Basic Information | |
---|---|
Family ID | F009365 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 319 |
Average Sequence Length | 43 residues |
Representative Sequence | MTYTLRRLRTALSGLVAEDRPGFKRVDASPARYDDGSWLKPRS |
Number of Associated Samples | 158 |
Number of Associated Scaffolds | 318 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 55.10 % |
% of genes near scaffold ends (potentially truncated) | 25.08 % |
% of genes from short scaffolds (< 2000 bps) | 83.07 % |
Associated GOLD sequencing projects | 147 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (69.906 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.705 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.527 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.962 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.72% β-sheet: 0.00% Coil/Unstructured: 80.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 318 Family Scaffolds |
---|---|---|
PF03734 | YkuD | 9.12 |
PF08220 | HTH_DeoR | 4.40 |
PF02423 | OCD_Mu_crystall | 3.14 |
PF13466 | STAS_2 | 3.14 |
PF13671 | AAA_33 | 1.89 |
PF00903 | Glyoxalase | 1.89 |
PF00563 | EAL | 1.89 |
PF00383 | dCMP_cyt_deam_1 | 1.89 |
PF07885 | Ion_trans_2 | 1.57 |
PF06026 | Rib_5-P_isom_A | 1.57 |
PF02645 | DegV | 1.57 |
PF12229 | PG_binding_4 | 1.26 |
PF00491 | Arginase | 1.26 |
PF01243 | Putative_PNPOx | 1.26 |
PF13520 | AA_permease_2 | 0.94 |
PF13419 | HAD_2 | 0.94 |
PF13551 | HTH_29 | 0.94 |
PF02965 | Met_synt_B12 | 0.94 |
PF01061 | ABC2_membrane | 0.94 |
PF02566 | OsmC | 0.94 |
PF10944 | DUF2630 | 0.94 |
PF00561 | Abhydrolase_1 | 0.94 |
PF00905 | Transpeptidase | 0.63 |
PF09969 | DUF2203 | 0.63 |
PF01156 | IU_nuc_hydro | 0.63 |
PF07690 | MFS_1 | 0.63 |
PF07883 | Cupin_2 | 0.63 |
PF05013 | FGase | 0.63 |
PF00440 | TetR_N | 0.63 |
PF00378 | ECH_1 | 0.63 |
PF13302 | Acetyltransf_3 | 0.63 |
PF12697 | Abhydrolase_6 | 0.63 |
PF08281 | Sigma70_r4_2 | 0.63 |
PF01425 | Amidase | 0.63 |
PF04389 | Peptidase_M28 | 0.63 |
PF01494 | FAD_binding_3 | 0.63 |
PF00196 | GerE | 0.63 |
PF01391 | Collagen | 0.31 |
PF00293 | NUDIX | 0.31 |
PF03717 | PBP_dimer | 0.31 |
PF13649 | Methyltransf_25 | 0.31 |
PF13450 | NAD_binding_8 | 0.31 |
PF16859 | TetR_C_11 | 0.31 |
PF13607 | Succ_CoA_lig | 0.31 |
PF00528 | BPD_transp_1 | 0.31 |
PF07992 | Pyr_redox_2 | 0.31 |
PF10057 | MpsC | 0.31 |
PF04024 | PspC | 0.31 |
PF03167 | UDG | 0.31 |
PF07228 | SpoIIE | 0.31 |
PF00583 | Acetyltransf_1 | 0.31 |
PF13407 | Peripla_BP_4 | 0.31 |
PF12833 | HTH_18 | 0.31 |
PF03061 | 4HBT | 0.31 |
PF16912 | Glu_dehyd_C | 0.31 |
PF13527 | Acetyltransf_9 | 0.31 |
PF00251 | Glyco_hydro_32N | 0.31 |
PF13449 | Phytase-like | 0.31 |
PF00821 | PEPCK_GTP | 0.31 |
PF00990 | GGDEF | 0.31 |
PF00069 | Pkinase | 0.31 |
PF07730 | HisKA_3 | 0.31 |
PF09587 | PGA_cap | 0.31 |
PF00702 | Hydrolase | 0.31 |
PF02322 | Cyt_bd_oxida_II | 0.31 |
PF01266 | DAO | 0.31 |
PF02627 | CMD | 0.31 |
PF00149 | Metallophos | 0.31 |
PF12680 | SnoaL_2 | 0.31 |
PF13439 | Glyco_transf_4 | 0.31 |
PF01740 | STAS | 0.31 |
PF01850 | PIN | 0.31 |
PF00436 | SSB | 0.31 |
PF02803 | Thiolase_C | 0.31 |
PF12836 | HHH_3 | 0.31 |
PF13358 | DDE_3 | 0.31 |
PF03704 | BTAD | 0.31 |
PF02133 | Transp_cyt_pur | 0.31 |
PF09339 | HTH_IclR | 0.31 |
PF02786 | CPSase_L_D2 | 0.31 |
PF02401 | LYTB | 0.31 |
PF01068 | DNA_ligase_A_M | 0.31 |
PF13193 | AMP-binding_C | 0.31 |
PF01545 | Cation_efflux | 0.31 |
PF04237 | YjbR | 0.31 |
PF00188 | CAP | 0.31 |
PF00535 | Glycos_transf_2 | 0.31 |
PF04454 | Linocin_M18 | 0.31 |
PF13549 | ATP-grasp_5 | 0.31 |
PF08669 | GCV_T_C | 0.31 |
PF06974 | WS_DGAT_C | 0.31 |
PF00313 | CSD | 0.31 |
PF12138 | Spherulin4 | 0.31 |
COG ID | Name | Functional Category | % Frequency in 318 Family Scaffolds |
---|---|---|---|
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 9.12 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 9.12 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 3.14 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 1.89 |
COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 1.89 |
COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 1.89 |
COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 1.89 |
COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 1.57 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.26 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 1.26 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.26 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.94 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.94 |
COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 0.94 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.63 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.63 |
COG3741 | N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.63 |
COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.63 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.63 |
COG3931 | Predicted N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.63 |
COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 0.63 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.63 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.31 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.31 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.31 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.31 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.31 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.31 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.31 |
COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.31 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.31 |
COG3507 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.31 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.31 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.31 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.31 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.31 |
COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 0.31 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.31 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.31 |
COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.31 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.31 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.31 |
COG1621 | Sucrose-6-phosphate hydrolase SacC, GH32 family | Carbohydrate transport and metabolism [G] | 0.31 |
COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.31 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.31 |
COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.31 |
COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.31 |
COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 0.31 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.31 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 69.91 % |
Unclassified | root | N/A | 29.78 % |
Quinella | genus | Quinella | 0.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000828|JGI12467J12023_1046606 | Not Available | 526 | Open in IMG/M |
3300000833|JGI12273J12029_10159182 | Not Available | 670 | Open in IMG/M |
3300000956|JGI10216J12902_106368443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1675 | Open in IMG/M |
3300000956|JGI10216J12902_107099557 | Not Available | 638 | Open in IMG/M |
3300001205|C688J13580_1067172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 504 | Open in IMG/M |
3300002568|C688J35102_117727252 | Not Available | 502 | Open in IMG/M |
3300002568|C688J35102_118545319 | Not Available | 570 | Open in IMG/M |
3300002568|C688J35102_119707237 | Not Available | 754 | Open in IMG/M |
3300002568|C688J35102_120303558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
3300002568|C688J35102_120349186 | Not Available | 1006 | Open in IMG/M |
3300002568|C688J35102_120535745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1155 | Open in IMG/M |
3300002568|C688J35102_120541852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
3300002568|C688J35102_120659774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1309 | Open in IMG/M |
3300002568|C688J35102_120913597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2268 | Open in IMG/M |
3300003203|JGI25406J46586_10047589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1460 | Open in IMG/M |
3300003373|JGI25407J50210_10169260 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300004006|Ga0055453_10068531 | Not Available | 1001 | Open in IMG/M |
3300004081|Ga0063454_100706529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
3300004081|Ga0063454_101218017 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR27 | 624 | Open in IMG/M |
3300004081|Ga0063454_102059868 | Not Available | 506 | Open in IMG/M |
3300004153|Ga0063455_100831098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
3300004153|Ga0063455_101330861 | Not Available | 549 | Open in IMG/M |
3300004479|Ga0062595_102587260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 508 | Open in IMG/M |
3300004799|Ga0058863_10077694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 981 | Open in IMG/M |
3300005327|Ga0070658_11723816 | Not Available | 542 | Open in IMG/M |
3300005329|Ga0070683_101474126 | Not Available | 654 | Open in IMG/M |
3300005332|Ga0066388_103985278 | Not Available | 753 | Open in IMG/M |
3300005336|Ga0070680_100858201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
3300005338|Ga0068868_100516438 | Not Available | 1048 | Open in IMG/M |
3300005339|Ga0070660_100307765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1300 | Open in IMG/M |
3300005343|Ga0070687_100938197 | Not Available | 623 | Open in IMG/M |
3300005353|Ga0070669_101347954 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR27 | 618 | Open in IMG/M |
3300005367|Ga0070667_100938540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 806 | Open in IMG/M |
3300005436|Ga0070713_101771206 | Not Available | 599 | Open in IMG/M |
3300005440|Ga0070705_100799394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
3300005441|Ga0070700_100151863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1585 | Open in IMG/M |
3300005456|Ga0070678_102048327 | Not Available | 542 | Open in IMG/M |
3300005535|Ga0070684_101276494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 691 | Open in IMG/M |
3300005562|Ga0058697_10756548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
3300005577|Ga0068857_102140691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 549 | Open in IMG/M |
3300005577|Ga0068857_102301163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
3300005615|Ga0070702_100637311 | Not Available | 804 | Open in IMG/M |
3300005718|Ga0068866_11287088 | Not Available | 531 | Open in IMG/M |
3300005937|Ga0081455_10674876 | Not Available | 662 | Open in IMG/M |
3300005937|Ga0081455_10754065 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005981|Ga0081538_10048485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2589 | Open in IMG/M |
3300005981|Ga0081538_10197613 | Not Available | 832 | Open in IMG/M |
3300005985|Ga0081539_10209770 | Not Available | 893 | Open in IMG/M |
3300006169|Ga0082029_1253334 | Not Available | 500 | Open in IMG/M |
3300006169|Ga0082029_1701257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 750 | Open in IMG/M |
3300006358|Ga0068871_100886592 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR27 | 826 | Open in IMG/M |
3300006635|Ga0075526_1017677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 513 | Open in IMG/M |
3300006755|Ga0079222_12114052 | Not Available | 557 | Open in IMG/M |
3300006846|Ga0075430_101440803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 566 | Open in IMG/M |
3300006876|Ga0079217_11544703 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300006881|Ga0068865_100333958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1223 | Open in IMG/M |
3300006881|Ga0068865_100480917 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300006881|Ga0068865_101019202 | Not Available | 726 | Open in IMG/M |
3300006918|Ga0079216_11169586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 615 | Open in IMG/M |
3300007004|Ga0079218_11973172 | Not Available | 665 | Open in IMG/M |
3300007004|Ga0079218_12058961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
3300007004|Ga0079218_12594106 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300007790|Ga0105679_10035812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1052 | Open in IMG/M |
3300009094|Ga0111539_10621521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1258 | Open in IMG/M |
3300009094|Ga0111539_10930232 | Not Available | 1011 | Open in IMG/M |
3300009094|Ga0111539_11133368 | Not Available | 909 | Open in IMG/M |
3300009137|Ga0066709_102789567 | Not Available | 649 | Open in IMG/M |
3300009147|Ga0114129_10367328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1903 | Open in IMG/M |
3300009147|Ga0114129_13321490 | Not Available | 520 | Open in IMG/M |
3300009148|Ga0105243_10502684 | Not Available | 1149 | Open in IMG/M |
3300009148|Ga0105243_11099522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
3300009148|Ga0105243_11173381 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300009156|Ga0111538_10342422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1892 | Open in IMG/M |
3300009156|Ga0111538_12271260 | Not Available | 681 | Open in IMG/M |
3300009156|Ga0111538_12740004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
3300009156|Ga0111538_12871679 | Not Available | 603 | Open in IMG/M |
3300009162|Ga0075423_12354520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 580 | Open in IMG/M |
3300009177|Ga0105248_12612062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
3300009553|Ga0105249_12415979 | Not Available | 598 | Open in IMG/M |
3300009553|Ga0105249_13098982 | Not Available | 534 | Open in IMG/M |
3300009789|Ga0126307_10000075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 54310 | Open in IMG/M |
3300009789|Ga0126307_10012357 | All Organisms → cellular organisms → Bacteria | 6260 | Open in IMG/M |
3300009789|Ga0126307_10024618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4586 | Open in IMG/M |
3300009789|Ga0126307_10079683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2584 | Open in IMG/M |
3300009789|Ga0126307_10108582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2203 | Open in IMG/M |
3300009789|Ga0126307_10483298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 999 | Open in IMG/M |
3300009840|Ga0126313_10095231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2180 | Open in IMG/M |
3300009840|Ga0126313_10102304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium → unclassified Cryobacterium → Cryobacterium sp. SO1 | 2109 | Open in IMG/M |
3300009840|Ga0126313_10141635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1808 | Open in IMG/M |
3300009840|Ga0126313_10461521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
3300009840|Ga0126313_10463258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium | 1012 | Open in IMG/M |
3300009840|Ga0126313_10735045 | Not Available | 800 | Open in IMG/M |
3300009840|Ga0126313_11095651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
3300009840|Ga0126313_11096127 | Not Available | 654 | Open in IMG/M |
3300009840|Ga0126313_11165994 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300010036|Ga0126305_10419601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 884 | Open in IMG/M |
3300010037|Ga0126304_10630232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 723 | Open in IMG/M |
3300010037|Ga0126304_11049752 | Not Available | 556 | Open in IMG/M |
3300010038|Ga0126315_10000805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11250 | Open in IMG/M |
3300010038|Ga0126315_10057583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2128 | Open in IMG/M |
3300010038|Ga0126315_10272707 | Not Available | 1038 | Open in IMG/M |
3300010038|Ga0126315_10957653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 571 | Open in IMG/M |
3300010039|Ga0126309_10006230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4670 | Open in IMG/M |
3300010039|Ga0126309_10010286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3818 | Open in IMG/M |
3300010039|Ga0126309_10374671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 845 | Open in IMG/M |
3300010039|Ga0126309_10658427 | Not Available | 667 | Open in IMG/M |
3300010039|Ga0126309_10900686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium → unclassified Cryobacterium → Cryobacterium sp. SO1 | 586 | Open in IMG/M |
3300010039|Ga0126309_11152831 | Not Available | 530 | Open in IMG/M |
3300010040|Ga0126308_10447025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 868 | Open in IMG/M |
3300010040|Ga0126308_10621360 | Not Available | 738 | Open in IMG/M |
3300010041|Ga0126312_10284628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1164 | Open in IMG/M |
3300010041|Ga0126312_10700012 | Not Available | 731 | Open in IMG/M |
3300010041|Ga0126312_10747005 | Not Available | 708 | Open in IMG/M |
3300010042|Ga0126314_10063002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2443 | Open in IMG/M |
3300010042|Ga0126314_10090816 | Not Available | 2060 | Open in IMG/M |
3300010042|Ga0126314_10159704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1574 | Open in IMG/M |
3300010042|Ga0126314_10384091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1010 | Open in IMG/M |
3300010042|Ga0126314_10529777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 856 | Open in IMG/M |
3300010044|Ga0126310_10402419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
3300010044|Ga0126310_11606625 | Not Available | 537 | Open in IMG/M |
3300010045|Ga0126311_10083846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2149 | Open in IMG/M |
3300010045|Ga0126311_10421400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1031 | Open in IMG/M |
3300010045|Ga0126311_10813547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 754 | Open in IMG/M |
3300010045|Ga0126311_10917826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
3300010045|Ga0126311_11634732 | Not Available | 543 | Open in IMG/M |
3300010166|Ga0126306_10003742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8888 | Open in IMG/M |
3300010166|Ga0126306_10067436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2519 | Open in IMG/M |
3300010166|Ga0126306_10121380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1913 | Open in IMG/M |
3300010166|Ga0126306_10222185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1433 | Open in IMG/M |
3300010166|Ga0126306_11019476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 675 | Open in IMG/M |
3300010399|Ga0134127_13372951 | Not Available | 523 | Open in IMG/M |
3300010400|Ga0134122_10687799 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300011332|Ga0126317_10444984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 566 | Open in IMG/M |
3300011400|Ga0137312_1024911 | Not Available | 877 | Open in IMG/M |
3300012042|Ga0136627_1001984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 8172 | Open in IMG/M |
3300012046|Ga0136634_10161658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 875 | Open in IMG/M |
3300012093|Ga0136632_10049977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1925 | Open in IMG/M |
3300012094|Ga0136638_10208056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 893 | Open in IMG/M |
3300012212|Ga0150985_103395448 | Not Available | 617 | Open in IMG/M |
3300012212|Ga0150985_104535562 | Not Available | 551 | Open in IMG/M |
3300012212|Ga0150985_106562239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1339 | Open in IMG/M |
3300012212|Ga0150985_108950831 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR27 | 555 | Open in IMG/M |
3300012212|Ga0150985_110492783 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300012212|Ga0150985_111427695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix espanaensis | 878 | Open in IMG/M |
3300012212|Ga0150985_111427695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix espanaensis | 878 | Open in IMG/M |
3300012212|Ga0150985_114621837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
3300012212|Ga0150985_120602780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
3300012212|Ga0150985_121430172 | Not Available | 626 | Open in IMG/M |
3300012212|Ga0150985_121489120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1264 | Open in IMG/M |
3300012397|Ga0134056_1059686 | Not Available | 540 | Open in IMG/M |
3300012469|Ga0150984_106788214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 509 | Open in IMG/M |
3300012469|Ga0150984_115759108 | Not Available | 594 | Open in IMG/M |
3300012512|Ga0157327_1058801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
3300012678|Ga0136615_10027488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2930 | Open in IMG/M |
3300012684|Ga0136614_10006343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7990 | Open in IMG/M |
3300012684|Ga0136614_10445527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 940 | Open in IMG/M |
3300012897|Ga0157285_10293137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
3300012911|Ga0157301_10357697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 552 | Open in IMG/M |
3300012938|Ga0162651_100030209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 789 | Open in IMG/M |
3300012951|Ga0164300_10051488 | Not Available | 1629 | Open in IMG/M |
3300012958|Ga0164299_10200118 | Not Available | 1154 | Open in IMG/M |
3300012985|Ga0164308_11106878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 710 | Open in IMG/M |
3300014325|Ga0163163_13013001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
3300014745|Ga0157377_10095238 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1764 | Open in IMG/M |
3300017695|Ga0180121_10238602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
3300017787|Ga0183260_10431529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 870 | Open in IMG/M |
3300017789|Ga0136617_10000148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 51578 | Open in IMG/M |
3300017965|Ga0190266_10434797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 741 | Open in IMG/M |
3300017965|Ga0190266_10436593 | Not Available | 740 | Open in IMG/M |
3300017965|Ga0190266_10883428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
3300017965|Ga0190266_11374797 | Not Available | 501 | Open in IMG/M |
3300018066|Ga0184617_1279000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 503 | Open in IMG/M |
3300018422|Ga0190265_10034643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 4240 | Open in IMG/M |
3300018422|Ga0190265_10065175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3259 | Open in IMG/M |
3300018422|Ga0190265_10070076 | All Organisms → cellular organisms → Bacteria | 3160 | Open in IMG/M |
3300018422|Ga0190265_10078884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3005 | Open in IMG/M |
3300018422|Ga0190265_10084194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2923 | Open in IMG/M |
3300018422|Ga0190265_10109541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2611 | Open in IMG/M |
3300018422|Ga0190265_10114501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2561 | Open in IMG/M |
3300018422|Ga0190265_10135039 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
3300018422|Ga0190265_10137151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes lobatus | 2368 | Open in IMG/M |
3300018422|Ga0190265_10200067 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
3300018422|Ga0190265_10423218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1433 | Open in IMG/M |
3300018422|Ga0190265_10503347 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
3300018422|Ga0190265_10717756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae | 1121 | Open in IMG/M |
3300018422|Ga0190265_10884936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1016 | Open in IMG/M |
3300018422|Ga0190265_12440596 | Quinella → unclassified Quinella → Quinella sp. 1Q7 | 622 | Open in IMG/M |
3300018422|Ga0190265_12507688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 614 | Open in IMG/M |
3300018422|Ga0190265_12790787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
3300018422|Ga0190265_13354764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 534 | Open in IMG/M |
3300018429|Ga0190272_10207698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1423 | Open in IMG/M |
3300018429|Ga0190272_10446578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1076 | Open in IMG/M |
3300018429|Ga0190272_11124712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 764 | Open in IMG/M |
3300018429|Ga0190272_11712105 | Not Available | 651 | Open in IMG/M |
3300018429|Ga0190272_12020237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
3300018432|Ga0190275_10004611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9912 | Open in IMG/M |
3300018432|Ga0190275_10009110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 7292 | Open in IMG/M |
3300018432|Ga0190275_10019729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5208 | Open in IMG/M |
3300018432|Ga0190275_10122901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2344 | Open in IMG/M |
3300018432|Ga0190275_10221926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1804 | Open in IMG/M |
3300018432|Ga0190275_10258373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1685 | Open in IMG/M |
3300018432|Ga0190275_10771518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1023 | Open in IMG/M |
3300018432|Ga0190275_11221475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
3300018432|Ga0190275_12016547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 656 | Open in IMG/M |
3300018432|Ga0190275_12131620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 639 | Open in IMG/M |
3300018432|Ga0190275_12345300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 612 | Open in IMG/M |
3300018432|Ga0190275_12665450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
3300018466|Ga0190268_10001885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4082 | Open in IMG/M |
3300018466|Ga0190268_10450680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
3300018466|Ga0190268_11239908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
3300018466|Ga0190268_11437215 | Not Available | 594 | Open in IMG/M |
3300018466|Ga0190268_12239996 | Not Available | 513 | Open in IMG/M |
3300018469|Ga0190270_10266937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1501 | Open in IMG/M |
3300018469|Ga0190270_10616404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1060 | Open in IMG/M |
3300018469|Ga0190270_10711294 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300018469|Ga0190270_10770507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 965 | Open in IMG/M |
3300018469|Ga0190270_11352254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
3300018469|Ga0190270_11600047 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300018469|Ga0190270_11756936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes lobatus | 675 | Open in IMG/M |
3300018469|Ga0190270_12130264 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300018476|Ga0190274_10111261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2209 | Open in IMG/M |
3300018476|Ga0190274_10875074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium → unclassified Cryobacterium → Cryobacterium sp. SO1 | 963 | Open in IMG/M |
3300018476|Ga0190274_12486540 | Not Available | 615 | Open in IMG/M |
3300018481|Ga0190271_10147499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2265 | Open in IMG/M |
3300018481|Ga0190271_10549440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes lobatus | 1270 | Open in IMG/M |
3300018481|Ga0190271_10884320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1018 | Open in IMG/M |
3300018481|Ga0190271_11725447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 739 | Open in IMG/M |
3300018918|Ga0193616_1113706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 755 | Open in IMG/M |
3300018920|Ga0190273_10145282 | Not Available | 1408 | Open in IMG/M |
3300018920|Ga0190273_11922038 | Not Available | 544 | Open in IMG/M |
3300018933|Ga0193614_1196529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
3300018984|Ga0193605_1176957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 633 | Open in IMG/M |
3300019233|Ga0184645_1337217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
3300019279|Ga0184642_1685531 | Not Available | 671 | Open in IMG/M |
3300019356|Ga0173481_10483537 | Not Available | 627 | Open in IMG/M |
3300019377|Ga0190264_10267682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1006 | Open in IMG/M |
3300019377|Ga0190264_10360410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 919 | Open in IMG/M |
3300019377|Ga0190264_11683448 | Not Available | 563 | Open in IMG/M |
3300019767|Ga0190267_10220397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 909 | Open in IMG/M |
3300019767|Ga0190267_10959126 | Not Available | 594 | Open in IMG/M |
3300019889|Ga0193743_1046636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. KC06 | 1914 | Open in IMG/M |
3300020076|Ga0206355_1675378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1335 | Open in IMG/M |
3300020181|Ga0196958_10007297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3078 | Open in IMG/M |
3300022195|Ga0222625_1622240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
3300024430|Ga0196962_10000869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 10816 | Open in IMG/M |
3300024430|Ga0196962_10005050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 4113 | Open in IMG/M |
3300024430|Ga0196962_10202403 | Not Available | 639 | Open in IMG/M |
3300024430|Ga0196962_10247077 | Not Available | 580 | Open in IMG/M |
3300025571|Ga0207874_1023364 | Not Available | 2086 | Open in IMG/M |
3300025899|Ga0207642_10099661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1455 | Open in IMG/M |
3300025899|Ga0207642_10304152 | Not Available | 925 | Open in IMG/M |
3300025899|Ga0207642_10335044 | Not Available | 888 | Open in IMG/M |
3300025908|Ga0207643_10463416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
3300025908|Ga0207643_10642275 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300025909|Ga0207705_11339770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 546 | Open in IMG/M |
3300025920|Ga0207649_10204611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1397 | Open in IMG/M |
3300025920|Ga0207649_10787891 | Not Available | 741 | Open in IMG/M |
3300025927|Ga0207687_10269003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1362 | Open in IMG/M |
3300025927|Ga0207687_10634594 | Not Available | 903 | Open in IMG/M |
3300025932|Ga0207690_11290228 | Not Available | 610 | Open in IMG/M |
3300025933|Ga0207706_11691778 | Not Available | 510 | Open in IMG/M |
3300025938|Ga0207704_10396819 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300025944|Ga0207661_11513988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 615 | Open in IMG/M |
3300025972|Ga0207668_11805063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
3300026075|Ga0207708_11828906 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300026118|Ga0207675_100630242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1077 | Open in IMG/M |
3300026118|Ga0207675_100772908 | Not Available | 973 | Open in IMG/M |
3300026118|Ga0207675_101883373 | Not Available | 617 | Open in IMG/M |
3300026142|Ga0207698_12446007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
3300027618|Ga0208736_1090140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 740 | Open in IMG/M |
3300027636|Ga0214469_1009710 | All Organisms → cellular organisms → Bacteria | 3414 | Open in IMG/M |
3300027907|Ga0207428_10633237 | Not Available | 768 | Open in IMG/M |
3300028381|Ga0268264_10673881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1025 | Open in IMG/M |
3300028587|Ga0247828_10447203 | Not Available | 756 | Open in IMG/M |
3300028589|Ga0247818_10661521 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300028705|Ga0307276_10045585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
3300028714|Ga0307309_10046240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 936 | Open in IMG/M |
3300028799|Ga0307284_10054568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1414 | Open in IMG/M |
3300028802|Ga0307503_10386936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 727 | Open in IMG/M |
3300028812|Ga0247825_11208784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
3300028875|Ga0307289_10347910 | Not Available | 610 | Open in IMG/M |
3300028889|Ga0247827_11132657 | Not Available | 539 | Open in IMG/M |
3300030006|Ga0299907_10104501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2325 | Open in IMG/M |
3300030336|Ga0247826_10261769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1220 | Open in IMG/M |
3300030336|Ga0247826_10383438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1034 | Open in IMG/M |
3300030981|Ga0102770_11266234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 670 | Open in IMG/M |
3300031228|Ga0299914_11135703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
3300031229|Ga0299913_10010858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8108 | Open in IMG/M |
3300031229|Ga0299913_10139453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2389 | Open in IMG/M |
3300031229|Ga0299913_10561039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1126 | Open in IMG/M |
3300031450|Ga0272433_10102827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1848 | Open in IMG/M |
3300031455|Ga0307505_10393357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 659 | Open in IMG/M |
3300031473|Ga0272434_1031221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 4660 | Open in IMG/M |
3300031731|Ga0307405_10179061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1520 | Open in IMG/M |
3300031731|Ga0307405_11518609 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300031824|Ga0307413_10170159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1541 | Open in IMG/M |
3300031824|Ga0307413_10848207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes lobatus | 772 | Open in IMG/M |
3300031824|Ga0307413_11029365 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300031901|Ga0307406_11550997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
3300031903|Ga0307407_10935446 | Not Available | 667 | Open in IMG/M |
3300031911|Ga0307412_11762378 | Not Available | 569 | Open in IMG/M |
3300031938|Ga0308175_100283258 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
3300031938|Ga0308175_102213497 | Not Available | 616 | Open in IMG/M |
3300031938|Ga0308175_102313416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 602 | Open in IMG/M |
3300031995|Ga0307409_100774147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 965 | Open in IMG/M |
3300031995|Ga0307409_101751435 | Not Available | 650 | Open in IMG/M |
3300031995|Ga0307409_101815396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
3300031995|Ga0307409_102952222 | Not Available | 502 | Open in IMG/M |
3300032002|Ga0307416_100461920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1325 | Open in IMG/M |
3300032002|Ga0307416_100529824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1248 | Open in IMG/M |
3300032002|Ga0307416_102480169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 617 | Open in IMG/M |
3300032005|Ga0307411_10349627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1205 | Open in IMG/M |
3300032074|Ga0308173_11256221 | Not Available | 693 | Open in IMG/M |
3300034173|Ga0334925_008157 | Not Available | 2390 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.71% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 15.67% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.02% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.70% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.08% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.45% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.13% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 2.19% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.19% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.88% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.57% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.57% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.25% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.25% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.25% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.94% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.31% |
Polar Desert | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert | 0.31% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.31% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.31% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.31% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.31% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.31% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.31% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.31% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.31% |
Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.31% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.31% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.31% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.31% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.31% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.31% |
Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 0.31% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.63% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.63% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.63% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.63% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000750 | Soil microbial communities from Moab, Utah, sample - Soil Crust Dry out, 3 days (biological replicate A) D5A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300000828 | Soil microbial communities from Moab, Utah, sample - Soil Crust Dry out, 3 days (biological replicate C) D5C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300000833 | Soil microbial communities from Moab, Utah, sample - Soil Crust Prior wet up (biological replicate C) 0C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006635 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-three | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
3300012042 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06) | Environmental | Open in IMG/M |
3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
3300012678 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06) | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018918 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 0 min after wetting v1 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300018933 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 42 hrs v1 | Environmental | Open in IMG/M |
3300018984 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 9 hrs after wetting v1 | Environmental | Open in IMG/M |
3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300020181 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
3300025571 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-1-D (SPAdes) | Engineered | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027618 | Polar desert microbial communities from Antarctic Dry Valleys - UQ255 (SPAdes) | Environmental | Open in IMG/M |
3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030981 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031473 | Rock endolithic microbial communities from Victoria Land, Antarctica - Trio Nunatak nord | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300034173 | Biocrust microbial communities from Mojave Desert, California, United States - 21HNC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12272J11983_10377431 | 3300000750 | Soil | PPPHERDDMSLKLTRLRQSLSDLVAEDRRDFKRIDVSPALYDDGSWLKPRN* |
JGI12467J12023_10466061 | 3300000828 | Soil | ASQKEKTVMPSTLQRIGRGLTGLVPEDRPAFKRIDASPVRYDSGAWLKPRR* |
JGI12273J12029_100239591 | 3300000833 | Soil | NPPPHERDDMSLKLTRLRQSLSDLVAEDRRDFKRIDVSPALYDDGSWLKPRN* |
JGI12273J12029_101591821 | 3300000833 | Soil | QKEKTVMPSTLQRIGRGLTGLVPEDRPAFKRIDASPVRYDSGAWLKPRR* |
JGI10216J12902_1063684432 | 3300000956 | Soil | RNDMTTTLRRIYRALSGVVAEDRPGFKRLDVSPARGDDESWFKPRQ* |
JGI10216J12902_1070995572 | 3300000956 | Soil | MSSFARRVRRVASHLVAEDRPHFKRVDASPARYDDGSWLK* |
C688J13580_10671722 | 3300001205 | Soil | MVTMNTTLRRVRSAFSGFVAEDRPSFKRLDVSSARYDDGAWLKAHH* |
C688J35102_1177272521 | 3300002568 | Soil | MLRRIRRALSSAVAEDRPAFKRIDASAARYDDGAWLTDKH* |
C688J35102_1185453192 | 3300002568 | Soil | MINTFRRLRRTFSELVAEDRPGFKRLDASAARYDDGSWLGPRR* |
C688J35102_1197072373 | 3300002568 | Soil | MTAFVSRVRRAASHLVAEDRSHFKRVDASRAVYDDGSWLK* |
C688J35102_1203035581 | 3300002568 | Soil | MMKSLRRMRATLAGLAAEDRPGFKRLDASPAQPDDGTWLMTC* |
C688J35102_1203491863 | 3300002568 | Soil | MSNALRTFSQAMSGLLAEDRPAFKRIDASSARYDDGSWLRPRPAA* |
C688J35102_1205357452 | 3300002568 | Soil | MLRRIRRALSSAVAEDRPAFKRIDASPARYDDGSWLTDKH* |
C688J35102_1205418522 | 3300002568 | Soil | MSDKLRRIRTALSNLVAEDRPEFKRIDASRARPDDGSWLKPQH* |
C688J35102_1206597743 | 3300002568 | Soil | MTTFARLRRVASHLVAEDRAHFKRIDASPAAYDDGSWLK* |
C688J35102_1209135975 | 3300002568 | Soil | MNNALRSLRYAVAGLVAEDRPAFKRIDASRARYDDGSWLRPRPNA* |
JGI25406J46586_100475892 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MTTKLKSLRLAMSGLVAEDRPAFKRLDASSVKYDDGSWLTRP* |
JGI25407J50210_101692601 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MTINRIRRAFSGLVAEDRDGFKRVDASPVRADDASWLTARRYNA* |
Ga0055453_100685313 | 3300004006 | Natural And Restored Wetlands | MSNALTTLRHAVAGLVAEDRPGFKRVDASRARYDDGSWLR |
Ga0063454_1007065291 | 3300004081 | Soil | MNRPLRRLRRTVGSLAAEDRPAFKRIDASPARYDDGSWLKPHH* |
Ga0063454_1012180171 | 3300004081 | Soil | DMSNALRTFSQAMSGLLAEDRPAFKRIDASSARYDDGSWLRPRPTA* |
Ga0063454_1020598681 | 3300004081 | Soil | MNSVLRRLRRSASDLAVDTRPGFARIDASPARYDDGSWLKPNH* |
Ga0063455_1008310981 | 3300004153 | Soil | MNRPLRRLRRTVGNLAADDRPAFRRIDASPARYDDGSWLKPHH* |
Ga0063455_1013308612 | 3300004153 | Soil | MSNALRSLRYAVAGLVAEDRPAFKRIDASRARYDDGSWLRPRPNA* |
Ga0062595_1025872602 | 3300004479 | Soil | MTSPLHRFRVALSGLVAEDRPGFKRIDVSPARPDDGAWLKPRR* |
Ga0058863_100776942 | 3300004799 | Host-Associated | MNSLRRIRLALSDLVAEDRPAFKRIDVSPALGDDGRWLRSTR* |
Ga0070658_117238161 | 3300005327 | Corn Rhizosphere | TICDMSNTLRSIRYAVAGLVAEDRPAFKRIDASAARYDDGSWLRPRPAA* |
Ga0070683_1014741262 | 3300005329 | Corn Rhizosphere | MNSLRRIRLALSDLVAEDRPAFKRIDASPALGDDGRWLRSTR* |
Ga0066388_1039852781 | 3300005332 | Tropical Forest Soil | MSNALRTFRSAVTGLVAEDRPGFKRIDASSARYDDGSWLRPRPVA* |
Ga0070680_1008582012 | 3300005336 | Corn Rhizosphere | MSNTLRNIGRAVSGLIAEDRPAFKRIDPSSARYDDGSWLKPRPVG* |
Ga0068868_1005164381 | 3300005338 | Miscanthus Rhizosphere | MTTLRRFRSALSSLATEDRPGFKRVDASPARYDDGAWLTPRH* |
Ga0070660_1003077652 | 3300005339 | Corn Rhizosphere | MTTLRRFRSALTSLATEDRPGFKRVDASPARYDDGAWLTPRH* |
Ga0070687_1009381971 | 3300005343 | Switchgrass Rhizosphere | MSNTLRSLRHAVAGLVAEDRPAFKRIDASSARYDDGSWLRPRPHA* |
Ga0070669_1013479541 | 3300005353 | Switchgrass Rhizosphere | DMSNTLRSIRYAVAGLVAEDRPAFKRIDASAARYDDGSWLRPRPAA* |
Ga0070667_1009385402 | 3300005367 | Switchgrass Rhizosphere | NTLRSLRHAVAGLVAEDRPAFKRIDASSARYDDGSWLRPRPHA* |
Ga0070713_1017712062 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDRLRRIRNALGNLVAEDRPEFKRIDASPALPDDGSWLKSQH* |
Ga0070705_1007993942 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLVSFKPPPKEPAMTTLRRFRSALSSLASEDRPGFKRVDASPARYDDGAWLTPRH* |
Ga0070700_1001518633 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNTLRSIRYAVAGLVAEDRPAFKRIDASAARYDDGSWLRPRPAA* |
Ga0070678_1020483271 | 3300005456 | Miscanthus Rhizosphere | MDAMNNTLRRARSALSGLVAEDRRDFKRLDVSSARYDDGSWLKP |
Ga0070684_1012764942 | 3300005535 | Corn Rhizosphere | MNSRLSRLRRTVGNLVAEDRPGFKRVDVSPARYDDGSWLK* |
Ga0058697_107565482 | 3300005562 | Agave | MTTKLNSIRRIVSGLVAEDRTGFKRIDASVAYDDGSWLKRQ* |
Ga0068857_1021406912 | 3300005577 | Corn Rhizosphere | MNSTLRRLRRTVGNLVAEDRPGFKRVDVSPARYDDGSWLK* |
Ga0068857_1023011631 | 3300005577 | Corn Rhizosphere | MSNMLRRFRNTLVLRGAEDRPEFKRIDASPALYDDGSW |
Ga0070702_1006373111 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAMNNTLRRARSALSGLVAEDRRDFKRLDVSSARYDDGAWLKAHH* |
Ga0068866_112870881 | 3300005718 | Miscanthus Rhizosphere | PKEPAMTTLRRFRSALTSLATEDRPGFKRVDASPARYDDGAWLTPRH* |
Ga0081455_106748762 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTMNRLRRAISGLVAEDRDGFKRVDASPVRPDDASWLATRRYSA* |
Ga0081455_107540652 | 3300005937 | Tabebuia Heterophylla Rhizosphere | RLLSDLVAEDRAGFKRVDASAAQYDDGAWLTRRN* |
Ga0081538_100484852 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MRAHDCDHHHMTLNRIRRALSGLVAEDRDGFKRIDASPARPDDASWFAARRYSA* |
Ga0081538_101976132 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MTMNRLRRAFSGLVAEDRPGFKRLDASPVRADDASWLAHRRYNA* |
Ga0081539_102097701 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MTTKLNSLRRAMSGLVAEDRPAFKRLDASSVKYDDGSWLTRR* |
Ga0082029_12533342 | 3300006169 | Termite Nest | MSRLRRLGRTLSDLVAEDRDGFKRVDASNAPLYDDGTWSKATKR* |
Ga0082029_17012572 | 3300006169 | Termite Nest | MSSRLRRLGRTLSDLVAEDRDGFKRVDASSAPAYDDGSWLKPRR* |
Ga0068871_1008865922 | 3300006358 | Miscanthus Rhizosphere | MRNTLRRIRYAVAGLVAEDRPAFKRIDASAARYDDGSWLRPRPAA* |
Ga0075526_10176772 | 3300006635 | Arctic Peat Soil | MNRTLRRLRRTVGNLVAEDRPGFKRVDASPARYDDGSWLK* |
Ga0079222_121140521 | 3300006755 | Agricultural Soil | MSNAFRTIGRAVSGLIAEDRPAFKRIDASSARYDDGRWLKP |
Ga0075430_1014408032 | 3300006846 | Populus Rhizosphere | MTMKTLRRAFSGLIAEDRPGFKRIDASPVRADDASWLAPRRYNA* |
Ga0079217_115447032 | 3300006876 | Agricultural Soil | MTNALRRFRHVVTQLGTDSRRDFKRVDASPALYDDGSWLTPKPA* |
Ga0068865_1003339582 | 3300006881 | Miscanthus Rhizosphere | MSNKLRSIHYAVAGLVAEDRPAFKRIDASAARYDDGSWLRPRPAA* |
Ga0068865_1004809171 | 3300006881 | Miscanthus Rhizosphere | PQEASPMLRRIRRALSSAVAEDRPAFKRIDASPARYDDGSWLTDKH* |
Ga0068865_1010192023 | 3300006881 | Miscanthus Rhizosphere | MDAMNNTLRRARSALSGLVAEDRRDFKRLDVSSARYDDGSWL |
Ga0079216_111695861 | 3300006918 | Agricultural Soil | MPNIMRRVSRAVSGLVAEDRPAFKRIDASPAKPDDGSWLREGR* |
Ga0079218_119731721 | 3300007004 | Agricultural Soil | MFLHRIRKALAELPAEDRPGFKRIDASNARPDNGAWLHLR* |
Ga0079218_120589612 | 3300007004 | Agricultural Soil | MNLNSLRRAVSGLVAEDRPGFKRIDTSPARADDTSWLAQRRYNA* |
Ga0079218_125941062 | 3300007004 | Agricultural Soil | MTMNRIRRAFSGLVAEDRDGFKRVDASPVRPDDAAWLATRRYSA* |
Ga0105679_100358121 | 3300007790 | Soil | MSRPFRRIARVLSGLAAEDRPGFKRVDASRAVPDDGSWLE |
Ga0111539_106215212 | 3300009094 | Populus Rhizosphere | MINTLRRFRLALSDLIAEDRPDFKRVDVSPARQDDGSWLEAH* |
Ga0111539_109302322 | 3300009094 | Populus Rhizosphere | MLRRIRRALSSVVAEDRPAFKRIDASPARYDDGSWLTDKH* |
Ga0111539_111333681 | 3300009094 | Populus Rhizosphere | MTMNRIRRAFSGLVAEDRDGFKRVDASPVRSDDASWLATRRYSA* |
Ga0066709_1027895672 | 3300009137 | Grasslands Soil | MTYTLRRLRTALSGLVAEDRPGFKRVDASPARYDDGSWLKPRS* |
Ga0114129_103673284 | 3300009147 | Populus Rhizosphere | MTTKLNSLRRAMSGLLAEDRPAFKRIDASSVQYDDGSWLTRR* |
Ga0114129_133214902 | 3300009147 | Populus Rhizosphere | MTLNRLRTALAGLVAEDRPGFKRVDASSARYDDGSWLPRR* |
Ga0105243_105026841 | 3300009148 | Miscanthus Rhizosphere | MDAMNNTLRRARSALSGLVAEDRRDFKRLDVSSARYDDGSWLKPHH* |
Ga0105243_110995221 | 3300009148 | Miscanthus Rhizosphere | RRFRSALTSLATEDRPGFKRVDASPARYDDGAWLTPRH* |
Ga0105243_111733811 | 3300009148 | Miscanthus Rhizosphere | MNNTLRRARSALSGLVAEDRRDFKRLDVSSARYDDGAWLKAHH* |
Ga0111538_103424223 | 3300009156 | Populus Rhizosphere | MKMNRIRTALSSLVAEDRTGFKRVDASPARYDDGAWLTRR* |
Ga0111538_122712602 | 3300009156 | Populus Rhizosphere | RLRRAFSGLVAEDRDGFKRVDASPVRSDDASWLATRRYSA* |
Ga0111538_127400041 | 3300009156 | Populus Rhizosphere | INTLRRFRLALSDLIAEDRPDFKRVDVSPARQDDGSWLEAH* |
Ga0111538_128716793 | 3300009156 | Populus Rhizosphere | FSGLIAEDRPGFKRIDASPVRADDASWLAPRRYNA* |
Ga0075423_123012212 | 3300009162 | Populus Rhizosphere | VIDKPTSRERNAMSNRLRRLGRVLADLVAEDRPEFKRIDASPALPDDGSWLKPKQ* |
Ga0075423_123545201 | 3300009162 | Populus Rhizosphere | AMTTKLNSLRRAMSGLLAEDRPAFKRIDASSVQYDDGSWLTRR* |
Ga0105248_126120621 | 3300009177 | Switchgrass Rhizosphere | LRRARSALSGLVAEDRRDFKRLDVSSARYDDGAWLKAHH* |
Ga0105249_124159791 | 3300009553 | Switchgrass Rhizosphere | MSNTLRSIRYAVAGLVAEDRPAFKRIDASAARYDDGSW |
Ga0105249_130989822 | 3300009553 | Switchgrass Rhizosphere | MSNTLRTIGRAVSGLIAEDRPGFKRIDASSARYDDGSWLKPRPVG* |
Ga0126307_1000007517 | 3300009789 | Serpentine Soil | MTSRLRHIRLAVSSLVAEDRPAFKRIDASPARYDDGAWLKPRPLG* |
Ga0126307_100123572 | 3300009789 | Serpentine Soil | MTEMLRRFRRAVASFAAEDRPEFKRVDASPARYDDGSWLTPRH* |
Ga0126307_100246182 | 3300009789 | Serpentine Soil | MTEILRRFRRAVTSLGAEDRPEFKRVDASPALYDDGSWLTKR* |
Ga0126307_100796833 | 3300009789 | Serpentine Soil | MNRPLRRLRRTVGNLVAEDRPGFKRVDASPALYDDGAWLKKS* |
Ga0126307_101085822 | 3300009789 | Serpentine Soil | MSQLLRRFRRTVAALAAEDRPGFKRVDASPALYDDGSWLERR* |
Ga0126307_104832982 | 3300009789 | Serpentine Soil | MTRIRRTLSGLAAETRPEFKRVDASRAQYDDGSWLKA* |
Ga0126313_100952313 | 3300009840 | Serpentine Soil | MSRLHRLRRTVGSLAAETRPEFKRVDASPALYDDGSWLKSSKS* |
Ga0126313_101023042 | 3300009840 | Serpentine Soil | MTSTLLRLRRAVSNLAAEDRPAFKRVDASPVAYDNGAWLRPLA* |
Ga0126313_101416353 | 3300009840 | Serpentine Soil | MTTGKFRRLRRALSNLPAETRPEFKRVDASPALYDDGSWLK* |
Ga0126313_104615213 | 3300009840 | Serpentine Soil | MNRPLRRLRRTVGSLAAEDRPAFKRIDASSARYDDGSWLKPHH* |
Ga0126313_104632582 | 3300009840 | Serpentine Soil | MTSMFSRLRRSLSDLIPDDRADFKRIDASPARYDDGSWLERAAE* |
Ga0126313_107350452 | 3300009840 | Serpentine Soil | MTSTLRRLSRTFSGLVAEDRDGFKRVDASPARPDDGKWLKTC* |
Ga0126313_110956512 | 3300009840 | Serpentine Soil | MTKLSRLRSSLNGLVAETRPEFKRVDASRAKYDDGSWLKNS* |
Ga0126313_110961272 | 3300009840 | Serpentine Soil | MNRTLSRLRRPVGNLVAEDRPGFKRVDVSPARYDDGAWLK* |
Ga0126313_111659942 | 3300009840 | Serpentine Soil | RAVSELGTEDRPNFKRVDASPALYDDGSWLKPQH* |
Ga0126305_104196012 | 3300010036 | Serpentine Soil | MNHPLRRLRRTVGNLVAEDRPGFKRVDVSPARYDDGSWLKS* |
Ga0126304_106302322 | 3300010037 | Serpentine Soil | MTRIRRTLSGLAAETRPEFKRIDASRAQYDDGSWLKA* |
Ga0126304_110497521 | 3300010037 | Serpentine Soil | MTNMLRRLHRAVVLAGAEGRPDFKRIDASPALYDDGSWLTPRT* |
Ga0126315_100008052 | 3300010038 | Serpentine Soil | MTDMLRRFRRAVASLGVEDRPAFKSVDASPALYDDGSWLTTKK* |
Ga0126315_100575835 | 3300010038 | Serpentine Soil | MPQLLTRFRRTIAALAAEDRPAFKRVDASPALYDDGSWLERR* |
Ga0126315_102727072 | 3300010038 | Serpentine Soil | MKTTLRRFRTALADLVAEDRPAFKRVDAVSRARYDDGSWLNDR* |
Ga0126315_109576531 | 3300010038 | Serpentine Soil | MNSLRRIASILSSLLAEDRPGFKRLDASPASYDSGAWLRPTALA* |
Ga0126309_100062302 | 3300010039 | Serpentine Soil | MNSRLRRLRRTVGNLVAEDRPGFKRVDVSPARYDDGSWLKS* |
Ga0126309_100102865 | 3300010039 | Serpentine Soil | MNYSLRRLRRTVGNLVAEDRPGFKRVDASPALYDDGSWLKS* |
Ga0126309_103746712 | 3300010039 | Serpentine Soil | MSRLHRLRRTVGNLVAEDRPGFKRVDASPALYDDGSWLKSPR* |
Ga0126309_106584272 | 3300010039 | Serpentine Soil | MLRRLRRAVVLLGAEDRPEFKRIDASPALYDDGSWLKSET* |
Ga0126309_109006862 | 3300010039 | Serpentine Soil | MTTTLLRLRRAVSNLAAEDRPAFKRVDASPVAYDNGAWLRPLA* |
Ga0126309_111528311 | 3300010039 | Serpentine Soil | MTTTLRRLARAMAGLVAEDRPAFKRVDVSPARHDDGAWLTGN* |
Ga0126308_104470252 | 3300010040 | Serpentine Soil | MFSRLRTALSSLAAEDRTGFKRIDVSPARYDDGAWLKPRR* |
Ga0126308_106213602 | 3300010040 | Serpentine Soil | MTSLRRIASILSSLLAEDRPGFKRLDASPASYDSGAWLRPTALA* |
Ga0126312_102846283 | 3300010041 | Serpentine Soil | MSHPLRRLRRTVGNLVAEDRPGFKRVDASRALYDDGAWLKQS* |
Ga0126312_107000123 | 3300010041 | Serpentine Soil | MSQTLRRLRRAVSELGTEDRPNFKRVDASPALYDDGSWLKPQH* |
Ga0126312_107470052 | 3300010041 | Serpentine Soil | MSNAFRTIGRAVSGLIAEDRPAFKRIDTSSARYDDGSWLRPRPVG* |
Ga0126314_100630023 | 3300010042 | Serpentine Soil | MSQLLSRFRRTVASLAVEDRPGFKRVDASPALYDDGSWLERR* |
Ga0126314_100908161 | 3300010042 | Serpentine Soil | SQIGPKMTDMLRRFRRAVASLGVEDRPAFKSVDASPALYDDGSWLTTKK* |
Ga0126314_101597042 | 3300010042 | Serpentine Soil | MNRPLRRLRRTVGNLVAEDRPGFKRVDASPALYDDGSWLKPSN* |
Ga0126314_103840911 | 3300010042 | Serpentine Soil | NRSLRTLRRTVASLPAEDRSGFKRIDASPALYDDGSWLKPNH* |
Ga0126314_105297772 | 3300010042 | Serpentine Soil | MSRLHRLRRTVGSLVAETRPEFKRIDASPARYDDGSWLKSPQS* |
Ga0126310_104024193 | 3300010044 | Serpentine Soil | MNRPLRHLRRTVGAIAAEDRPAFKRIDASPARYDDGSWLKPHH* |
Ga0126310_116066251 | 3300010044 | Serpentine Soil | MSHPLRRLRRTVGNLVAEDRPGFKRVDASPALYDDGAWLKQS* |
Ga0126311_100838464 | 3300010045 | Serpentine Soil | MNRPLRHLRRTVGSLAAEDRPAFKRIDASSARYDDGSWLKPHH* |
Ga0126311_104214002 | 3300010045 | Serpentine Soil | MTDMLRRFRRAVASLGVEDRPAFKSVDASPALYDDGSWL |
Ga0126311_108135472 | 3300010045 | Serpentine Soil | MSHPLRRLRRTVGNLVAEDRPGFKRVDASPALYDDGSWLK* |
Ga0126311_109178262 | 3300010045 | Serpentine Soil | MTSMFSRLRLSLSDLIPDDRADFKRIDASPARYDDGSWLERTAE* |
Ga0126311_116347321 | 3300010045 | Serpentine Soil | MMSMTSTLLRLRRAVSNLAAEDRPDFKRVDASPVAYDNGAWLRPLA* |
Ga0126306_1000374216 | 3300010166 | Serpentine Soil | MTNLLRRLRNAVVLLGAEDRPDFKRVDASPAVYDDGSWLKRDA* |
Ga0126306_100674362 | 3300010166 | Serpentine Soil | MTNILRRLHRAVVLAGAEGRPDFKRIDASPALYDDGSWLTPRT* |
Ga0126306_101213804 | 3300010166 | Serpentine Soil | MTEILRRLRRAVTSLGAEDRPEFKRVDASPALYDDGSWLTKR* |
Ga0126306_102221852 | 3300010166 | Serpentine Soil | MTTRLRRLGRSLSDLVAEDRDGFKRLDASSAPLYDDGSWLKPRR* |
Ga0126306_110194761 | 3300010166 | Serpentine Soil | MNSRLSRLRRTVGNLVAEDRPGFKRVDASPALYDDGAWLKKS* |
Ga0134127_133729512 | 3300010399 | Terrestrial Soil | MSNTLRSIRYAVASLVAEDRPAFKRIDASAARYDDGSWLRPRPAA* |
Ga0134122_106877992 | 3300010400 | Terrestrial Soil | MPTLRRFRSALTSLATEDRPGFKRVDASPARYDDGAWLTPRH* |
Ga0126317_104449842 | 3300011332 | Soil | GLEPLMLNLRRLRRTVGNLVAETRPEFKRIDASPARYDDGSWLKQD* |
Ga0137312_10249112 | 3300011400 | Soil | MTMNRIRRAFSGLVAEDRDGFKRVDASPVRPDDASWLASRRYSA* |
Ga0136627_10019845 | 3300012042 | Polar Desert Sand | MTKMLRRLRRAVADLGAEDRPSFKRVDASAALYHDGSWLKPRR* |
Ga0136634_101616582 | 3300012046 | Polar Desert Sand | MTNMLRRLRRNVALLGAEDRPDFKRVDASPALYDDGSWLTPRT* |
Ga0136632_100499772 | 3300012093 | Polar Desert Sand | MTNMLRRLHRTVALLGAEGRPDFKRVDASPALYDDGSWLTPRT* |
Ga0136638_102080561 | 3300012094 | Polar Desert Sand | TCARHPALMTNMLRRLHRTVALLGAEGRPDFKRVDASPALYDDGSWLTPRA* |
Ga0150985_1033954481 | 3300012212 | Avena Fatua Rhizosphere | MTAFARLRRVASHLVAEDRPHFKRVDASPAAYDDGSWLK* |
Ga0150985_1045355621 | 3300012212 | Avena Fatua Rhizosphere | TTGDAMTRLRRIRLALSDLVAEDRPDFKRVDASPALSDDGRWLSR* |
Ga0150985_1065622391 | 3300012212 | Avena Fatua Rhizosphere | VRSAFSGFVAEDRPSFKRLDVSSARYDDGAWLKAHH* |
Ga0150985_1089508311 | 3300012212 | Avena Fatua Rhizosphere | IRYAVAGLVAEDRPAFKRIDASSARYDDGSWLRPRPNA* |
Ga0150985_1104927831 | 3300012212 | Avena Fatua Rhizosphere | RFAVSGLVAEDRRDFKRLDASSVRYDDGAWLKAHH* |
Ga0150985_1114276951 | 3300012212 | Avena Fatua Rhizosphere | MSQMLRRLGRAVTDLGTEDRSGFKRIDASPALPDDGSWLEPRTR* |
Ga0150985_1114276952 | 3300012212 | Avena Fatua Rhizosphere | MLRRLRAAVTELSTEDRSNFKRIDASPAVYDDGSWLKPRS* |
Ga0150985_1146218372 | 3300012212 | Avena Fatua Rhizosphere | MMKSLRRMRATLAGLAAEDRPGFKRLDASPARPDDGIWLMTC* |
Ga0150985_1206027801 | 3300012212 | Avena Fatua Rhizosphere | TLRRFRSAVSGLAAEDRRDFKRLDVSRARYDDGAWLKAHH* |
Ga0150985_1214301722 | 3300012212 | Avena Fatua Rhizosphere | PFRTLRRTVANLAAEDRPGFKRVDASPALYDDGSWLKPNH* |
Ga0150985_1214891201 | 3300012212 | Avena Fatua Rhizosphere | RYAVAGLVAEDRPAFKRIDPSSARYDDGSWLRPRPNA* |
Ga0134056_10596861 | 3300012397 | Grasslands Soil | RPLRRLRRTVGTLAAEDRPAFKRIDASPARYDDGSWLKPHH* |
Ga0150984_1067882141 | 3300012469 | Avena Fatua Rhizosphere | RLDWSLTMNSRLSRLRRTVGNLVAEDRPGFKRVDVSPARYDDGSWLK* |
Ga0150984_1157591081 | 3300012469 | Avena Fatua Rhizosphere | LRRTVANLAAEDRPGFKRVDASPALYDDGSWLKPNH* |
Ga0157327_10588011 | 3300012512 | Arabidopsis Rhizosphere | EATICDMSNTLRSIRYAVAGLVAEDRPAFKRIDASAARYDDGSWLRPRPAA* |
Ga0136615_100274882 | 3300012678 | Polar Desert Sand | MTKMLRRLRRAVADLGAEDRPCFKRVDASAALYDDGSWLKPRR* |
Ga0136614_100063434 | 3300012684 | Polar Desert Sand | MTNMLRRLHRTVALLSAEGRPDFKRVDASPALYDDGSWLTPRT* |
Ga0136614_104455271 | 3300012684 | Polar Desert Sand | MSHPLRRLRRTVGNLVAEDRPGFKRVDASPALYDDGAWLKPND* |
Ga0157285_102931371 | 3300012897 | Soil | MSSLVRRVRRAASHLVAEDRAHFKRVDVSRARYDDGAWLK* |
Ga0157301_103576972 | 3300012911 | Soil | RHPDAMSNMLRRFRNTLVLRGAEDRPEFKRIDASPALYDDGSWLTPRS* |
Ga0162651_1000302093 | 3300012938 | Soil | MSKLRRLRRAAGNLVAEGRPEFKRIDVSPARYDDGSWLK* |
Ga0164300_100514882 | 3300012951 | Soil | MSDRLRRIRNALGNLVAEDRPEVKRIDASPALPDDGSWLKSQH* |
Ga0164299_102001182 | 3300012958 | Soil | MSGRLRRIRNALGNLVAEDRPEFKRIDASPALPDDGSWLKSQH* |
Ga0164308_111068782 | 3300012985 | Soil | MMRDMFSRLRTALSSLAAEDRPGFKRIDASPARYDDGAWLKPRR* |
Ga0163163_130130011 | 3300014325 | Switchgrass Rhizosphere | MSNMLRRFRNTLVLRGAEDRPEFKRIDASPALYDDGSWLTPRS* |
Ga0157377_100952382 | 3300014745 | Miscanthus Rhizosphere | MNSTLRRLSRSLSGLVAEDRRDFKRLDVSSARYDDGSWLKPHH* |
Ga0180121_102386022 | 3300017695 | Polar Desert Sand | MTNMLRRLHRTVALLGAEGRPDFKRVDASPALYDDGSWLTPRT |
Ga0183260_104315292 | 3300017787 | Polar Desert Sand | MTNILRRLHRTVALLGAEGRPDLKRVDASPALCDDGSWLTPRT |
Ga0136617_1000014824 | 3300017789 | Polar Desert Sand | MNRTLRRLRRTAGNLVAEDRPGFKRIDVSPARYDDGSWLK |
Ga0190266_104347972 | 3300017965 | Soil | MNRTLSRLRRTVGNLVAEDRPGFKRVDASPARYDDGSWLK |
Ga0190266_104365932 | 3300017965 | Soil | MTNVLRRIHRAVVLLGAEDRPDFKRVDASPVVYDDGSWLTP |
Ga0190266_108834281 | 3300017965 | Soil | MNRTLSRLRRTVGNLVAEDRPGFKRVDASPARYDDGAWLK |
Ga0190266_113747972 | 3300017965 | Soil | MSRKLDRIRTALADLVVEDRREFKRIDASPALFDDGAWLKPRT |
Ga0184617_12790002 | 3300018066 | Groundwater Sediment | MSKLRRLRRAAGNLVAETRPEFKSIDASPARYDDGSWLK |
Ga0190265_100346435 | 3300018422 | Soil | VLNSLRCLRRAFSDLIAEDRPGFKRIDVSPARYDDGSWLEPRRRH |
Ga0190265_100651752 | 3300018422 | Soil | MTKSMSRFRRAFAGLVAEDRDGFKRIDASPAKYDDGSWLAPRR |
Ga0190265_100700761 | 3300018422 | Soil | MTMLRRLRNAVTTVASETRPEFKRVDASPALYDNGAWLKPLV |
Ga0190265_100788844 | 3300018422 | Soil | MTTTMRRFRTAVAGLVAEDRAGFKRIDASAAKYDDGSWLTPRR |
Ga0190265_100841943 | 3300018422 | Soil | MSSRLRRLSRTLSDLVAEDRDGFKRLDASSTPAYDDGSWLKARR |
Ga0190265_101095412 | 3300018422 | Soil | MTNALRRVRHVVTQLGSESRRDFKRVDASPALYDDGSWLTPKNA |
Ga0190265_101145014 | 3300018422 | Soil | VQSQNKTMNNHLRTLRRAVAGLVAEDRPGFKRVDASSARYDDGSWLKPRS |
Ga0190265_101350393 | 3300018422 | Soil | MTKTMRRFRSAVAGLAAEDRPSFKRVDASPAKYDDGSWLTPRR |
Ga0190265_101371513 | 3300018422 | Soil | MDITMNSTFRRLRTALSDLVAEDRPAYKRIDASPARYDDGSWLEPRR |
Ga0190265_102000672 | 3300018422 | Soil | MTMNSLRRALSGLVAEDRPGFKRVDASPVLTDDASWLSRGRRPAA |
Ga0190265_104232182 | 3300018422 | Soil | MNTLSRLRRAATGLAPEGRPNFKRIDASPARYDDGSWLKER |
Ga0190265_105033472 | 3300018422 | Soil | MTTTSLRRIRRAVSGLVAEDRPDFKRLDASRARYDDGSWLTPRS |
Ga0190265_105189852 | 3300018422 | Soil | MTRTLRRLTRAVAGVAYDTRPEFNRVDASPALYDNGAWLKPLV |
Ga0190265_107177562 | 3300018422 | Soil | MTSTLRRIRLAVTGLVAEDRAGFKRVDASRARYDDGAWLEPR |
Ga0190265_108849362 | 3300018422 | Soil | MSKLHRFRRAVSVLAVEDRPNFKRVDASPVNYDDGAWLIRPLA |
Ga0190265_124405962 | 3300018422 | Soil | MTNTVRRFRSVLPNLIAEDRPGFKRLDSSSARYDDGSWLEPRR |
Ga0190265_125076882 | 3300018422 | Soil | MSKFSPRRNAVSGLAAEDRPHFKRIDASKARYDDGSWLKDS |
Ga0190265_127907871 | 3300018422 | Soil | MTTRLRRLGRSLSELVAEDRDGFKRLDASSAPLYDDGSWLKPRR |
Ga0190265_133547641 | 3300018422 | Soil | DSTMSTRLRRLRSTLSDLVAEDRSGFKRLDASPAMPDDGAWMKPRR |
Ga0190272_102076981 | 3300018429 | Soil | MNTRLQNFRRAVAGLVAEDRPAFKRIDASSARYDDGKWLTK |
Ga0190272_104465782 | 3300018429 | Soil | MNRISRLRSAVSGLVAEDRPHFKRIDASKARYDDGSWLKDS |
Ga0190272_111247122 | 3300018429 | Soil | MNSTLRRLRRTVGNLVAEDRPGFKRVDVSPARYDDGSWLK |
Ga0190272_117121052 | 3300018429 | Soil | RTESTMTKSMSRFRRAVAGLVAEDRDGFKRIDASAAKYDDGSWLTPRR |
Ga0190272_120202372 | 3300018429 | Soil | MNSRLRRLRRTVGNLVAEDRPGFKRVDASPARYDDGSWLKET |
Ga0190275_100046118 | 3300018432 | Soil | MSKFSRLRNAVSGLAAEDRPHFKRIDASKARYDDGSWLKHS |
Ga0190275_100091103 | 3300018432 | Soil | MFQTVRRIRHALSDLVPEDRPAFKRIDVSPAKPDDGAWLRRC |
Ga0190275_100197291 | 3300018432 | Soil | MPNIMRRVSSAVSGLVAEDRPAFKRVDASPARYDDGSWLKPRD |
Ga0190275_101229014 | 3300018432 | Soil | MSNLLHRLRRNVAFLGAENRPEFKRIDASPALYDDGSWLTPRS |
Ga0190275_102219262 | 3300018432 | Soil | MTPKLRRIRNAMSSLVAEDRAGFKRLDVSPARYDDGAWLKPRR |
Ga0190275_102583733 | 3300018432 | Soil | MTNMLRRLRTAVVLLGAEDRPDFKRVDASPALYDDGSWLTP |
Ga0190275_107715182 | 3300018432 | Soil | MSTTLRRLRSTLSDLVAEDRSGFKRLDASPALPDDGSWVKPRR |
Ga0190275_112214752 | 3300018432 | Soil | MSRLNRLRRTVGNLVAEDRPGFKRVDASPARYDDGSWLK |
Ga0190275_120165471 | 3300018432 | Soil | MFDSLHRLRRAVSGLVAEDRPDFKRIDASPARPDDGAWLRLR |
Ga0190275_121316202 | 3300018432 | Soil | MLSMTTMKRLRRTLSGLAAETRPEFKRVDASRARYDDGSWLKA |
Ga0190275_123453002 | 3300018432 | Soil | MSTRLNRIRRTLSDLVAEDRPGFKRVDASPARSDDGSWLNRER |
Ga0190275_126654501 | 3300018432 | Soil | MNRTLSRLRRTVGNLVAEDRPGFKRVDASPARYDD |
Ga0190268_100018854 | 3300018466 | Soil | MTTRLQNFRRAVAGLVAEDRPAFKRIDASSARYDDGKWLTK |
Ga0190268_104506802 | 3300018466 | Soil | MTMNRIRRAFSGLVAEDRPGFKSLDASPVRADDAAWLTQRRYNA |
Ga0190268_112399082 | 3300018466 | Soil | MTNRLHTLRRAFAGLVAEDRTGFKRVDASSARYDDGSWLKPRS |
Ga0190268_114372151 | 3300018466 | Soil | MNRLSRLRRTVGNLVAEDRPGFKRVDVSPARYDDGAWLKKS |
Ga0190268_122399961 | 3300018466 | Soil | MSDMLRRFRQVVAGLAAEDRPDFKRIDASPARPDSGSWLTPRR |
Ga0190270_102669372 | 3300018469 | Soil | MTTLRRFRSALSSLATEDRPGFKRVDASPARYDAGAWLTPRH |
Ga0190270_106164042 | 3300018469 | Soil | MTTMNRIRRSLSGLAAETRPEFKRVDASRARYDDGSWLKP |
Ga0190270_107112942 | 3300018469 | Soil | MTMNSLRRAFSGLVAEDRRGFKRIDASPARADDASWLAQRRYNA |
Ga0190270_107705073 | 3300018469 | Soil | MNRTLSRLRRTVGNLVAEDRPGFKRVDVSPARYDDGSWLK |
Ga0190270_113522542 | 3300018469 | Soil | MNLNSLRRAVSGLVAEDRPGFKRIDTSPARADDTSWLAQRRYNA |
Ga0190270_116000472 | 3300018469 | Soil | ESTMTKTMRRFRTAVSGLVAEDRRGFNRIDASPAKYDDGSWLTPRS |
Ga0190270_117569362 | 3300018469 | Soil | MAITMNSTFRRLRTALSDLVAEDRPNYKRIDASPARYDDGSWLEPRR |
Ga0190270_121302642 | 3300018469 | Soil | MTMNRLRRAFSGLVAEDRDGFKRVDASPARPDDASWLATRRYSA |
Ga0190274_101112612 | 3300018476 | Soil | MTTLRRFRSALSSLATEDRPGFKRVDASPARYDDGAWLTPRH |
Ga0190274_108750742 | 3300018476 | Soil | MSKLNRFRRAFSGLAAEDRPSFKRVDASPVAYDDGSWLRPLA |
Ga0190274_124865402 | 3300018476 | Soil | MTMNRIRRAFSGLVAEDRDGFKRVDASPVRPDDASWLATRRYSA |
Ga0190271_101474992 | 3300018481 | Soil | MKNSLSRVRRALSGLAVEGRPDFKRVDASSARYDDGAWLEPRS |
Ga0190271_105494403 | 3300018481 | Soil | MENTMNSTLRRLRTALSDLVAEDRPNYKRIDASPARYDDGSWLEPRR |
Ga0190271_108843202 | 3300018481 | Soil | MTLNSLRRAFSGLVAEDRPNFKRVDASPARSDDASWLNHRRWNA |
Ga0190271_117254473 | 3300018481 | Soil | MNTKLARLRNALSDLVAEDRPNYKRIDASPARYDDGAWLEPRRR |
Ga0193616_11137063 | 3300018918 | Soil | PDGMTDMLRRLHRTVVLVGAEDRPAFKRIDASPALYDDGSWLKPRS |
Ga0190273_101452823 | 3300018920 | Soil | MSRKLDRLRQTLADLVAEDRREFKRIDASPALFDDGAWLKPRR |
Ga0190273_119220382 | 3300018920 | Soil | MTGMLRRLHRAVAGAVHEDRPGFKRVDASPAQYDDGAWLEPRR |
Ga0193614_11965292 | 3300018933 | Soil | MTDMLRRLHRTVVLVGAEDRPAFKRIDASPALYDDGSWLK |
Ga0193605_11769571 | 3300018984 | Soil | LSRPPIARHPDGMTDMLRRLHRTVVLVGAEDRPAFKRIDASPALYDDGSWLQPRS |
Ga0184645_13372173 | 3300019233 | Groundwater Sediment | FRLALSQVVAEDRPSFKRIDVSPARYDDGSWLESRH |
Ga0184642_16855311 | 3300019279 | Groundwater Sediment | RNAMTATLRRIRLALSDLVAEDRPAFKRLDASPARYDDGAWLQSRR |
Ga0173481_104835372 | 3300019356 | Soil | SPMLRRIRRALSSAVAEDRPAFKRIDASPARYDDGSWLTDKH |
Ga0190264_102676822 | 3300019377 | Soil | LNRIRRAVSGLVAEDRPGFKRVDASPARYDDGSWLSPRPLS |
Ga0190264_103604102 | 3300019377 | Soil | MTTALRRFRHGVTQLGSDSRRDFKRVDASPALYDDGSWLTPKNA |
Ga0190264_116834482 | 3300019377 | Soil | MSKLSRLRRAAGNLVAETRPEFKRIDASPARYDDGSWLK |
Ga0190267_102203972 | 3300019767 | Soil | MSNMLRRFRNTLVLRGAEDRPEFKRIDASPALYDDGSWLTPRS |
Ga0190267_109591262 | 3300019767 | Soil | MNSRLSRLRRTVGNLVAEDRPGFKRVDASPARYDDGSWLK |
Ga0193743_10466363 | 3300019889 | Soil | MSNVFRRLRRAVSVLAVEDRPNFKRVDVSRARYDDGSWLESS |
Ga0206355_16753782 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSLRRIRLALSALVAEDRPAFKRIDVSPALGDDGRWLRSTR |
Ga0196958_100072974 | 3300020181 | Soil | MSQLLRRLRDAVARAAAEDRPHFKRIDASPVVFDDGAWLASTPRHRR |
Ga0222625_16222401 | 3300022195 | Groundwater Sediment | KNEDDMTNTLRRIRVALSDLVAEDRPDFKRLDASPARYDDGAWLPARR |
Ga0196962_1000086910 | 3300024430 | Soil | MTTLSRLRRAVSDLVADSRTDFKRIDASPARYDDGSWLAPRR |
Ga0196962_100050502 | 3300024430 | Soil | MTFTSLRRALSGLVAEDRPGFKRVDASPVRADDASWLDRR |
Ga0196962_102024031 | 3300024430 | Soil | MSTRLRRLGRSLSDLVAEDRDGFKRLDASSAPAYDDGSWLKRSR |
Ga0196962_102470771 | 3300024430 | Soil | MHSVLRRFRRTASDLVADTRPGFRRIDASPARYDDGSWLKPNH |
Ga0207874_10233641 | 3300025571 | Ionic Liquid And High Solid Enriched | MNSTLHRLRTVLSDLVAEDRPGYKRVDASPARPDDGSWLEPRRR |
Ga0207642_100996613 | 3300025899 | Miscanthus Rhizosphere | MLRRIRRALSSAVAEDRPAFKRIDASPARYDDGSW |
Ga0207642_103041522 | 3300025899 | Miscanthus Rhizosphere | IHLPEEASPMLRRIRRALSSAVAEDRPAFKRIDASPARYDDGSWLTDKH |
Ga0207642_103350442 | 3300025899 | Miscanthus Rhizosphere | MSNTLRSIRYAVAGLVAEDRPAFKRIDASAARYDDGSWLRPRPAA |
Ga0207643_104634162 | 3300025908 | Miscanthus Rhizosphere | DLPKEPAMTTLRRFRSALSSLATEDRPGFKRVDASPARYDDGAWLTPRH |
Ga0207643_106422751 | 3300025908 | Miscanthus Rhizosphere | MDAMNNTLRRARSALSGLVAEDRRDFKRLDVSSARYDDGSWLKPHH |
Ga0207705_113397701 | 3300025909 | Corn Rhizosphere | TICDMSNTLRSIRYAVAGLVAEDRPAFKRIDASAARYDDGSWLRPRPAA |
Ga0207649_102046112 | 3300025920 | Corn Rhizosphere | MTTLRRFRSALTSLATEDRPGFKRVDASPARYDDGAWLTPRH |
Ga0207649_107878911 | 3300025920 | Corn Rhizosphere | RRARSALSGLVAEDRRDFKRLDVSSARYDDGSWLKPHH |
Ga0207687_102690033 | 3300025927 | Miscanthus Rhizosphere | MLRRIRRALSSAVAEDRPAFKRIDASPARYDDGSWLTDKH |
Ga0207687_106345941 | 3300025927 | Miscanthus Rhizosphere | PQMLRRIRRALSSAVAEDRPAFKRIDASPARYDDGSWLTDKH |
Ga0207690_112902282 | 3300025932 | Corn Rhizosphere | MTTLRRFRSALSSLATEDRPGFKRVDASPARYDDGA |
Ga0207706_116917781 | 3300025933 | Corn Rhizosphere | MDAMNNILRRARSALSGLVAEDRRDFKRLDVSSARYDDGA |
Ga0207704_103968193 | 3300025938 | Miscanthus Rhizosphere | PSPQEASPMLRRIRRALSSAVAEDRPAFKRIDASPARYDDGSWLTDKH |
Ga0207661_115139882 | 3300025944 | Corn Rhizosphere | MSSMLRRFRLSLADLVAEDRPAFKRIDASPARYDDGAWLDAPNSA |
Ga0207668_118050631 | 3300025972 | Switchgrass Rhizosphere | RFRSALSSLATEDRPGFKRVDASPARYDDGAWLTPRH |
Ga0207708_118289062 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMNRIRRAFSGLVAEDRDGFKRVDASPVRSDDASWLATRRYSA |
Ga0207675_1006302422 | 3300026118 | Switchgrass Rhizosphere | PPEATICDMSNTLRSIRYAVAGLVAEDRPAFKRIDASAARYDDGSWLRPRPAA |
Ga0207675_1007729081 | 3300026118 | Switchgrass Rhizosphere | RHQEGNPQMTAFARRIRSVASHLVAEDRAHFKRIDASRAVYDDGSWLK |
Ga0207675_1018833731 | 3300026118 | Switchgrass Rhizosphere | MDAMNNILRRARSALSGLVAEDRRDFKRLDVSSARYDDGSWLKPHH |
Ga0207698_124460071 | 3300026142 | Corn Rhizosphere | RYAVAGLVAEDRPAFKRIDASAARYDDGSWLRPRPAA |
Ga0208736_10901402 | 3300027618 | Polar Desert | MTNMLRRLHRTVALLSAEGRPDFKRVDASPALYDDGSWLTPRT |
Ga0214469_10097101 | 3300027636 | Soil | MTMNRIRRAVAGLVAEDRPGFKRVDVSTARADDGSWLSPR |
Ga0207428_106332372 | 3300027907 | Populus Rhizosphere | MLRRIRRALSSVVAEDRPAFKRIDASPARYDDGSWLTDKH |
Ga0268264_106738812 | 3300028381 | Switchgrass Rhizosphere | RNVPPEATICDMSNTLRSIRYAVAGLVAEDRPAFKRIDASAARYDDGSWLRPRPAA |
Ga0247828_104472031 | 3300028587 | Soil | MLRRIRSALSSVVAEDRPAFKRIDASPAKYDDGSWLTPKH |
Ga0247818_106615213 | 3300028589 | Soil | MNMLRRIRRAVSALGAENRPDFKRVDASPAKPDDGSWLTDRH |
Ga0307276_100455852 | 3300028705 | Soil | MTNTIRRIRLAASRLAPEDRPHFKRVDASPARYDDGSWLK |
Ga0307309_100462402 | 3300028714 | Soil | MSRLRRLRRAAGNAVAETRPEFKRIDVSPARYDDGSWLKS |
Ga0307284_100545682 | 3300028799 | Soil | MTTKLNSLRRAMSGLVAEDRPAFKRIDASPAQYDDGSWLKGR |
Ga0307503_103869361 | 3300028802 | Soil | RSMSTMNRILRSLSGLAAETRPEFKRVDASRARYDDGSWLKP |
Ga0247825_112087842 | 3300028812 | Soil | MTSTLRRLRRAVSTLGAEDRPAFKRVDASPALYDDGSWLAR |
Ga0307289_103479102 | 3300028875 | Soil | MSNTLRTIGRAVSGLIAEDRPAFKRIDASTARYDDGAWLKPRPVG |
Ga0247827_111326572 | 3300028889 | Soil | MTMKNIRRALSGLVAEDRPGFKRVDASAARYDDGSWLAPRR |
Ga0299907_101045013 | 3300030006 | Soil | MTMNRIRRAVAGLVAEDRPGFKRVDVSTARADDGSWLSPRPLS |
Ga0299907_112188422 | 3300030006 | Soil | MNQLLHRLRRAVASVSFEDRPEFKRVDVSPARYDSGAWLKPLV |
Ga0247826_102617692 | 3300030336 | Soil | MTMNRLRRALSGLVAEDRDGFKRVDASPVRPDDASWLATRRYSG |
Ga0247826_103834382 | 3300030336 | Soil | MSTLNRIRRSLSDLVAETRPEFNRVDVSRAKYDDGSWLKS |
Ga0102770_112662341 | 3300030981 | Soil | DRMNRTLRRLRRAVGNLAAEDRPDFKRIDVSPARYDDGAWLKEER |
Ga0299914_111357032 | 3300031228 | Soil | MTMNRIRRAVAGLVAEDRPGFKRVDVSAARADDGSWLSPRPLG |
Ga0299913_100108587 | 3300031229 | Soil | MTKTMRRLRSAVAGLAAEDRPSFKRVDASPAKYDDGSWLAPRR |
Ga0299913_101394532 | 3300031229 | Soil | MTNALRRFRHVVTQLGTDSRRDFKRVDASPALYDDGSWLTPKPA |
Ga0299913_105610392 | 3300031229 | Soil | MTFPLRNLRRAVAGFVAEDRPDFKRIDVSPARADDGRWMQPLA |
Ga0272433_101028271 | 3300031450 | Rock | MTRMLRRLGRAVAALGAEGRPEFKRIDVSPARFDDGPWLLPRYA |
Ga0307505_103933572 | 3300031455 | Soil | MNRILRSLSGLAAETRPEFKRVDASRAQYDDGSWLKS |
Ga0272434_10312213 | 3300031473 | Rock | MTQMLRRLGRAVAALGAEGRPEFKRIDVSPARFDDGPWLLPRYA |
Ga0307405_101790614 | 3300031731 | Rhizosphere | PHWIDMTEMLRRFRRAVASFAAEDRPEFKRVDASPARYDDGSWLTPRH |
Ga0307405_115186091 | 3300031731 | Rhizosphere | MSELLRRIRNAVSSLAAEDRPGFKRIDLSPALSDDGAWLTPRH |
Ga0307413_101701594 | 3300031824 | Rhizosphere | MTEMLRRFRRAVASFAAEDRPEFKRVDASPARYDDGSWLTPRH |
Ga0307413_108482073 | 3300031824 | Rhizosphere | MGFTMNNTFRRLRTALSDLVAEDRPGYKRIDASPARYDDGSWLEPRRR |
Ga0307413_110293652 | 3300031824 | Rhizosphere | MTSKLSRFRRAMSVLAVEDRPDFKRVDVSPVAYDDGAWLRPLV |
Ga0307406_115509972 | 3300031901 | Rhizosphere | MTNTLLRLRRAVSNLAAEDRPAFKRVDASPVAYDNGAWLRPLA |
Ga0307407_109354462 | 3300031903 | Rhizosphere | MNSVLRRLRRSASDLVADTRPGFNRIDASPVRYDDGSWLKPSH |
Ga0307412_117623781 | 3300031911 | Rhizosphere | MTKLTRFRRVVTALVVEDRPGFKRIDASPVAYDDGSWLRPLV |
Ga0308175_1002832583 | 3300031938 | Soil | MTNMLRRLRTTLSGLVAEDRPEFKRIDASAARSDDGAWLGRQC |
Ga0308175_1022134972 | 3300031938 | Soil | MTAFARRLRRVASHLVAEDRAHFKRIDASPAVYDDGSWLK |
Ga0308175_1023134162 | 3300031938 | Soil | MPSALRRFRNALADLVAEDRPGFKRLDASPARPDDGSWLARR |
Ga0307409_1007741472 | 3300031995 | Rhizosphere | AFYPRKKWIAMHSVIRRIRRSASDLVADTRPAFNRIDASPARYDDGSWLKSNH |
Ga0307409_1017514351 | 3300031995 | Rhizosphere | MSELLRRIRNAVSSLAAEDRPGFKRIDVSPALSDDGAWLTPRH |
Ga0307409_1018153962 | 3300031995 | Rhizosphere | MMPMTNTLLRLRRAVSNLAAEDRPAFKRVDASPVAYDDGAWLRPLA |
Ga0307409_1029522222 | 3300031995 | Rhizosphere | MPQLLTRFRRTIAALAAEDRPAFKRVDASPALYDDGSWLERR |
Ga0307416_1004619201 | 3300032002 | Rhizosphere | QLLRRFRRTVAALAAEDRPGFKRVDASPALYDDGSWLERR |
Ga0307416_1005298242 | 3300032002 | Rhizosphere | MHSVIRRIRRSASDLVADTRPGFNRIDASPARYDDGSWLKSNH |
Ga0307416_1024801692 | 3300032002 | Rhizosphere | MNRLSTLRRLVSDLVAEDRTGFKRIDASAARYDDGSWLKRR |
Ga0307411_103496274 | 3300032005 | Rhizosphere | MNSTFRRLRTALSDLVAEDRPSYKRIDASPARYDDGSWLEPRRR |
Ga0308173_112562211 | 3300032074 | Soil | MNRFRKFRLALSDLVAEDRPGFKRVDASPALSDDGHWLSRC |
Ga0334925_008157_1900_2022 | 3300034173 | Hypolithic Biocrust | MNPTLRRLRRAVGGLVAEDRPGFKRVDASPARYDDGSWLK |
⦗Top⦘ |