Metagenome / Metatranscriptome Family F009605

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F009605
Family Type	Metagenome / Metatranscriptome
Number of Sequences	315
Average Sequence Length	39 residues
Representative Sequence	MKTILNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGN
Number of Associated Samples	136
Number of Associated Scaffolds	315

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	91.03 %
% of genes near scaffold ends (potentially truncated)	12.06 %
% of genes from short scaffolds (< 2000 bps)	61.90 %
Associated GOLD sequencing projects	117
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (59.683 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (28.571 % of family members)
Environment Ontology (ENVO)	Unclassified (73.016 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (85.079 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.56
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 315 Family Scaffolds
PF12697	Abhydrolase_6	9.52
PF07883	Cupin_2	3.17
PF00487	FA_desaturase	2.86
PF00565	SNase	2.54
PF06094	GGACT	1.27
PF06941	NT5C	0.95
PF13759	2OG-FeII_Oxy_5	0.95
PF01223	Endonuclease_NS	0.95
PF02777	Sod_Fe_C	0.95
PF07819	PGAP1	0.95
PF12708	Pectate_lyase_3	0.95
PF03477	ATP-cone	0.63
PF13772	AIG2_2	0.63
PF03851	UvdE	0.63
PF00574	CLP_protease	0.63
PF00268	Ribonuc_red_sm	0.63
PF00535	Glycos_transf_2	0.63
PF12705	PDDEXK_1	0.63
PF00155	Aminotran_1_2	0.63
PF12695	Abhydrolase_5	0.63
PF00534	Glycos_transf_1	0.63
PF01521	Fe-S_biosyn	0.63
PF10263	SprT-like	0.32
PF13394	Fer4_14	0.32
PF13673	Acetyltransf_10	0.32
PF13884	Peptidase_S74	0.32
PF03741	TerC	0.32
PF03783	CsgG	0.32
PF02678	Pirin	0.32
PF16861	Carbam_trans_C	0.32
PF10118	Metal_hydrol	0.32
PF05996	Fe_bilin_red	0.32
PF05637	Glyco_transf_34	0.32
PF10528	GLEYA	0.32
PF03061	4HBT	0.32
PF00004	AAA	0.32
PF06821	Ser_hydrolase	0.32
PF06347	SH3_4	0.32
PF01471	PG_binding_1	0.32
PF01909	NTP_transf_2	0.32
PF00383	dCMP_cyt_deam_1	0.32
PF07691	PA14	0.32
PF04055	Radical_SAM	0.32
PF01177	Asp_Glu_race	0.32
PF01126	Heme_oxygenase	0.32
PF00081	Sod_Fe_N	0.32
PF00550	PP-binding	0.32
PF03401	TctC	0.32

COG ID	Name	Functional Category	% Frequency in 315 Family Scaffolds
COG3239	Fatty acid desaturase	Lipid transport and metabolism [I]	2.86
COG1398	Fatty-acid desaturase	Lipid transport and metabolism [I]	2.86
COG0605	Superoxide dismutase	Inorganic ion transport and metabolism [P]	1.27
COG0616	Periplasmic serine protease, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	1.27
COG0740	ATP-dependent protease ClpP, protease subunit	Posttranslational modification, protein turnover, chaperones [O]	1.27
COG1075	Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase fold	Lipid transport and metabolism [I]	0.95
COG2267	Lysophospholipase, alpha-beta hydrolase superfamily	Lipid transport and metabolism [I]	0.95
COG1864	DNA/RNA endonuclease G, NUC1	Nucleotide transport and metabolism [F]	0.95
COG4502	5'(3')-deoxyribonucleotidase	Nucleotide transport and metabolism [F]	0.95
COG0596	2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold	Coenzyme transport and metabolism [H]	0.95
COG4841	Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family	Function unknown [S]	0.63
COG1030	Membrane-bound serine protease NfeD, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	0.63
COG0208	Ribonucleotide reductase beta subunit, ferritin-like domain	Nucleotide transport and metabolism [F]	0.63
COG4294	UV DNA damage repair endonuclease	Replication, recombination and repair [L]	0.63
COG0316	Fe-S cluster assembly iron-binding protein IscA	Posttranslational modification, protein turnover, chaperones [O]	0.63
COG5398	Heme oxygenase	Coenzyme transport and metabolism [H]	0.32
COG3545	Predicted esterase of the alpha/beta hydrolase fold	General function prediction only [R]	0.32
COG3230	Heme oxygenase	Inorganic ion transport and metabolism [P]	0.32
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.32
COG1741	Redox-sensitive bicupin YhaK, pirin superfamily	General function prediction only [R]	0.32
COG1462	Curli biogenesis system outer membrane secretion channel CsgG	Cell wall/membrane/envelope biogenesis [M]	0.32
COG0861	Tellurite resistance membrane protein TerC	Inorganic ion transport and metabolism [P]	0.32

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	71.11 %
Unclassified	root	N/A	28.89 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	61.59 %
Unclassified	root	N/A	28.89 %
cellular organisms	root	All Organisms → cellular organisms	9.52 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	59.68 %
Unclassified	root	N/A	28.89 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	9.52 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.90 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	59.68 %
Unclassified	root	N/A	28.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.90 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.59 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	59.68 %
Unclassified	root	N/A	28.89 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.90 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.59 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	59.68 %
Unclassified	root	N/A	28.89 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.90 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.59 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	58.73 %
Unclassified	root	N/A	28.89 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.90 %
Saprospiria	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria	1.59 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	58.73 %
Unclassified	root	N/A	28.89 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.90 %
Saprospirales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales	1.59 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	58.73 %
Unclassified	root	N/A	28.89 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.90 %
unclassified Saprospirales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales	1.59 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	58.73 %
Unclassified	root	N/A	28.89 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.90 %
Saprospirales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium	1.59 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000756\|JGI12421J11937_10038011	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1663	Open in IMG/M
3300000756\|JGI12421J11937_10147175	Not Available	586	Open in IMG/M
3300000756\|JGI12421J11937_10171850	Not Available	521	Open in IMG/M
3300000882\|FwDRAFT_10292354	Not Available	529	Open in IMG/M
3300002139\|M3t2BS2_1876187	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	761	Open in IMG/M
3300002142\|M2t2FKB2_1050267	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	864	Open in IMG/M
3300002408\|B570J29032_109599896	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	920	Open in IMG/M
3300002835\|B570J40625_100078030	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4314	Open in IMG/M
3300002835\|B570J40625_100242345	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1891	Open in IMG/M
3300002835\|B570J40625_100586211	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1024	Open in IMG/M
3300002835\|B570J40625_100659086	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	945	Open in IMG/M
3300002835\|B570J40625_100912502	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	759	Open in IMG/M
3300003277\|JGI25908J49247_10000491	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	12074	Open in IMG/M
3300003277\|JGI25908J49247_10000658	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10625	Open in IMG/M
3300003277\|JGI25908J49247_10002037	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6482	Open in IMG/M
3300003277\|JGI25908J49247_10002163	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6279	Open in IMG/M
3300003277\|JGI25908J49247_10002972	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5413	Open in IMG/M
3300003277\|JGI25908J49247_10009730	Not Available	3001	Open in IMG/M
3300003277\|JGI25908J49247_10011216	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2779	Open in IMG/M
3300003277\|JGI25908J49247_10015611	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2318	Open in IMG/M
3300003277\|JGI25908J49247_10023487	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium	1817	Open in IMG/M
3300003277\|JGI25908J49247_10057942	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	994	Open in IMG/M
3300003277\|JGI25908J49247_10086851	Not Available	765	Open in IMG/M
3300003277\|JGI25908J49247_10153294	Not Available	537	Open in IMG/M
3300003277\|JGI25908J49247_10157981	Not Available	527	Open in IMG/M
3300003388\|JGI25910J50241_10002984	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6155	Open in IMG/M
3300003388\|JGI25910J50241_10015670	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2687	Open in IMG/M
3300003388\|JGI25910J50241_10166492	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	567	Open in IMG/M
3300003394\|JGI25907J50239_1001054	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6610	Open in IMG/M
3300003411\|JGI25911J50253_10009327	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3717	Open in IMG/M
3300003497\|JGI25925J51416_10077065	Not Available	828	Open in IMG/M
3300003783\|Ga0007850_1000110	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8550	Open in IMG/M
3300003986\|Ga0063233_10093931	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	880	Open in IMG/M
3300004112\|Ga0065166_10230668	All Organisms → cellular organisms → Bacteria	738	Open in IMG/M
3300004124\|Ga0066178_10067680	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	933	Open in IMG/M
3300004763\|Ga0007746_1049309	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1777	Open in IMG/M
3300004769\|Ga0007748_11426944	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	670	Open in IMG/M
3300004810\|Ga0007757_11470727	Not Available	510	Open in IMG/M
3300005415\|Ga0007743_1284757	Not Available	680	Open in IMG/M
3300005415\|Ga0007743_1305973	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	643	Open in IMG/M
3300005517\|Ga0070374_10011903	Not Available	4279	Open in IMG/M
3300005517\|Ga0070374_10013403	All Organisms → cellular organisms → Bacteria	4062	Open in IMG/M
3300005517\|Ga0070374_10013623	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4033	Open in IMG/M
3300005517\|Ga0070374_10025772	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3014	Open in IMG/M
3300005517\|Ga0070374_10161052	Not Available	1163	Open in IMG/M
3300005517\|Ga0070374_10185352	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1074	Open in IMG/M
3300005517\|Ga0070374_10699900	Not Available	500	Open in IMG/M
3300005527\|Ga0068876_10021630	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4065	Open in IMG/M
3300005581\|Ga0049081_10000329	Not Available	18375	Open in IMG/M
3300005581\|Ga0049081_10011243	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3383	Open in IMG/M
3300005581\|Ga0049081_10051780	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1554	Open in IMG/M
3300005582\|Ga0049080_10019091	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2392	Open in IMG/M
3300005582\|Ga0049080_10026662	Not Available	2018	Open in IMG/M
3300005582\|Ga0049080_10042636	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1574	Open in IMG/M
3300005582\|Ga0049080_10068228	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1221	Open in IMG/M
3300005582\|Ga0049080_10099649	Not Available	988	Open in IMG/M
3300005583\|Ga0049085_10149371	Not Available	789	Open in IMG/M
3300005583\|Ga0049085_10194376	Not Available	675	Open in IMG/M
3300005584\|Ga0049082_10071647	Not Available	1217	Open in IMG/M
3300005662\|Ga0078894_10016774	Not Available	5862	Open in IMG/M
3300005662\|Ga0078894_10017187	All Organisms → cellular organisms → Bacteria	5791	Open in IMG/M
3300005662\|Ga0078894_10028381	All Organisms → cellular organisms → Bacteria	4594	Open in IMG/M
3300005662\|Ga0078894_10102754	Not Available	2525	Open in IMG/M
3300005662\|Ga0078894_10163968	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2002	Open in IMG/M
3300005662\|Ga0078894_10263656	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1562	Open in IMG/M
3300005662\|Ga0078894_10276024	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1525	Open in IMG/M
3300005662\|Ga0078894_10280447	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1512	Open in IMG/M
3300005662\|Ga0078894_10328676	Not Available	1386	Open in IMG/M
3300005662\|Ga0078894_10381364	Not Available	1275	Open in IMG/M
3300005662\|Ga0078894_10675602	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	913	Open in IMG/M
3300005662\|Ga0078894_10684420	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	906	Open in IMG/M
3300005662\|Ga0078894_11149287	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	660	Open in IMG/M
3300005941\|Ga0070743_10119785	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	881	Open in IMG/M
3300006484\|Ga0070744_10033004	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1529	Open in IMG/M
3300007545\|Ga0102873_1213702	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	579	Open in IMG/M
3300007548\|Ga0102877_1178751	Not Available	598	Open in IMG/M
3300007551\|Ga0102881_1121518	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	722	Open in IMG/M
3300007559\|Ga0102828_1035607	Not Available	1129	Open in IMG/M
3300007597\|Ga0102919_1132611	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	784	Open in IMG/M
3300007630\|Ga0102903_1128346	Not Available	697	Open in IMG/M
3300007642\|Ga0102876_1060020	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1053	Open in IMG/M
3300008111\|Ga0114344_1001562	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13521	Open in IMG/M
3300008111\|Ga0114344_1017914	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2886	Open in IMG/M
3300008113\|Ga0114346_1044394	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2252	Open in IMG/M
3300008113\|Ga0114346_1281707	Not Available	589	Open in IMG/M
3300008119\|Ga0114354_1079999	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium	1335	Open in IMG/M
3300008964\|Ga0102889_1231482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	535	Open in IMG/M
3300008999\|Ga0102816_1184803	Not Available	650	Open in IMG/M
3300009026\|Ga0102829_1319771	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	519	Open in IMG/M
3300009068\|Ga0114973_10144892	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1323	Open in IMG/M
3300009068\|Ga0114973_10353874	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	775	Open in IMG/M
3300009068\|Ga0114973_10723282	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	506	Open in IMG/M
3300009151\|Ga0114962_10002080	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16995	Open in IMG/M
3300009151\|Ga0114962_10005618	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9795	Open in IMG/M
3300009151\|Ga0114962_10026067	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4064	Open in IMG/M
3300009151\|Ga0114962_10096364	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1849	Open in IMG/M
3300009151\|Ga0114962_10105103	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1753	Open in IMG/M
3300009151\|Ga0114962_10561679	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	596	Open in IMG/M
3300009151\|Ga0114962_10726839	Not Available	506	Open in IMG/M
3300009155\|Ga0114968_10000035	Not Available	122003	Open in IMG/M
3300009155\|Ga0114968_10025088	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4057	Open in IMG/M
3300009155\|Ga0114968_10095723	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1822	Open in IMG/M
3300009158\|Ga0114977_10010232	Not Available	5944	Open in IMG/M
3300009158\|Ga0114977_10697942	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	540	Open in IMG/M
3300009159\|Ga0114978_10017338	All Organisms → cellular organisms → Bacteria → Proteobacteria	5380	Open in IMG/M
3300009159\|Ga0114978_10027222	All Organisms → cellular organisms → Bacteria	4123	Open in IMG/M
3300009159\|Ga0114978_10101851	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1896	Open in IMG/M
3300009159\|Ga0114978_10151515	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1493	Open in IMG/M
3300009159\|Ga0114978_10270648	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1049	Open in IMG/M
3300009159\|Ga0114978_10277621	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1032	Open in IMG/M
3300009159\|Ga0114978_10390365	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	835	Open in IMG/M
3300009159\|Ga0114978_10530510	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	688	Open in IMG/M
3300009160\|Ga0114981_10131529	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium	1383	Open in IMG/M
3300009160\|Ga0114981_10437904	All Organisms → cellular organisms → Bacteria	702	Open in IMG/M
3300009164\|Ga0114975_10000393	Not Available	32931	Open in IMG/M
3300009164\|Ga0114975_10000446	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	31118	Open in IMG/M
3300009164\|Ga0114975_10000499	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	29659	Open in IMG/M
3300009164\|Ga0114975_10002597	Not Available	12319	Open in IMG/M
3300009164\|Ga0114975_10010325	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5828	Open in IMG/M
3300009164\|Ga0114975_10024111	All Organisms → cellular organisms → Bacteria	3671	Open in IMG/M
3300009164\|Ga0114975_10037579	All Organisms → cellular organisms → Bacteria → Proteobacteria	2882	Open in IMG/M
3300009164\|Ga0114975_10048268	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2513	Open in IMG/M
3300009164\|Ga0114975_10123465	All Organisms → Viruses → Predicted Viral	1491	Open in IMG/M
3300009164\|Ga0114975_10174653	All Organisms → Viruses → Predicted Viral	1221	Open in IMG/M
3300009164\|Ga0114975_10417974	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	730	Open in IMG/M
3300009164\|Ga0114975_10524071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	637	Open in IMG/M
3300009164\|Ga0114975_10573506	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	603	Open in IMG/M
3300009164\|Ga0114975_10747622	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	515	Open in IMG/M
3300009164\|Ga0114975_10765083	Not Available	508	Open in IMG/M
3300009182\|Ga0114959_10014264	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5298	Open in IMG/M
3300009182\|Ga0114959_10167108	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1158	Open in IMG/M
3300009182\|Ga0114959_10352937	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	726	Open in IMG/M
3300009183\|Ga0114974_10468599	Not Available	711	Open in IMG/M
3300009187\|Ga0114972_10595672	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	618	Open in IMG/M
3300009419\|Ga0114982_1003161	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6863	Open in IMG/M
3300009419\|Ga0114982_1004396	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5592	Open in IMG/M
3300009419\|Ga0114982_1033308	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1666	Open in IMG/M
3300009419\|Ga0114982_1144152	Not Available	735	Open in IMG/M
3300010157\|Ga0114964_10078644	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1665	Open in IMG/M
3300010160\|Ga0114967_10182755	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1140	Open in IMG/M
3300010334\|Ga0136644_10087773	All Organisms → Viruses → Predicted Viral	1947	Open in IMG/M
3300010885\|Ga0133913_10192858	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5434	Open in IMG/M
3300010885\|Ga0133913_10772019	Not Available	2507	Open in IMG/M
3300010885\|Ga0133913_10882983	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2323	Open in IMG/M
3300010885\|Ga0133913_12503324	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1257	Open in IMG/M
3300010885\|Ga0133913_12611178	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1226	Open in IMG/M
3300010885\|Ga0133913_13205796	All Organisms → Viruses → Predicted Viral	1081	Open in IMG/M
3300011010\|Ga0139557_1003619	All Organisms → Viruses → Predicted Viral	3350	Open in IMG/M
3300011010\|Ga0139557_1010414	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1828	Open in IMG/M
3300011011\|Ga0139556_1028893	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	812	Open in IMG/M
3300012352\|Ga0157138_1004626	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2325	Open in IMG/M
3300012663\|Ga0157203_1000207	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	19749	Open in IMG/M
3300012663\|Ga0157203_1002669	Not Available	3919	Open in IMG/M
3300012663\|Ga0157203_1006511	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2141	Open in IMG/M
3300012663\|Ga0157203_1010665	Not Available	1520	Open in IMG/M
3300012663\|Ga0157203_1011378	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1451	Open in IMG/M
3300012663\|Ga0157203_1014541	Not Available	1224	Open in IMG/M
3300012663\|Ga0157203_1018991	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1019	Open in IMG/M
3300012663\|Ga0157203_1051644	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	557	Open in IMG/M
3300012665\|Ga0157210_1000190	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	30350	Open in IMG/M
3300012665\|Ga0157210_1000235	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	26884	Open in IMG/M
3300012665\|Ga0157210_1002548	All Organisms → cellular organisms → Bacteria	4639	Open in IMG/M
3300012665\|Ga0157210_1005543	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2556	Open in IMG/M
3300012665\|Ga0157210_1007314	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2096	Open in IMG/M
3300012665\|Ga0157210_1039328	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	731	Open in IMG/M
3300012665\|Ga0157210_1039928	Not Available	724	Open in IMG/M
3300012667\|Ga0157208_10008213	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1526	Open in IMG/M
3300013004\|Ga0164293_10149705	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1735	Open in IMG/M
3300013004\|Ga0164293_10525684	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	777	Open in IMG/M
3300013005\|Ga0164292_10152071	Not Available	1690	Open in IMG/M
3300013006\|Ga0164294_10000156	Not Available	62615	Open in IMG/M
3300013285\|Ga0136642_1001903	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8563	Open in IMG/M
3300013285\|Ga0136642_1096817	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	763	Open in IMG/M
3300013285\|Ga0136642_1101418	All Organisms → cellular organisms → Bacteria	741	Open in IMG/M
3300013285\|Ga0136642_1109131	Not Available	708	Open in IMG/M
3300013285\|Ga0136642_1156259	Not Available	566	Open in IMG/M
3300013286\|Ga0136641_1000730	Not Available	13915	Open in IMG/M
3300013286\|Ga0136641_1007584	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3757	Open in IMG/M
3300013286\|Ga0136641_1033319	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1545	Open in IMG/M
3300013372\|Ga0177922_11320426	Not Available	592	Open in IMG/M
3300017761\|Ga0181356_1086492	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium	1035	Open in IMG/M
3300017778\|Ga0181349_1023572	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2500	Open in IMG/M
3300017780\|Ga0181346_1302970	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	542	Open in IMG/M
3300017784\|Ga0181348_1135021	Not Available	936	Open in IMG/M
3300019784\|Ga0181359_1004201	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4546	Open in IMG/M
3300019784\|Ga0181359_1060584	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1449	Open in IMG/M
3300020141\|Ga0211732_1039183	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	862	Open in IMG/M
3300020141\|Ga0211732_1043497	Not Available	1384	Open in IMG/M
3300020141\|Ga0211732_1067323	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1969	Open in IMG/M
3300020141\|Ga0211732_1104413	Not Available	3499	Open in IMG/M
3300020141\|Ga0211732_1143192	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	18644	Open in IMG/M
3300020141\|Ga0211732_1250121	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	609	Open in IMG/M
3300020151\|Ga0211736_10270451	Not Available	1806	Open in IMG/M
3300020151\|Ga0211736_10369794	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3615	Open in IMG/M
3300020151\|Ga0211736_10411071	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1143	Open in IMG/M
3300020151\|Ga0211736_10951476	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2063	Open in IMG/M
3300020151\|Ga0211736_10986588	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1171	Open in IMG/M
3300020159\|Ga0211734_10742353	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2820	Open in IMG/M
3300020160\|Ga0211733_11109289	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3040	Open in IMG/M
3300020161\|Ga0211726_10714979	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	594	Open in IMG/M
3300020162\|Ga0211735_10986525	Not Available	558	Open in IMG/M
3300020205\|Ga0211731_10262278	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	623	Open in IMG/M
3300020205\|Ga0211731_10438098	Not Available	912	Open in IMG/M
3300020205\|Ga0211731_10822917	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1819	Open in IMG/M
3300020528\|Ga0208224_1007618	All Organisms → cellular organisms → Bacteria	1748	Open in IMG/M
3300020528\|Ga0208224_1023980	Not Available	835	Open in IMG/M
3300020566\|Ga0208222_1052631	Not Available	716	Open in IMG/M
3300020572\|Ga0207909_1058959	Not Available	582	Open in IMG/M
3300021141\|Ga0214163_1099822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	673	Open in IMG/M
3300021336\|Ga0210307_1209669	Not Available	702	Open in IMG/M
3300021519\|Ga0194048_10031775	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2217	Open in IMG/M
3300021519\|Ga0194048_10192790	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	756	Open in IMG/M
3300021956\|Ga0213922_1110085	Not Available	549	Open in IMG/M
3300021963\|Ga0222712_10438677	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	785	Open in IMG/M
3300022190\|Ga0181354_1080107	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1078	Open in IMG/M
3300022407\|Ga0181351_1253101	Not Available	547	Open in IMG/M
3300022407\|Ga0181351_1272155	Not Available	514	Open in IMG/M
3300022602\|Ga0248169_104146	Not Available	15641	Open in IMG/M
3300024346\|Ga0244775_10006029	Not Available	12157	Open in IMG/M
3300024346\|Ga0244775_10078020	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2834	Open in IMG/M
3300024346\|Ga0244775_10115623	Not Available	2275	Open in IMG/M
3300024346\|Ga0244775_10123448	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2193	Open in IMG/M
3300024346\|Ga0244775_10168980	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1842	Open in IMG/M
3300024346\|Ga0244775_10403193	All Organisms → cellular organisms → Bacteria	1124	Open in IMG/M
3300024346\|Ga0244775_10460133	Not Available	1042	Open in IMG/M
3300024346\|Ga0244775_10718277	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	804	Open in IMG/M
3300024346\|Ga0244775_11177292	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300024853\|Ga0255252_1083315	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	608	Open in IMG/M
3300025358\|Ga0208504_1000034	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	38055	Open in IMG/M
3300027145\|Ga0255114_1067161	Not Available	622	Open in IMG/M
3300027292\|Ga0255134_1080467	Not Available	505	Open in IMG/M
3300027418\|Ga0208022_1061244	Not Available	815	Open in IMG/M
3300027534\|Ga0255125_1068993	Not Available	734	Open in IMG/M
3300027563\|Ga0209552_1041942	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1317	Open in IMG/M
3300027563\|Ga0209552_1086546	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	851	Open in IMG/M
3300027586\|Ga0208966_1118206	Not Available	718	Open in IMG/M
3300027586\|Ga0208966_1155244	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	604	Open in IMG/M
3300027600\|Ga0255117_1013845	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1892	Open in IMG/M
3300027608\|Ga0208974_1000045	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	55066	Open in IMG/M
3300027608\|Ga0208974_1000112	Not Available	35732	Open in IMG/M
3300027608\|Ga0208974_1001112	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10634	Open in IMG/M
3300027608\|Ga0208974_1009610	Not Available	3173	Open in IMG/M
3300027621\|Ga0208951_1181010	Not Available	535	Open in IMG/M
3300027631\|Ga0208133_1013887	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2159	Open in IMG/M
3300027642\|Ga0209135_1099390	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	978	Open in IMG/M
3300027644\|Ga0209356_1145184	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	666	Open in IMG/M
3300027679\|Ga0209769_1018810	Not Available	2449	Open in IMG/M
3300027679\|Ga0209769_1209654	Not Available	602	Open in IMG/M
3300027708\|Ga0209188_1021931	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3243	Open in IMG/M
3300027708\|Ga0209188_1056282	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1721	Open in IMG/M
3300027708\|Ga0209188_1148848	Not Available	886	Open in IMG/M
3300027708\|Ga0209188_1247205	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	618	Open in IMG/M
3300027710\|Ga0209599_10007407	All Organisms → cellular organisms → Bacteria → Proteobacteria	3576	Open in IMG/M
3300027710\|Ga0209599_10010962	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2768	Open in IMG/M
3300027710\|Ga0209599_10053883	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1061	Open in IMG/M
3300027710\|Ga0209599_10120446	Not Available	693	Open in IMG/M
3300027732\|Ga0209442_1000022	Not Available	89871	Open in IMG/M
3300027732\|Ga0209442_1156249	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	875	Open in IMG/M
3300027732\|Ga0209442_1162242	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	853	Open in IMG/M
3300027733\|Ga0209297_1097621	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1262	Open in IMG/M
3300027734\|Ga0209087_1013070	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4196	Open in IMG/M
3300027736\|Ga0209190_1058766	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1904	Open in IMG/M
3300027746\|Ga0209597_1000008	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	116631	Open in IMG/M
3300027749\|Ga0209084_1000399	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	40377	Open in IMG/M
3300027749\|Ga0209084_1011102	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5425	Open in IMG/M
3300027749\|Ga0209084_1102214	Not Available	1261	Open in IMG/M
3300027756\|Ga0209444_10173579	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	804	Open in IMG/M
3300027759\|Ga0209296_1000991	Not Available	23109	Open in IMG/M
3300027759\|Ga0209296_1007046	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7039	Open in IMG/M
3300027759\|Ga0209296_1007992	Not Available	6543	Open in IMG/M
3300027759\|Ga0209296_1016061	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4364	Open in IMG/M
3300027759\|Ga0209296_1163830	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium	986	Open in IMG/M
3300027759\|Ga0209296_1283846	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	665	Open in IMG/M
3300027763\|Ga0209088_10092783	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1395	Open in IMG/M
3300027763\|Ga0209088_10281583	Not Available	680	Open in IMG/M
3300027763\|Ga0209088_10343272	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	592	Open in IMG/M
3300027769\|Ga0209770_10003110	Not Available	8193	Open in IMG/M
3300027769\|Ga0209770_10136370	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	995	Open in IMG/M
3300027769\|Ga0209770_10316214	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300027782\|Ga0209500_10066690	Not Available	1866	Open in IMG/M
3300027782\|Ga0209500_10082826	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1624	Open in IMG/M
3300027782\|Ga0209500_10139257	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1154	Open in IMG/M
3300027782\|Ga0209500_10315135	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	657	Open in IMG/M
3300027785\|Ga0209246_10018340	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2613	Open in IMG/M
3300027797\|Ga0209107_10026388	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3340	Open in IMG/M
3300027797\|Ga0209107_10526641	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	521	Open in IMG/M
3300027798\|Ga0209353_10047503	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1977	Open in IMG/M
3300027798\|Ga0209353_10073840	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1551	Open in IMG/M
3300027892\|Ga0209550_10008041	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9749	Open in IMG/M
3300027963\|Ga0209400_1000145	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	62162	Open in IMG/M
3300027963\|Ga0209400_1009735	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6157	Open in IMG/M
3300027963\|Ga0209400_1085898	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1503	Open in IMG/M
3300027969\|Ga0209191_1001632	Not Available	14679	Open in IMG/M
3300027969\|Ga0209191_1012532	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4442	Open in IMG/M
3300027969\|Ga0209191_1015450	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3910	Open in IMG/M
3300027969\|Ga0209191_1021215	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3216	Open in IMG/M
3300027969\|Ga0209191_1100052	All Organisms → Viruses → Predicted Viral	1237	Open in IMG/M
3300027969\|Ga0209191_1276638	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	630	Open in IMG/M
3300028393\|Ga0304728_1182126	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	740	Open in IMG/M
3300028394\|Ga0304730_1004420	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9216	Open in IMG/M
3300028394\|Ga0304730_1024668	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3198	Open in IMG/M
3300032092\|Ga0315905_10023420	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6260	Open in IMG/M
3300032092\|Ga0315905_10942549	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	733	Open in IMG/M
3300033978\|Ga0334977_0027612	Not Available	3223	Open in IMG/M
3300033992\|Ga0334992_0001335	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	19561	Open in IMG/M
3300033994\|Ga0334996_0303347	Not Available	793	Open in IMG/M
3300034082\|Ga0335020_0027997	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3112	Open in IMG/M
3300034082\|Ga0335020_0038540	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2574	Open in IMG/M
3300034093\|Ga0335012_0080428	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1841	Open in IMG/M
3300034102\|Ga0335029_0300069	Not Available	1014	Open in IMG/M
3300034102\|Ga0335029_0666560	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	570	Open in IMG/M
3300034356\|Ga0335048_0425073	Not Available	653	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	97.46%
Terrestrial	Environmental → Terrestrial	2.54%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	88.89%
Marine	Environmental → Aquatic → Marine	7.94%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	2.54%
Unclassified	Environmental → Aquatic → Unclassified	0.63%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	44.76%
Lentic	Environmental → Aquatic → Freshwater → Lentic	35.24%
Lotic	Environmental → Aquatic → Freshwater → Lotic	5.71%
Unclassified	Environmental → Aquatic → Marine → Unclassified	4.13%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	3.81%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	2.54%
River	Environmental → Aquatic → Freshwater → River	1.59%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.63%
Ice	Environmental → Aquatic → Freshwater → Ice	0.63%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.63%
Creek	Environmental → Aquatic → Freshwater → Creek	0.32%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	44.76%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	30.79%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	5.71%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	4.13%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	3.81%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.86%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	2.54%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	1.59%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	1.59%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.63%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.63%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.63%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.32%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	28.57%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	23.81%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	9.52%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	5.71%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	5.40%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	4.44%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	3.81%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	3.81%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.86%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	2.54%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	1.59%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	1.59%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	1.59%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	1.27%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.63%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.63%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater	0.63%
Marine	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine	0.63%
Freshwater And Marine	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine	0.32%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.32%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	0.32%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000756	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011	Environmental	Open in IMG/M
3300000882	Freshwater microbial communities from the Columbia River	Environmental	Open in IMG/M
3300002139	M3t2BS2 (117f)	Environmental	Open in IMG/M
3300002142	M2t3t2 FKB2 (115f)	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300003388	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN	Environmental	Open in IMG/M
3300003394	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN	Environmental	Open in IMG/M
3300003411	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD	Environmental	Open in IMG/M
3300003497	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN	Environmental	Open in IMG/M
3300003783	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08	Environmental	Open in IMG/M
3300003986	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2)	Environmental	Open in IMG/M
3300004112	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)	Environmental	Open in IMG/M
3300004124	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)	Environmental	Open in IMG/M
3300004763	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004769	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004810	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005415	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005941	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300007545	Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3	Environmental	Open in IMG/M
3300007548	Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3	Environmental	Open in IMG/M
3300007551	Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3	Environmental	Open in IMG/M
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental	Open in IMG/M
3300007597	Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02	Environmental	Open in IMG/M
3300007630	Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02	Environmental	Open in IMG/M
3300007642	Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3	Environmental	Open in IMG/M
3300008111	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008119	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA	Environmental	Open in IMG/M
3300008964	Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02	Environmental	Open in IMG/M
3300008999	Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545	Environmental	Open in IMG/M
3300009026	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009182	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009187	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300010334	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011010	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice	Environmental	Open in IMG/M
3300011011	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m	Environmental	Open in IMG/M
3300012352	Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37	Environmental	Open in IMG/M
3300012663	Freshwater microbial communities from Indian River, Ontario, Canada - S50	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300012667	Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental	Open in IMG/M
3300013285	Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y	Environmental	Open in IMG/M
3300013286	Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020528	Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020566	Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020572	Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021141	Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion	Environmental	Open in IMG/M
3300021336	Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental	Open in IMG/M
3300021956	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300022602	Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024853	Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025358	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes)	Environmental	Open in IMG/M
3300027145	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h	Environmental	Open in IMG/M
3300027292	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8d	Environmental	Open in IMG/M
3300027418	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)	Environmental	Open in IMG/M
3300027534	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8d	Environmental	Open in IMG/M
3300027563	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027586	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)	Environmental	Open in IMG/M
3300027600	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027621	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)	Environmental	Open in IMG/M
3300027631	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)	Environmental	Open in IMG/M
3300027642	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027644	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027679	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)	Environmental	Open in IMG/M
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027732	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027746	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027756	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027769	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027797	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)	Environmental	Open in IMG/M
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027892	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028393	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)	Environmental	Open in IMG/M
3300028394	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300034082	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088	Environmental	Open in IMG/M
3300034093	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034356	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12421J11937_100380112	3300000756	Freshwater And Sediment	MKTIVNSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS*
JGI12421J11937_101471753	3300000756	Freshwater And Sediment	MKTILNTVWSVIVAFGEARYAASLARQGRIEESKAVYNGRA*
JGI12421J11937_101718501	3300000756	Freshwater And Sediment	MKTIVNSIWSFLEAFGQARYAASLARQGRIEESKAVYNGPA*
FwDRAFT_102923543	3300000882	Freshwater And Marine	MKTIVNAIWAFLEAFGQARAAASLARQGRIAEAKAIYGA*
M3t2BS2_18761872	3300002139	Marine	MKTILNSIWSFLEALGQARYAASLARQGRISEAKAVYK*
M2t2FKB2_10502673	3300002142	Marine	MKTILNSIWSFLEALGQARYAASLARQGRISEAKAVY
B570J29032_1095998962	3300002408	Freshwater	MNSILNSILNSIWSVLESFAQARAAAVLARQGRIEEAKAVYGN*
B570J40625_1000780307	3300002835	Freshwater	MKKIVNSIWSFLEALGQARAASILARQGRIEEAKAIYGA*
B570J40625_1002423452	3300002835	Freshwater	MKTILNSIWSFLEAFGEARYAASLARQGRTEEAKAVYGA*
B570J40625_1005862112	3300002835	Freshwater	MKTILNSIWAVLEAFGQARYAASLARQGRIAESKAVYES*
B570J40625_1006590861	3300002835	Freshwater	MKTILNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGA*
B570J40625_1009125022	3300002835	Freshwater	MKTILNTIWSFLEAFGQARYAASLARQGRTEEAKAVYGS*
JGI25908J49247_100004919	3300003277	Freshwater Lake	MNSILNSIWSVLEAFGQARAAASLARQGRIDEAKAVYNGQQ*
JGI25908J49247_1000065816	3300003277	Freshwater Lake	MKTILNTIWSVLEAFGQARYAASLARQGRVEESKAVYNGRA*
JGI25908J49247_100020379	3300003277	Freshwater Lake	MKTILNSIWSVLESFAQARAAASLARQGRIDEAKAVYTN*
JGI25908J49247_1000216312	3300003277	Freshwater Lake	MKKIVNSLWSFLEALGQARAASILARQGRIEEAKAVYNGPA*
JGI25908J49247_100029723	3300003277	Freshwater Lake	MKTILNTIWSVIVAFGEARYAASLARQGRIEESKAVYNGRA*
JGI25908J49247_100097303	3300003277	Freshwater Lake	MKTITNAIWSFLEAFGQARYAASLARQGRIAESKAVYNGPA*
JGI25908J49247_100112162	3300003277	Freshwater Lake	MKTILNSIWSFLEAFGQARVAASLARQGRIEESKAVYNGPA*
JGI25908J49247_100156115	3300003277	Freshwater Lake	MKTIVNTIWLFLEAFGQARAAASLARQGRIAEAKAVYGN*
JGI25908J49247_100234874	3300003277	Freshwater Lake	MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYTN*
JGI25908J49247_100579422	3300003277	Freshwater Lake	MKTILNTIWSWLVAFGEARYAASLARQGRVAEAKAVYGS*
JGI25908J49247_100868513	3300003277	Freshwater Lake	MKTIXNSIWSVLEAFGQARVAASLARMGDIEGAKAVYNEPA*
JGI25908J49247_101532942	3300003277	Freshwater Lake	MKTILNSIWSVLEAFGQARAAASLVRQGRIAEAKAIYGN*
JGI25908J49247_101579812	3300003277	Freshwater Lake	MKTIINSIWSVLEAFGQARVAASLARMGDIEGAKAVYNEPA*
JGI25910J50241_100029842	3300003388	Freshwater Lake	MKTILNSIWSVLESFGQARAAASLARQGKIAEAKAIYGN*
JGI25910J50241_100156707	3300003388	Freshwater Lake	MKTILNTIWSVLEAFGQARYAASLARQGRVEESKAVYNGRA
JGI25910J50241_101664922	3300003388	Freshwater Lake	MKTIVNSIWSLLEVFGQARYAASLARQGRIAEAKAVYGA*
JGI25907J50239_100105410	3300003394	Freshwater Lake	MKTILNSIWSVLESFGQARAAASLARQGRIDEAKAVYTN*
JGI25911J50253_100093276	3300003411	Freshwater Lake	MKTILNSIWSFLETFGQARVAASLARQGRIEESKAVYNGPA*
JGI25925J51416_100770653	3300003497	Freshwater Lake	MKTITNAIWSFLEAFGQARAAASLARXGRIEEAKAVYTN*
JGI25925J51416_101585782	3300003497	Freshwater Lake	TTLKKGXLXMKTIVNSIWSLLEXFGQARXAAXLARQGRIXEAKAVYGA*
Ga0007850_100011010	3300003783	Freshwater	MKSILKSIWTVLEAVGQARYAAHLARQGRIADAKAIYGE*
Ga0063233_100939313	3300003986	Freshwater Lake	SMKTITNAIWSFLEAFAQARAAASLARMGDIEGAKAVYK*
Ga0065166_102306682	3300004112	Freshwater Lake	MKTILNSIWSFLVAFGEARYAASLARQGRVEEAKAVYNN*
Ga0066178_100676801	3300004124	Freshwater Lake	IQFSKGTLSMKTILNTIWSWLVAFGEARYAASLARQGRVAEAKAVYGS*
Ga0007746_10493094	3300004763	Freshwater Lake	MKTIINSIWSFLEAFGQARYAASLARQGRVEESKAVYNGRA*
Ga0007748_114269441	3300004769	Freshwater Lake	SMKTITNAIWSFLEVFAQARAAASLARMGDIEGAKAAYK*
Ga0007757_114707272	3300004810	Freshwater Lake	MKTILNTIWSWLEAFGQARYAASLARQGRMEESKAVYNGRA*
Ga0007743_12847573	3300005415	Freshwater Lake	MNSILNSIWSVLEAFGQARAAASLARQGRIDEAKAVYNGQQ*SSRIGG
Ga0007743_13059733	3300005415	Freshwater Lake	MKTIVNSIWSFLESFAQARAAASLARQGRIEEAKAIYGN*
Ga0070374_100119034	3300005517	Freshwater Lake	MKTITNAIWSFLEAFAQARAAASLARMGDIEGAKAVYK*
Ga0070374_100134033	3300005517	Freshwater Lake	MKTILNSIWSVLEAFGQARAAASLARMGDIEGAKAVYK*
Ga0070374_100136233	3300005517	Freshwater Lake	MKTITNAIWSFLEVFAQARAAASLARMGDIEGAKAAYK*
Ga0070374_100257726	3300005517	Freshwater Lake	MKTIINTIWSWLEAFGQARYAASLARQGRIEESKAVYNGRA*
Ga0070374_101610524	3300005517	Freshwater Lake	MKNILNSIWSVLEAFGQARAAASLARMGDIEGAKAVYK*
Ga0070374_101853522	3300005517	Freshwater Lake	MKTIVNSIWSLLEAFGQARAAASLARQGRIEEAKAVYGA*
Ga0070374_106999002	3300005517	Freshwater Lake	MKTILNSIWSMLEAFGQARAAASLARMGDIEGAKAVYK*
Ga0068876_100216307	3300005527	Freshwater Lake	MKTITNAIWSFLQAFGQARAAASLARQGRIEEAKAIYGN*
Ga0049081_100003295	3300005581	Freshwater Lentic	MKTILNTIWSVIVAFGEARYAASLARQGRVEEAKAVYDGPA*
Ga0049081_100112434	3300005581	Freshwater Lentic	MKTILNSIWSVLVAFGEARYAASLARQGKIKESKAVYGA*
Ga0049081_100517803	3300005581	Freshwater Lentic	MKTILNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGN*
Ga0049080_100190915	3300005582	Freshwater Lentic	MKTILNSIWSVLVSFGEARYAASLARQGKIKESKAVYGA*
Ga0049080_100266626	3300005582	Freshwater Lentic	MKTIVNTFWSFLEAFGQARAAAILARQGRIEEAKAIYIN*
Ga0049080_100426362	3300005582	Freshwater Lentic	MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYGN*
Ga0049080_100682282	3300005582	Freshwater Lentic	MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYRA*
Ga0049080_100996493	3300005582	Freshwater Lentic	MKTILNSIWSVLEAFGQARAAASLVRQGRIAEAKAVYGN*
Ga0049085_101493713	3300005583	Freshwater Lentic	MKTFTNAIWSFLEAFGQARAAASLARQGRIEEAKAVYNAQA*
Ga0049085_101943763	3300005583	Freshwater Lentic	MKTILNSIWSFLEAFGQARVAASLARQGRIEEAKAVYGN*
Ga0049082_100716474	3300005584	Freshwater Lentic	MKTIVNAIWSFLEAFGQARAAASLARQGRIAEAKAIYGA*
Ga0078894_1001677410	3300005662	Freshwater Lake	MKSFINAIWSFLESVGQARAAASLARLGKIEEAKAIFSK*
Ga0078894_1001718710	3300005662	Freshwater Lake	MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYGA*
Ga0078894_100283816	3300005662	Freshwater Lake	MKTIIDAIWSFLEAFGQARAAASLARQGRIDEAKAVYE*
Ga0078894_101027546	3300005662	Freshwater Lake	MKTIANYLWSMLEAFGQARAAASLARMGDIEGAKSVYK*
Ga0078894_101639684	3300005662	Freshwater Lake	MKTFIKSIWSFLEAFAQARAAASLARQGKTAEAKAVYGS*
Ga0078894_102636564	3300005662	Freshwater Lake	MKTILNSIWSFLVAFGEARYAASLARQGRVAEAKAVYGS*
Ga0078894_102760244	3300005662	Freshwater Lake	MKSILNSIWSVLEAFGQARYAASLARQGRTEEAKAVYGA*
Ga0078894_102804474	3300005662	Freshwater Lake	MKTIVNSIWSFLESFAQARAAASLARQGRVEEAKAVYTN*
Ga0078894_103286762	3300005662	Freshwater Lake	MKTILNSIWSFLVAFGEARYAASLARQGRTEEAKAIYNN*
Ga0078894_103813642	3300005662	Freshwater Lake	MKNFIQSIWSFFESFGQARYAAFLARQGRIEEAKAIYSK*
Ga0078894_106756023	3300005662	Freshwater Lake	MKTILNSIWSFLVAFGEARYAASLARQGRVEEAKAVYGA*
Ga0078894_106844202	3300005662	Freshwater Lake	MKTILTSIWSFLEAFGQARYAASLARQGRTEEAKAVYGA*
Ga0078894_111492871	3300005662	Freshwater Lake	ISMKNFINSFWSFLEAFGQARYATFLTRQGRIDEAKALYE*
Ga0070743_101197852	3300005941	Estuarine	MKTITNAIWSFLEAFGQARAAASLARMGDIEGAKAVYK*
Ga0070744_100330044	3300006484	Estuarine	MKTIVNSIWSFLEAFAQARAAASLARQGKIAESKAVYK*
Ga0102873_12137021	3300007545	Estuarine	LSMKTIVNAIWAFLEAFGQARAAASLARQGRIAEAKAIYGA*
Ga0102877_11787512	3300007548	Estuarine	MNSITNAIWSFLEAFGQARAAASLARQGRIAESKAVYNGPA*
Ga0102881_11215182	3300007551	Estuarine	KSIWSFLEAFGQARYAASLARQGRTEEAKAVYRA*
Ga0102828_10356071	3300007559	Estuarine	MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYTN*
Ga0102919_11326112	3300007597	Estuarine	MKTIINSIWSFLEAFGQARTAASLARQGKIDEAKAVYGN*
Ga0102903_11283463	3300007630	Estuarine	MKTIVNSIWSFLEAFGQARTAASLARQGRVAEAKAVYGS*
Ga0102876_10600204	3300007642	Estuarine	LSMKTILNSIWSVLEAFGQARAAASLARMGDIEGAKAVYK*
Ga0114344_10015626	3300008111	Freshwater, Plankton	MKTITNAIWSFLQALGQARAAASLARQGRIEEAKAIYGN*
Ga0114344_10179142	3300008111	Freshwater, Plankton	MKTITNAIWSFLVAFGEARYAASLARQGRVAEAKDVYKS*
Ga0114346_10443942	3300008113	Freshwater, Plankton	MKTILNSIWSVLEAFGQARAAASLARQGRIAEAKAVYGN*
Ga0114346_12817073	3300008113	Freshwater, Plankton	MKTILNYIWTVLEAFGQARYAASLARQGRTEEAKA
Ga0114354_10799992	3300008119	Freshwater, Plankton	MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYGA*
Ga0102889_12314822	3300008964	Estuarine	MKTIINTIWSFLVAFGQARYAASLARQGRIEESKAVYNGQA*
Ga0102816_11848031	3300008999	Estuarine	MKTIINSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS*
Ga0102829_13197711	3300009026	Estuarine	ITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYGN*
Ga0114973_101448923	3300009068	Freshwater Lake	MKTILNSIWSFLEAFAQARAAASLARQGKIAESKAVYGN*
Ga0114973_103538742	3300009068	Freshwater Lake	MKKIINSIWSLLEAFGQARAAASLARQGRIAEAKAVYGA*
Ga0114973_107232822	3300009068	Freshwater Lake	MKTILNSIWSVLEAFGQARYAASLARQGRIAESKAVYGS*
Ga0114962_1000208015	3300009151	Freshwater Lake	MKTIVNSIWSFLEAFGQARAAASLARQGKTAEAKAVYK*
Ga0114962_100056184	3300009151	Freshwater Lake	MKTVLNSIWSFLEAFGQARVAASLARQGRIKESKAVYGA*
Ga0114962_100260673	3300009151	Freshwater Lake	MKTIVNAIWSFLESFAQARAAASLARQGRVEEAKAIYGS*
Ga0114962_100963642	3300009151	Freshwater Lake	MKTIVNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGA*
Ga0114962_101051032	3300009151	Freshwater Lake	MKSIINSIWSVLLTFGEARYAASLARQGRVAEAKAVYRN*
Ga0114962_105616792	3300009151	Freshwater Lake	MKTIVNSIWSFLEAFGQARAAASLARQGKIAESKAVYGA*
Ga0114962_107268392	3300009151	Freshwater Lake	MKSVLNTIWSVLVSFGEARHAASLARQGRVAEAKAVYGA*
Ga0114968_100000354	3300009155	Freshwater Lake	MKKVLNAIWLFLVAFGEARYAASLARQGRVAEAKAVYGA*
Ga0114968_100250886	3300009155	Freshwater Lake	MKTIINSIWSFLEAFGQARAAASLARQGKIAESKAVYGS*
Ga0114968_100957233	3300009155	Freshwater Lake	MKTVLNSIWSFLEAFGQARYAASLVRQGRITEAKAVYGS*
Ga0114977_100102324	3300009158	Freshwater Lake	MKTIINSIWSFLEAFGQARAAASLARMGDIEGAKAVYK*
Ga0114977_106979421	3300009158	Freshwater Lake	GKISMKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGA*
Ga0114978_100173381	3300009159	Freshwater Lake	MKTVLNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGS*
Ga0114978_100272227	3300009159	Freshwater Lake	MKTILNSIWSFLESFAQARAAASLARQGRIEEAKAVYTN*
Ga0114978_101018513	3300009159	Freshwater Lake	MKTILNSIWSFLEAFGQARAAASLARQGKIAESKAIYGS*
Ga0114978_101515154	3300009159	Freshwater Lake	MKTIVNSIWSVLEAFGQARAAASLARQGRIAEAKAVYK*
Ga0114978_102706482	3300009159	Freshwater Lake	MKTILNSIWSFLEAFGQARVAASLARQGRIKESKAVYGA*
Ga0114978_102776212	3300009159	Freshwater Lake	MKTFVNSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS*
Ga0114978_103903652	3300009159	Freshwater Lake	MKTILNSIWSVLEAFGQARAAASLARQGRIAEAKAVYGA*
Ga0114978_105305101	3300009159	Freshwater Lake	KTITNAIWSFLEAFGQARAAASLARQGKIAESKAVYGS*
Ga0114981_101315294	3300009160	Freshwater Lake	MKTILNTIWSFLEAFGQARYAASLARQGRTEEAKAV
Ga0114981_104379042	3300009160	Freshwater Lake	MKTIVNSIWSFFEAMGQARAAASLARLGDIAGAKAIYK*
Ga0114975_1000039313	3300009164	Freshwater Lake	MKTILNSIWSVLESFAQARAAAVLVRQGRIEEAKAVYGA*
Ga0114975_1000044647	3300009164	Freshwater Lake	MKTIINSIWSFLEAFGQARAAASLARQGRVAEAKA
Ga0114975_100004992	3300009164	Freshwater Lake	MKTIINSIWSFLEAFGQARAAASLARQGRVAEAKAVYGA*
Ga0114975_1000259716	3300009164	Freshwater Lake	MKTIVNSIWSFLEAFGQARAAASLARQGRFEEAKAVYGA*
Ga0114975_100103255	3300009164	Freshwater Lake	MKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGS*
Ga0114975_100241113	3300009164	Freshwater Lake	MKTILNSIWSVLEAFGQARYAASLARQGRVEEAKAIYGS*
Ga0114975_100375792	3300009164	Freshwater Lake	MKTVLNSIWSVLVSFGEARYAASLARQGRIAEAKAIYNN*
Ga0114975_100482686	3300009164	Freshwater Lake	MKNFINAIWSFLEAFGQARAAASLARQGRIAEAKAIYGA*
Ga0114975_101234653	3300009164	Freshwater Lake	MKTILNAIWSFLVAFGEARYAASLARQGKIDKAKAVYGS*
Ga0114975_101746532	3300009164	Freshwater Lake	MKTILNSIWSFLEAFGQARTAASLVRQGRIEEAKAVYGS*
Ga0114975_104179743	3300009164	Freshwater Lake	MKSVLNTIWSFLEAFGQARAAASLARQGRIAEAKAVYGA*
Ga0114975_105240712	3300009164	Freshwater Lake	MKTILNSIWSFLESFAQARAAASLARQGRIEEAKAVYGS*
Ga0114975_105735062	3300009164	Freshwater Lake	MKTIVNSIWSFLEAFGQARAAASLARQGRVAEAKAVYGS*
Ga0114975_107476222	3300009164	Freshwater Lake	MKTILNSIWSWLEAFGQARAAASLARQGRVAEAKAVYGA*
Ga0114975_107650831	3300009164	Freshwater Lake	MKTIVNSIWSWLEAFGQARAAASLARQGRIAEAKAVYGA*
Ga0114959_100142647	3300009182	Freshwater Lake	MKSIFNSIWSFLEAFGEARYAASLARQGRTAEAKALYGG*
Ga0114959_101671084	3300009182	Freshwater Lake	MKSVLNTIWSVLVSFGEARYAASLARQGRVAEAKAVYGA*
Ga0114959_103529373	3300009182	Freshwater Lake	MKSILNSIWSVLVAFGEARYAASLARQGRVAEAKAVYGN*
Ga0114974_104685992	3300009183	Freshwater Lake	MKTILNSIWSFLEAFGQARAAASLARQGRIAEAKAIYGA*
Ga0114972_105956721	3300009187	Freshwater Lake	ILNSIWSFLEAFAQARAAASLARQGKIAESKAVYGN*
Ga0114982_10031613	3300009419	Deep Subsurface	MKTIANSIWSFLEAFGQARAAAILARQGRVEEAKAIYGS*
Ga0114982_10043968	3300009419	Deep Subsurface	MKTIVNSIWSFLEAFGQARAAAILARQGKIEEAKAVYGS*
Ga0114982_10333083	3300009419	Deep Subsurface	MKTFIKSIWSFLEAFAQARAAASLARQGKIDEAKAVYGS*
Ga0114982_11441523	3300009419	Deep Subsurface	MKTILNTIWSVLVAFGEARYAASLARQGRIDEAKAVYGS*
Ga0114964_100786443	3300010157	Freshwater Lake	MKSVLNTIWSILLSFGEARHAASLARQGRVAEAKAVYGA*
Ga0114967_101827552	3300010160	Freshwater Lake	MKTIINTIWSWLEAFGQARCAASLARQGRIAEAKAVYGA*
Ga0136644_100877735	3300010334	Freshwater Lake	TVPMKSVLNTIWSVLVSFGEAGHAASLARQGRVAEAKAVYGA*
Ga0133913_1019285811	3300010885	Freshwater Lake	MKTVVNAIWSFLEAFGQARAAASLARQGKIAESKAVYGS*
Ga0133913_107720191	3300010885	Freshwater Lake	MKTIINSIWSFLEAFGQARAAASLARQGRIEEAKAIYGA*
Ga0133913_108829835	3300010885	Freshwater Lake	MKTVLNSIWSFLVAFGEARYAASLARQGRVAEAKAIYNN*
Ga0133913_125033242	3300010885	Freshwater Lake	MKSIVKSIWSFLETFGQARAAASLARQGRVAEAKAIYGA*
Ga0133913_126111782	3300010885	Freshwater Lake	MKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGA*
Ga0133913_132057962	3300010885	Freshwater Lake	MKTILNSIWSFLEAFGQARAAASLARQGKFNEAKAVYGN*
Ga0139557_10036191	3300011010	Freshwater	MKTILNSIWSVLESFAQARAAASLARQGRIDEAKAVY
Ga0139557_10104142	3300011010	Freshwater	MKTILNTIWSVLVAFGEARYAASLARQGRIEESKAVYNGRA*
Ga0139556_10288931	3300011011	Freshwater	MKTILNSIWSFLEAFGQARAAASLARQGRIEEAKAVYTN*
Ga0157138_10046264	3300012352	Freshwater	MKTIINKLWSILESFGQARYAASLARQGRVDEAKAVYE*
Ga0157203_10002079	3300012663	Freshwater	MKTILNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGN*
Ga0157203_100266910	3300012663	Freshwater	MKIILNSIWSFLEAFGQARVAASLARQGKIEEAKAMYGA*
Ga0157203_10065114	3300012663	Freshwater	MKTILNSIWSVLESFAQARAAAVLARQGKIEEAKAVYGA*
Ga0157203_10106651	3300012663	Freshwater	MKTILNTIWSVIVAFGEARYAASLARQGRIAEAKAVYGA*
Ga0157203_10113783	3300012663	Freshwater	MKTIVKSIWSFLEAFGQARAAAILARQGRIEEAKAVYTN*
Ga0157203_10145413	3300012663	Freshwater	MKTFLNSIWSVLEAFGQARAAATLARIGDIEGAKAVYK*
Ga0157203_10189913	3300012663	Freshwater	MKTILNSIWSFLVAFGEARYAASLARQGRVAEAKAVYGA*
Ga0157203_10516442	3300012663	Freshwater	MKTFLNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGA*
Ga0157210_100019044	3300012665	Freshwater	MKSILNSIWSVLEAFGQARAAATLARIGDIEGAKAVYK*
Ga0157210_100023514	3300012665	Freshwater	MKSILNTIWSVLESFGQARYAASLARQGRVDEAKAVYE*
Ga0157210_10025484	3300012665	Freshwater	MKTFLNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGS*
Ga0157210_10055434	3300012665	Freshwater	MKQFFNTIWNVLVAIGEARYAASLARQGRIEEAKAVYGA*
Ga0157210_10073144	3300012665	Freshwater	MKTIANSIWLFLEAFGQARYAASLARQGRTEEAKAVYRS*
Ga0157210_10393282	3300012665	Freshwater	MKTILNYIWTALMAFSEARYAASLARQGRFDEAKAVYE*
Ga0157210_10399282	3300012665	Freshwater	MKQIFNTIWSVLVAFGEARYAASLARQGRVAEAKAVYGS*
Ga0157208_100082134	3300012667	Freshwater	MKTIVKSIWSFLEAFGQARAAAILARQGRVAEAKAVYGA*
Ga0164293_101497051	3300013004	Freshwater	MKTIVNSIWLFLEAFGQARDAASLARQGRIEEAKAVYGN*
Ga0164293_105256841	3300013004	Freshwater	KGNLSMKTILNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGA*
Ga0164292_101520715	3300013005	Freshwater	MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYGN*
Ga0164294_1000015647	3300013006	Freshwater	MKTIFNSIWSVLEAFAQARAAASLARMGDIEGAKAVYK*
Ga0136642_100190314	3300013285	Freshwater	MKSITNAIWSFLEAFGQARAAASLARQGRVTEAKALYGR*
Ga0136642_10968172	3300013285	Freshwater	MKTILNSIWSFLEAFGQARAAASLARQGRVAEAKAVYGA*
Ga0136642_11014182	3300013285	Freshwater	MKYILKSIWSVLEAVGEARYAAHLARQGRIADAKAVYGE*
Ga0136642_11091313	3300013285	Freshwater	MKTILNSIWSFLEVFGQARAAASLARQGKIAESKAVYGA*
Ga0136642_11562592	3300013285	Freshwater	MKSIVNSIWSFFEAMGQARAAASLARIGDIAGAKAIYK*
Ga0136641_10007303	3300013286	Freshwater	MKTILNSIWSFLEVFGQARYAASLARQGRTAEAKAVYGK*
Ga0136641_10075848	3300013286	Freshwater	MKTILNSIWLFLETFGQARYAASLARQGRTAEAKAVYGA*
Ga0136641_10333192	3300013286	Freshwater	MKTITSAIWSFLEIFGQARAAASLARQGKIAESKAVYGA*
Ga0177922_113204263	3300013372	Freshwater	MKTILNSIWSVLEAFGQARVAASLARMGDIEGAKAVYNEPA*
Ga0181356_10864924	3300017761	Freshwater Lake	MKTILNSMWSVLEAFGQARAAASLARMGDIEGAKAVYK
Ga0181349_10235725	3300017778	Freshwater Lake	MKTILNSIWSVLEAFGQARAAASLARQGRIAEAKAVYGN
Ga0181346_13029701	3300017780	Freshwater Lake	ELSKGNISMKTILNSIWSVLESFGQARAAASLARQGKIAEAKAIYGN
Ga0181348_11350214	3300017784	Freshwater Lake	MKTILNSIWSFLETFGQARVAASLARQGRIEESKAVYNG
Ga0181359_10042012	3300019784	Freshwater Lake	MKTILNSIWSVLEAFGQARAAASLVRQGRIAEAKAIYGN
Ga0181359_10605842	3300019784	Freshwater Lake	MKTIVNTIWLFLEAFGQARAAASLARQGRIAEAKAVYGN
Ga0211732_10391832	3300020141	Freshwater	MKTIVKSIWSFLEAFAQARAAASLARQGRVEEAKAVYGA
Ga0211732_10434972	3300020141	Freshwater	MKNFINAIWSFLEAFGQARAAASLARQGRIAEAKSIYGA
Ga0211732_10673233	3300020141	Freshwater	MKTIVNSIWSFLEAFGQARAAASLARQGKIDEAKAVYGN
Ga0211732_11044135	3300020141	Freshwater	MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYGN
Ga0211732_114319215	3300020141	Freshwater	MKTIINSIWSFLEAFGQARAAASLARQGKTAEAKAIYGA
Ga0211732_12501211	3300020141	Freshwater	MKQVLNTILQFLEAFGQARAAASLARQGRINEAKAVYAK
Ga0211736_102704513	3300020151	Freshwater	MKQVLNTILQFLEAFGQARAAASLTRQGRIDEAKAIYAK
Ga0211736_103697947	3300020151	Freshwater	MKTIVNSIWSFLEAFGQVRAAASLARQGRVEEAKAVYIN
Ga0211736_104110712	3300020151	Freshwater	MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYGN
Ga0211736_109514762	3300020151	Freshwater	MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAIYTN
Ga0211736_109865884	3300020151	Freshwater	MKTIINSIWSFLVAFGEARYAASLARQGRVEEAKAVYGA
Ga0211734_107423534	3300020159	Freshwater	MKQVLNTIFQFLEAFGQARAAASLARQGRIDEAKAIYAK
Ga0211733_111092897	3300020160	Freshwater	MKNIINSIWSFLEAFGQARAASILARQGRIEEAKAIYGN
Ga0211726_107149791	3300020161	Freshwater	MKNIINSIWSFLEAFGQARAASILARQGKIEEAKAIYGN
Ga0211735_109865252	3300020162	Freshwater	MKTILNTIWSVIVSFGEARYAASLARQGRVEEAKAVYNGPA
Ga0211731_102622781	3300020205	Freshwater	MKTIVNSIWSFLEAFAQARAAASLARQGKIEEAKAVYGA
Ga0211731_103231143	3300020205	Freshwater	LNTILQFFEAMGQARAAASLTRQGRINEAKAIYAK
Ga0211731_104380983	3300020205	Freshwater	MKTIINSVWSFLEAFGQARAAASLARQGRIEEAKAIYE
Ga0211731_108229175	3300020205	Freshwater	MKTIVNSIWSLLEAFGQARAAASLARQGKIEEAKAVYKA
Ga0211731_113512643	3300020205	Freshwater	MKQVLNTILQFFEAMGQARAAASLTRQGRIDEAKAIYAK
Ga0208224_10076181	3300020528	Freshwater	MKTIVNSIWLFLEAFGQARDAASLARQGRIEEAKAVYGN
Ga0208224_10239803	3300020528	Freshwater	MKTITNAIWSFLQAFGQARAAASLARQGRIEEAKAIYGN
Ga0208222_10526312	3300020566	Freshwater	MKTIVNSIWLFLEAFGQARAAASLARQGRIEEAKAVYGN
Ga0207909_10589593	3300020572	Freshwater	MKTILNSIWSVLESFAQARAAAVLARQGRIEEAKAVYGN
Ga0214163_10998222	3300021141	Freshwater	MKTILNSIWSFLEAFGQARYAASLARQGRIAESKAVYES
Ga0210307_12096691	3300021336	Estuarine	MKTILNSIWSVLEAFGQARAAASLARQGRIDDAKAVYK
Ga0194048_100317753	3300021519	Anoxic Zone Freshwater	MKTIINTIWSVIVAFGEARYAASLARQGRVEEAKAVYNGPA
Ga0194048_101927902	3300021519	Anoxic Zone Freshwater	MKTFVNSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS
Ga0213922_11100852	3300021956	Freshwater	MKSILNLIWSVLESFGQARAAAVLARQGRIEEAKAIYGS
Ga0222712_104386772	3300021963	Estuarine Water	MKSVLNSIWSFLESFAQARAAASLARQGRVEEAKAVYKN
Ga0181354_10801073	3300022190	Freshwater Lake	MKTITNAIWSFLEVFAQARAAASLARMGDIEGAKAAYK
Ga0181351_12531012	3300022407	Freshwater Lake	MKTILNSIWSVLEAFGEARYAASLARQGRVAEAKAVYGA
Ga0181351_12721552	3300022407	Freshwater Lake	MKTITNAIWSFLEAFGQARYAASLARQGRIAESKAVYNGPA
Ga0248169_1041468	3300022602	Freshwater	MKSILNSIWTVLVAVGQARHAAYLARQGRLAEAKAVYGN
Ga0244775_1000602916	3300024346	Estuarine	MKTITNAIWSFLEAFGQARAAASLARMGDIEGAKAVYK
Ga0244775_100780205	3300024346	Estuarine	LSMKTIVNSIWSFLEAFAQARAAASLARQGKIAEAKAVYGA
Ga0244775_101156235	3300024346	Estuarine	MKTIVNLIWSWLETFGQARAAASLARQGRIDEAKAVYK
Ga0244775_101234482	3300024346	Estuarine	MNSITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYTN
Ga0244775_101689805	3300024346	Estuarine	MKTIVNAIWAFLEAFGQARAAASLARQGRIAEAKAIYGA
Ga0244775_104031932	3300024346	Estuarine	MKTIVNSIWSFLEAFGQARAAASLARQGRIEESKAVYNGPA
Ga0244775_104601334	3300024346	Estuarine	MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYRN
Ga0244775_107182772	3300024346	Estuarine	MKTIINSIRSFLEAFGQARTAASLARQGRIEEAKAVYNAPA
Ga0244775_111772921	3300024346	Estuarine	LNSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS
Ga0255252_10833152	3300024853	Freshwater	GKIPMKTILNTIWSVLEAFGQARYAASLARQGRVEESKAVYNGRA
Ga0208504_100003413	3300025358	Freshwater	MKSILKSIWTVLEAVGQARYAAHLARQGRIADAKAIYGE
Ga0255114_10671611	3300027145	Freshwater	SMKTILNSIWSMLEAFGQARAAASLARMGDIEGAKAVYK
Ga0255134_10804672	3300027292	Freshwater	MKTILNSIWSVLEAFAQARAAASLARMGDIEGAKAVYK
Ga0208022_10612443	3300027418	Estuarine	MKTITNAIWSFLEAFAQARAAASLARMGDIEGAKAVYK
Ga0255125_10689932	3300027534	Freshwater	MKTILNSIWSVLEAFGQARAAASLARIGDIEGAKAVYK
Ga0209552_10419422	3300027563	Freshwater Lake	MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYTN
Ga0209552_10865462	3300027563	Freshwater Lake	SMKTIINSIWSFLEAFGQARYAASLARQGRVEESKAVYNGRA
Ga0208966_11182061	3300027586	Freshwater Lentic	MKTILNTIWSVIVAFGEARYAASLARQGRIEESKAVYNGRAXSSRR
Ga0208966_11552442	3300027586	Freshwater Lentic	MKTIVNAIWSFLEAFGQARAAASLARQGRIAEAKAIYGA
Ga0255117_10138455	3300027600	Freshwater	MKTIVNSIWSFLEAFGQARAAASLARQGRIAEAKAIYGA
Ga0208974_10000457	3300027608	Freshwater Lentic	MKKIVNSLWSFLEALGQARAASILARQGRIEEAKAVYNGPA
Ga0208974_100011265	3300027608	Freshwater Lentic	MKTILNTIWSVIVAFGEARYAASLARQGRVEEAKAVYDGPA
Ga0208974_100111217	3300027608	Freshwater Lentic	MKTILNSIWSVLVAFGEARYAASLARQGKIKESKAVYGA
Ga0208974_10096105	3300027608	Freshwater Lentic	FSKGKLSMKTILNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGN
Ga0208951_11810102	3300027621	Freshwater Lentic	MKTIVNSIWSLLEVFGQARYAASLARQGRIAEAKAVYGA
Ga0208133_10138871	3300027631	Estuarine	SMNSITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYTN
Ga0209135_10993902	3300027642	Freshwater Lake	MKTIVNSIWSLLEAFGQARAAASLARQGRIEEAKAVYGA
Ga0209356_11451842	3300027644	Freshwater Lake	MKTIVNTIWSVLEAFGQARAAASLARMGDIEGAKAVYK
Ga0209769_10188102	3300027679	Freshwater Lake	MKTILNSIWSVLESFGQARAAASLARQGKIAEAKAIYGN
Ga0209769_12096542	3300027679	Freshwater Lake	MNSILNSIWSVLEAFGQARAAASLARQGRIDEAKAVYNGQQ
Ga0209188_10219317	3300027708	Freshwater Lake	MKSIFNSIWSFLEAFGEARYAASLARQGRTAEAKALYGG
Ga0209188_10562822	3300027708	Freshwater Lake	MKSIINSIWSVLLTFGEARYAASLARQGRVAEAKAVYRN
Ga0209188_11488482	3300027708	Freshwater Lake	MKSVLNTIWSVLVSFGEARHAASLARQGRVAEAKAVYGA
Ga0209188_12472052	3300027708	Freshwater Lake	MKTIVNAIWSFLESFAQARAAASLARQGRVEEAKAIYGS
Ga0209599_100074078	3300027710	Deep Subsurface	MKTIVNSIWSFLEAFGQARAAAILARQGKIEEAKAVYGS
Ga0209599_100109623	3300027710	Deep Subsurface	MKTIANSIWSFLEAFGQARAAAILARQGRVEEAKAIYGS
Ga0209599_100538833	3300027710	Deep Subsurface	MKTIVKSIWSFLEAFAQARAAASLARQGKIDEAKAVYGS
Ga0209599_101204463	3300027710	Deep Subsurface	MKTILNTIWSVLVAFGEARYAASLARQGRIDEAKAVYGS
Ga0209442_1000022110	3300027732	Freshwater Lake	MKNILNSIWSVLEAFGQARAAASLARMGDIEGAKAVYK
Ga0209442_11562492	3300027732	Freshwater Lake	MKTIVNSIWSFLEAFGQARAAASLASQGKIAEAKAVYK
Ga0209442_11622422	3300027732	Freshwater Lake	MKTIVNSIWSFLESFAQARAAASLARQGKIAESKAVYK
Ga0209297_10976213	3300027733	Freshwater Lake	MKTIINSIWSFLEAFGQARAAASLARMGDIEGAKAVYK
Ga0209087_10130705	3300027734	Freshwater Lake	MKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGS
Ga0209190_10587663	3300027736	Freshwater Lake	MKTILNSIWSVLEAFGQARYAASLARQGRIAESKAVYGS
Ga0209597_100000860	3300027746	Freshwater Lake	MKTIINTIWSWLEAFGQARCAASLARQGRIAEAKAVYGA
Ga0209084_100039955	3300027749	Freshwater Lake	MKTIVNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGA
Ga0209084_101110210	3300027749	Freshwater Lake	MKTVLNSIWSFLEAFGQARVAASLARQGRIKESKAVYGA
Ga0209084_11022142	3300027749	Freshwater Lake	MKSVLNTIWSILLSFGEARHAASLARQGRVAEAKAVYGA
Ga0209444_101735794	3300027756	Freshwater Lake	ILNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGN
Ga0209296_100099112	3300027759	Freshwater Lake	MKTILNSIWSFLESFAQARAAASLARQGRIEEAKAVYGS
Ga0209296_10070465	3300027759	Freshwater Lake	MKTILNSIWSVLESFAQARAAAVLVRQGRIEEAKAVYGA
Ga0209296_10079929	3300027759	Freshwater Lake	MKTILNTIWSFLEAFGQARYAASLARQGRTEEAKAVYGS
Ga0209296_10160619	3300027759	Freshwater Lake	MKSVLNTIWSFLEAFGQARAAASLARQGRIAEAKAVYGA
Ga0209296_11638301	3300027759	Freshwater Lake	MKTILNSIWSVLEAFGQARYAASLARQGRVEEAKAIYGS
Ga0209296_12838462	3300027759	Freshwater Lake	MKTIINSIWSFLEAFGQARAAASLARQGRVAEAKAVYGA
Ga0209088_100927832	3300027763	Freshwater Lake	MKTILNSIWSVLEAFGQARAAASLARQGRIAEAKAVYGA
Ga0209088_102815833	3300027763	Freshwater Lake	MKTITNAIWSFLEAFGQARAAASLARQGKIAESKAVYGS
Ga0209088_103432721	3300027763	Freshwater Lake	MKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGA
Ga0209770_1000311011	3300027769	Freshwater Lake	MKNFINSFWSFLEAFGQARYATFLTRQGRIDEAKALYE
Ga0209770_101363702	3300027769	Freshwater Lake	MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYGA
Ga0209770_103162141	3300027769	Freshwater Lake	SMKTILNSIWSFLVAFGEARYAASLARQGRTEEAKAIYNN
Ga0209500_100666905	3300027782	Freshwater Lake	MKTILNSIWSFLEAFGQARVAASLARQGRIKESKAVYGA
Ga0209500_100828263	3300027782	Freshwater Lake	MKTILNSIWSFLEAFGQARAAASLARQGKIAESKAIYGS
Ga0209500_101392573	3300027782	Freshwater Lake	MKTILNSIWSFLEAFAQARAAASLARQGKIAESKAVYGN
Ga0209500_103151352	3300027782	Freshwater Lake	MKTIVNSIWSVLEAFGQARAAASLARQGRIAEAKAVYK
Ga0209246_100183403	3300027785	Freshwater Lake	MKTILNSIWSFLETFGQARVAASLARQGRIEESKAVYNGPA
Ga0209107_100263887	3300027797	Freshwater And Sediment	MKTIVNSIWSFLEAFGQARYAASLARQGRIEESKAVYNGPA
Ga0209107_105266411	3300027797	Freshwater And Sediment	MKTITNAIWSFLESFGQARAAASLARQGRIEEAKAVYRA
Ga0209353_100475032	3300027798	Freshwater Lake	MKTIINSIWSVLEAFGQARVAASLARMGDIEGAKAVYNEPA
Ga0209353_100738404	3300027798	Freshwater Lake	VNSIWSLLEAFGQARAAASLARQGRIEEAKAVYGA
Ga0209550_1000804116	3300027892	Freshwater Lake	MKTILNTIWSWLEAFGQARYAASLARQGRVEESKAVYNGRA
Ga0209400_1000145121	3300027963	Freshwater Lake	MKKVLNAIWLFLVAFGEARYAASLARQGRVAEAKAVYGA
Ga0209400_10097355	3300027963	Freshwater Lake	MKTIINSIWSFLEAFGQARAAASLARQGKIAESKAVYGS
Ga0209400_10858983	3300027963	Freshwater Lake	MKTVLNSIWSFLEAFGQARYAASLVRQGRITEAKAVYGS
Ga0209191_100163216	3300027969	Freshwater Lake	MKTIVNSIWSFLEAFGQARAAASLARQGRFEEAKAVYGA
Ga0209191_10125323	3300027969	Freshwater Lake	MKTILNAIWSFLVAFGEARYAASLARQGKIDKAKAVYGS
Ga0209191_10154502	3300027969	Freshwater Lake	MKTVLNSIWSVLVSFGEARYAASLARQGRIAEAKAIYNN
Ga0209191_10212154	3300027969	Freshwater Lake	MKNFINAIWSFLEAFGQARAAASLARQGRIAEAKAIYGA
Ga0209191_11000522	3300027969	Freshwater Lake	MKTILNSIWSFLEAFGQARTAASLVRQGRIEEAKAVYGS
Ga0209191_12766381	3300027969	Freshwater Lake	KTILNSIWSFLEAFGQARAAASLARQGKIAESKAIYGS
Ga0304728_11821262	3300028393	Freshwater Lake	MKSVLNTIWSVLVSFGEARYAASLARQGRVAEAKAVYGA
Ga0304730_100442010	3300028394	Freshwater Lake	MKTIINSIWSFLEAFGQARAAASLARQGKIAESKAVYGA
Ga0304730_10246686	3300028394	Freshwater Lake	MKSILNSIWSVLEAFGQARYAASLARQGRTEEAKAVYGA
Ga0315905_100234207	3300032092	Freshwater	MKTILNYIWTVLEAFGQARYAASLARQGRTEEAKAVYGA
Ga0315905_109425492	3300032092	Freshwater	LSMKTIVNSIWSLLEAFGQARAAASLARQGRIEEAKAVYGA
Ga0334977_0027612_2692_2811	3300033978	Freshwater	MKTILNSIRSFLEAFGQARYAASLARQGRTEEAKAVYGA
Ga0334992_0001335_12549_12668	3300033992	Freshwater	MKTILNSIWSFLEAFGEARAASILARQGRIEEAKAVYRN
Ga0334996_0303347_553_672	3300033994	Freshwater	MKTILNSIWSFLEAFGEARYAASLARQGRTEEAKAVYGA
Ga0335020_0027997_2371_2490	3300034082	Freshwater	MKTIVNSIWSFLEAFAQARAAASLARQGKIAEAKAVYGA
Ga0335020_0038540_437_568	3300034082	Freshwater	MNSILNSILNSIWSVLESFAQARAAAVLARQGRIEEAKAVYGN
Ga0335012_0080428_1480_1599	3300034093	Freshwater	MKTITNAIWSVLEAFGQARVAASLARQGKIEEAKAVYRA
Ga0335029_0300069_49_168	3300034102	Freshwater	MKTILNSIWSFLEAFGQARVAASLARQGRIEEAKAVYRA
Ga0335029_0666560_263_382	3300034102	Freshwater	MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYRA
Ga0335048_0425073_1_105	3300034356	Freshwater	MKTITNAIWSVLEAFGQARVAASLARQGKIEEAKA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F009605

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences