil | MEFAFTAEEQAFREDIRQFLRDHPPEHFAREGMDAGFGT |
| Ga0209488_112079451 | 3300027903 | Vadose Zone Soil | MDFGLSGPEQAFADEVRAFLQAHPPETFLEDGTDAGYGS |
| Ga0209583_105008032 | 3300027910 | Watersheds | MDFGYSAAEQAFAEEVRAFLRAYPPETFPLDGTDAGYGSGAHSRAFTAALGE |
| Ga0268265_115059351 | 3300028380 | Switchgrass Rhizosphere | MNFDFTEAEQAFADEVRRFLRANPPETFAVDGMDAGYGSGANS |
| Ga0247822_105070683 | 3300028592 | Soil | MDFAFTADERAFAEDVRRFLRAHPLESFPLEGMDAGYGSGAHSRAFMRALGAHE |
| Ga0307281_100935501 | 3300028803 | Soil | MDFGLSGPEQAFADEVRAFLQAHPPETFLEDGTDAGYGSGAHSHAF |
| Ga0247825_101818803 | 3300028812 | Soil | MDFAFSASECAFAEEVRNFLAVNPVERFPLEGMDAGYGSGAH |
| Ga0247825_105006041 | 3300028812 | Soil | VDFALSADEQAFAEDVRRFLRDHPLAQFPLDGMDAGYGSGAHSRAFLKALADEGWLS |
| Ga0247827_104398041 | 3300028889 | Soil | MEFGFTAEEQAFRDEVRRFVAAHPAQEFPLDGMDAGYGSGAHSRAFM |
| Ga0299907_105925481 | 3300030006 | Soil | MEFAFSPEAEAFREEIQAFLRQHPPESFPEDGMDAGY |
| Ga0268386_108033871 | 3300030619 | Soil | MDFAFTAGEEAFRDEVRRFLAEHPADRFLLDGMDAGYGSGAHSRAFLA |
| Ga0302046_113328691 | 3300030620 | Soil | MLASQEAIRMEFGFTADEEAFRDEVRQFLRDHPPEQFPQEGMDAGYGSGAH |
| Ga0307498_100691031 | 3300031170 | Soil | MNFDFTEAEQAFADEVRRFLRANPPETFAVDGMDAGYGSGANSRAFMKALAAQGW |
| Ga0299913_107753472 | 3300031229 | Soil | MDFGHSGAERAFADEVRAFLQTHPPETFPEDGTDAGY |
| Ga0307408_1014952231 | 3300031548 | Rhizosphere | MDFAFTAAEAAFAEEVRRFLAANPLDRFPLDGMDAGYGSGAHSRPFMRALADRGWISM |
| Ga0307408_1022782542 | 3300031548 | Rhizosphere | VEFALSDAEREFAGEVRAFLAAHPPTRFAVDGMDAGYGSGANSRAFLQALATQGWLS |
| Ga0318571_103670022 | 3300031549 | Soil | MDFEFSPDEQAFAEEIRGFLRAHPPERFPVDGMDAG |
| Ga0310886_100959661 | 3300031562 | Soil | MEFAFTAEEQAFRDEVRRFVDEHPADRYPLDGMDAGYGSGAHSRAFMAELG |
| Ga0307469_125116851 | 3300031720 | Hardwood Forest Soil | MDFGHSAAEQAFAEEVRAFLRAHPPDTFPPDGTDAGYGSGAHSRPFTAA |
| Ga0318493_102175272 | 3300031723 | Soil | MNFDFTQAEQAFAEEVRAFLRTHPPDTFAIDGMDAGYGSGAN |
| Ga0307405_104286401 | 3300031731 | Rhizosphere | MDFAFTAAEAAFAEEVRRFLAANPLARFPLDGMDAGYGSGAHS |
| Ga0307468_1003559053 | 3300031740 | Hardwood Forest Soil | MDFEFSPDEQAFAHEVRAFLVTHPPETFAVDGMDAGYG |
| Ga0307468_1016415972 | 3300031740 | Hardwood Forest Soil | MEFAFTADEDAFAREVRRFLAEHPPERYPLDGVDAGYGSGAHSRAF |
| Ga0318521_105638461 | 3300031770 | Soil | MNFDFTQAEQAFAEEVRAFLRAHPPDTFAIDGMDAGYGSGANSRAFM |
| Ga0318547_110630461 | 3300031781 | Soil | MNFDFTQAEQAFAEEVRAFLRAYPPDTFAIDGMDAGYGSGANSRAFMKA |
| Ga0318503_101686051 | 3300031794 | Soil | MNFDFTQGEQAFAEEVRAFLRAYPPDTFAIDGMDAGYGSGANSRAFM |
| Ga0318568_107685211 | 3300031819 | Soil | MNFDFTQAEQAFAEEVRAFLRAHPPDTFAIDGMDAGYGSGANSRAFMMALG |
| Ga0307473_112836321 | 3300031820 | Hardwood Forest Soil | MEFTLTAEEHAFASEVRGFLRDHPLAQFPLDGMDAGYGSGANSKAFIRALA |
| Ga0310907_105790372 | 3300031847 | Soil | MDFAFTADERAFAEDVRRFLRAHPLESFPLEGMDAGYGSGAH |
| Ga0315280_103716552 | 3300031862 | Sediment | MNFEFSPAEQAFAEEVRGFLRAHPPETFPVDGMDAGYGSGAHSR |
| Ga0306925_112093462 | 3300031890 | Soil | MNFDFTQAEQAFAEEVRAYLRAHPPDTFAIDGMDAGYGS |
| Ga0307406_103378111 | 3300031901 | Rhizosphere | MDFAFTAAEAAFAEEVRRFLAANPLDRFPLDGMDAGYGSGAHSRPFMRALADRGWISMCWPE |
| Ga0307406_111590512 | 3300031901 | Rhizosphere | VEFALSDAEREFAGEVRAFLAAHPPTRFAVDGMDAGYGSGANSRAFLH |
| Ga0306923_105566382 | 3300031910 | Soil | MEFAFTAAEQTFREDIRQFLRDHPPEQFAHEGMDAGYGSGAHSHAFLRQLG |
| Ga0310913_105645751 | 3300031945 | Soil | MNFDFTEAEQAFAEEVRRFIRANPPDTFPIDGMDAGYGS |
| Ga0307409_1004582311 | 3300031995 | Rhizosphere | MDFAFTAAEAAFAEEVRRFLAANPLARFPLDGMDAGYGSGAHSRPFMRALADRGWISMCW |
| Ga0307409_1005374692 | 3300031995 | Rhizosphere | MEFGFTAEEQAFREEVRAFVAAHPADRFPLDGMDAGYGSGAHSRALMAALAARG |
| Ga0307416_1032264931 | 3300032002 | Rhizosphere | MEFAFTADEQAFARDVHRFLAEHPPERYPLDGVDAGYGSGAHSHAF |
| Ga0306924_100328081 | 3300032076 | Soil | MDFEFSPDEQAFAEEIRGFLRAHPPERFPVDGMDAGYGSGAHSRAFLSALAER |
| Ga0310895_102067701 | 3300032122 | Soil | MDFAFTADERAFAEDVRRFLRAHPLESFPLEGMDAGYGSGAHSRAF |
| Ga0307415_1012878101 | 3300032126 | Rhizosphere | MEFTFTAEEHAFAEDVRRFIREHPPGEFPVDGMDAGYGSGANSKAFIR |
| Ga0307470_114132791 | 3300032174 | Hardwood Forest Soil | MEFAFSADEEAFANEVRRFLAEHPPERYPLDGVDAGYGSGAHSRAFMKALGERG |
| Ga0307471_1001524324 | 3300032180 | Hardwood Forest Soil | MNFDFTEAEQAFADEVRRFLRATPPETFPVDGMDAGYGSGSNSRAFMK |
| Ga0335085_114319061 | 3300032770 | Soil | MEFAFTADERAFAEDVRRFLREHPLEHFPLEGMDAGYGSG |
| Ga0326726_117209531 | 3300033433 | Peat Soil | MLTFVTMHLGFSAEETAFAEEVRAFLRRHPPDTFPPDGMDAGYGSGAVSRAFLRALGAEGYLR |
| Ga0326732_10229951 | 3300033501 | Peat Soil | MNFEFGPDEQAYAHEVRAFLRAHPPETFPVDGMDAGYGSGAH |
| Ga0316628_1009344731 | 3300033513 | Soil | MNFGLSGPEQAFADDVRAFLHAHPPETFPEDGTDAGYGSGAHSHAFTRALGERGWLS |
| Ga0316628_1017628862 | 3300033513 | Soil | MDFGFSAAEQAFADEVRAFLRAHPPETFPPDGTDAGYGSGAHSHAFTRALGERGWLS |
| Ga0364926_125377_412_540 | 3300033812 | Sediment | MNFDFTEAEQAFAEEVRRFLRANPPETFPIDGMDAGYGSGAHS |
| ⦗Top⦘ |