Metagenome / Metatranscriptome Family F009114

Overview

Basic Information

• Family ID: F009114
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 322
• Average Sequence Length: 40 residues
• Representative Sequence: MHSSFKFYLSNEASNEKVPKTKVVDLEILSKFDIQKFFI
• Number of Associated Samples: 137
• Number of Associated Scaffolds: 322

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 37.38 %
• % of genes near scaffold ends (potentially truncated): 60.56 %
• % of genes from short scaffolds (< 2000 bps): 98.45 %
• Associated GOLD sequencing projects: 131
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (83.851 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (67.391 % of family members)
• Environment Ontology (ENVO): Unclassified (85.404 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (79.814 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 47.76%
  β-sheet: 0.00%
  Coil/Unstructured: 52.24%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 322 Family Scaffolds
PF08263	LRRNT_2	0.31
PF08284	RVP_2	0.31

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
All Organisms	root	All Organisms	16.15 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
cellular organisms	root	All Organisms → cellular organisms	16.15 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	16.15 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	15.84 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.31 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	15.84 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.31 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	15.84 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.31 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	15.84 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.31 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	15.53 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.31 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	15.53 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.31 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	15.53 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.31 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	15.53 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.31 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	15.53 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.31 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	15.53 %
Spirurina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina	0.31 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	15.53 %
Spiruromorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha	0.31 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	15.53 %
Filarioidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea	0.31 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	15.53 %
Setariidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae	0.31 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	15.53 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.31 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	13.98 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.62 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.31 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	13.35 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.62 %
Chloridoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae	0.31 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	0.31 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.31 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	13.04 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.62 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	0.31 %
Eragrostideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae	0.31 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.31 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	13.04 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.62 %
Eragrostidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae	0.31 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	0.31 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.31 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	13.04 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.62 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.31 %
Eragrostis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis	0.31 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.31 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	13.04 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.31 %
Oryza nivara	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza nivara	0.31 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.31 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.31 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.31 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	11.80 %
Panicum sect. Panicum	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum	0.31 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.31 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.31 %
Oryza nivara	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza nivara	0.31 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.31 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.31 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.31 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.85 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	11.80 %
Panicum hallii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	0.31 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.31 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.31 %
Oryza nivara	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza nivara	0.31 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.31 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.31 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.31 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005330|Ga0070690_101603477	Not Available	528
3300005340|Ga0070689_101714248	Not Available	572
3300005347|Ga0070668_101912196	Not Available	546
3300005353|Ga0070669_101797005	Not Available	535
3300005365|Ga0070688_101416032	Not Available	564
3300005367|Ga0070667_102104715	Not Available	532
3300005615|Ga0070702_101457305	Not Available	562
3300005617|Ga0068859_100395591	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	1477
3300005617|Ga0068859_102350685	Not Available	588
3300005618|Ga0068864_101987083	Not Available	587
3300005618|Ga0068864_102664904	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	506
3300005618|Ga0068864_102684519	Not Available	504
3300005719|Ga0068861_101017766	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	792
3300005719|Ga0068861_102595634	Not Available	511
3300005841|Ga0068863_100704863	Not Available	1003
3300005841|Ga0068863_101649244	Not Available	650
3300005841|Ga0068863_101941771	Not Available	599
3300005841|Ga0068863_102626296	Not Available	512
3300005842|Ga0068858_100737280	Not Available	959
3300005842|Ga0068858_100803701	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	918
3300005842|Ga0068858_101232576	Not Available	736
3300005843|Ga0068860_101128650	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	804
3300005843|Ga0068860_101692232	Not Available	654
3300005843|Ga0068860_102339179	Not Available	555
3300005844|Ga0068862_101388019	Not Available	706
3300005844|Ga0068862_102240998	Not Available	558
3300005844|Ga0068862_102728781	Not Available	506
3300009553|Ga0105249_12326026	Not Available	609
3300009972|Ga0105137_106240	Not Available	601
3300009973|Ga0105136_108464	Not Available	613
3300009975|Ga0105129_100139	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2135
3300009976|Ga0105128_103262	Not Available	878
3300009976|Ga0105128_104925	Not Available	785
3300009976|Ga0105128_111197	Not Available	625
3300009980|Ga0105135_105587	Not Available	839
3300009980|Ga0105135_128366	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	520
3300009989|Ga0105131_103714	Not Available	1092
3300009990|Ga0105132_109650	Not Available	797
3300009992|Ga0105120_1010450	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	901
3300009995|Ga0105139_1048786	Not Available	740
3300010371|Ga0134125_10781145	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1051
3300010396|Ga0134126_10518829	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1371
3300010399|Ga0134127_12660500	Not Available	580
3300010401|Ga0134121_10854570	Not Available	879
3300010401|Ga0134121_11994142	Not Available	612
3300014968|Ga0157379_10666978	Not Available	974
3300014968|Ga0157379_10762497	Not Available	911
3300014968|Ga0157379_12322868	Not Available	534
3300015270|Ga0182183_1007318	Not Available	1049
3300015270|Ga0182183_1017855	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	832
3300015270|Ga0182183_1077306	Not Available	539
3300015280|Ga0182100_1031813	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	737
3300015280|Ga0182100_1075362	Not Available	556
3300015280|Ga0182100_1082086	Not Available	540
3300015284|Ga0182101_1033847	Not Available	721
3300015284|Ga0182101_1052192	Not Available	630
3300015290|Ga0182105_1030502	Not Available	769
3300015293|Ga0182103_1097595	Not Available	513
3300015297|Ga0182104_1009519	Not Available	1127
3300015297|Ga0182104_1012227	Not Available	1049
3300015297|Ga0182104_1014406	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1002
3300015297|Ga0182104_1016309	Not Available	968
3300015297|Ga0182104_1039611	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	739
3300015297|Ga0182104_1050580	Not Available	683
3300015297|Ga0182104_1053804	Not Available	669
3300015301|Ga0182184_1008335	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1126
3300015301|Ga0182184_1036574	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	709
3300015301|Ga0182184_1036770	Not Available	708
3300015301|Ga0182184_1100701	Not Available	503
3300015306|Ga0182180_1024293	Not Available	821
3300015306|Ga0182180_1035547	Not Available	714
3300015306|Ga0182180_1045294	Not Available	655
3300015306|Ga0182180_1049103	Not Available	636
3300015309|Ga0182098_1035042	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	780
3300015309|Ga0182098_1058009	Not Available	664
3300015309|Ga0182098_1067725	Not Available	630
3300015309|Ga0182098_1101588	Not Available	547
3300015310|Ga0182162_1004786	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1419
3300015310|Ga0182162_1046539	Not Available	728
3300015310|Ga0182162_1092824	Not Available	571
3300015310|Ga0182162_1098556	Not Available	558
3300015311|Ga0182182_1086582	Not Available	571
3300015312|Ga0182168_1024570	Not Available	924
3300015312|Ga0182168_1045595	Not Available	757
3300015313|Ga0182164_1011598	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1161
3300015313|Ga0182164_1047489	Not Available	745
3300015313|Ga0182164_1057840	Not Available	696
3300015313|Ga0182164_1079740	Not Available	621
3300015313|Ga0182164_1084757	Not Available	607
3300015313|Ga0182164_1117858	Not Available	535
3300015316|Ga0182121_1012872	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1186
3300015316|Ga0182121_1024093	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	977
3300015317|Ga0182136_1085626	Not Available	611
3300015317|Ga0182136_1094560	Not Available	588
3300015317|Ga0182136_1099599	Not Available	577
3300015318|Ga0182181_1021149	Not Available	888
3300015318|Ga0182181_1060495	Not Available	630
3300015318|Ga0182181_1081909	Not Available	568
3300015318|Ga0182181_1106717	Not Available	518
3300015319|Ga0182130_1005328	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1380
3300015320|Ga0182165_1043572	Not Available	794
3300015320|Ga0182165_1062633	Not Available	700
3300015320|Ga0182165_1083995	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	628
3300015324|Ga0182134_1006808	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1366
3300015324|Ga0182134_1074810	Not Available	655
3300015324|Ga0182134_1077215	Not Available	648
3300015324|Ga0182134_1093344	Not Available	603
3300015324|Ga0182134_1101719	Not Available	584
3300015325|Ga0182148_1075457	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	646
3300015325|Ga0182148_1078450	Not Available	637
3300015325|Ga0182148_1083985	Not Available	622
3300015325|Ga0182148_1097890	Not Available	588
3300015325|Ga0182148_1122106	Not Available	540
3300015325|Ga0182148_1127947	Not Available	530
3300015326|Ga0182166_1077977	Not Available	637
3300015326|Ga0182166_1142449	Not Available	506
3300015327|Ga0182114_1055644	Not Available	766
3300015327|Ga0182114_1064445	Not Available	727
3300015327|Ga0182114_1122897	Not Available	565
3300015327|Ga0182114_1156571	Not Available	510
3300015327|Ga0182114_1158523	Not Available	507
3300015328|Ga0182153_1030808	Not Available	893
3300015329|Ga0182135_1023894	Not Available	980
3300015329|Ga0182135_1040981	Not Available	824
3300015329|Ga0182135_1080741	Not Available	649
3300015329|Ga0182135_1121721	Not Available	555
3300015330|Ga0182152_1026869	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	949
3300015330|Ga0182152_1137821	Not Available	527
3300015331|Ga0182131_1005724	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1482
3300015331|Ga0182131_1015673	Not Available	1120
3300015333|Ga0182147_1018552	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1116
3300015333|Ga0182147_1052832	Not Available	794
3300015333|Ga0182147_1151465	Not Available	527
3300015333|Ga0182147_1154392	Not Available	523
3300015333|Ga0182147_1170369	Not Available	501
3300015334|Ga0182132_1019366	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1109
3300015334|Ga0182132_1081983	Not Available	678
3300015334|Ga0182132_1119714	Not Available	583
3300015334|Ga0182132_1156419	Not Available	520
3300015335|Ga0182116_1012146	Not Available	1332
3300015335|Ga0182116_1029797	Not Available	1010
3300015335|Ga0182116_1060416	Not Available	788
3300015335|Ga0182116_1139990	Not Available	562
3300015335|Ga0182116_1162092	Not Available	527
3300015335|Ga0182116_1175842	Not Available	506
3300015336|Ga0182150_1061997	Not Available	738
3300015336|Ga0182150_1063546	Not Available	731
3300015336|Ga0182150_1094380	Not Available	632
3300015336|Ga0182150_1145398	Not Available	532
3300015336|Ga0182150_1161573	Not Available	509
3300015337|Ga0182151_1017816	Not Available	1106
3300015337|Ga0182151_1021787	Not Available	1042
3300015337|Ga0182151_1034150	Not Available	903
3300015337|Ga0182151_1056836	Not Available	760
3300015337|Ga0182151_1145658	Not Available	532
3300015338|Ga0182137_1028185	Not Available	1026
3300015338|Ga0182137_1042314	Not Available	895
3300015338|Ga0182137_1122584	Not Available	594
3300015339|Ga0182149_1050081	Not Available	822
3300015339|Ga0182149_1063782	Not Available	752
3300015339|Ga0182149_1113365	Not Available	602
3300015340|Ga0182133_1072463	Not Available	754
3300015340|Ga0182133_1088347	Not Available	698
3300015340|Ga0182133_1119940	Not Available	617
3300015340|Ga0182133_1156369	Not Available	551
3300015340|Ga0182133_1157128	Not Available	550
3300015340|Ga0182133_1163093	Not Available	541
3300015340|Ga0182133_1164636	Not Available	538
3300015348|Ga0182115_1071499	Not Available	1055
3300015348|Ga0182115_1073836	Not Available	1040
3300015348|Ga0182115_1242687	Not Available	574
3300015348|Ga0182115_1247089	Not Available	568
3300015348|Ga0182115_1258550	Not Available	553
3300015348|Ga0182115_1296145	Not Available	511
3300015349|Ga0182185_1063616	Not Available	1001
3300015349|Ga0182185_1112790	Not Available	789
3300015349|Ga0182185_1128358	Not Available	745
3300015349|Ga0182185_1194154	Not Available	613
3300015349|Ga0182185_1279246	Not Available	510
3300015350|Ga0182163_1126070	Not Available	789
3300015350|Ga0182163_1129802	Not Available	778
3300015350|Ga0182163_1134973	Not Available	763
3300015350|Ga0182163_1137933	Not Available	755
3300015350|Ga0182163_1211486	Not Available	608
3300015350|Ga0182163_1227184	Not Available	585
3300015350|Ga0182163_1241820	Not Available	566
3300015352|Ga0182169_1056078	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1195
3300015352|Ga0182169_1074364	Not Available	1061
3300015352|Ga0182169_1077195	Not Available	1043
3300015352|Ga0182169_1183663	Not Available	684
3300015352|Ga0182169_1287436	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	531
3300015352|Ga0182169_1310364	Not Available	507
3300015353|Ga0182179_1085573	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	924
3300015353|Ga0182179_1123715	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	791
3300015353|Ga0182179_1128441	Not Available	778
3300015353|Ga0182179_1203441	Not Available	631
3300015353|Ga0182179_1253100	Not Available	568
3300015354|Ga0182167_1135489	Not Available	909
3300015354|Ga0182167_1202096	Not Available	727
3300015354|Ga0182167_1209172	Not Available	712
3300017408|Ga0182197_1084712	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	628
3300017408|Ga0182197_1094072	Not Available	604
3300017408|Ga0182197_1108859	Not Available	571
3300017412|Ga0182199_1026623	Not Available	1050
3300017412|Ga0182199_1064289	Not Available	782
3300017412|Ga0182199_1207112	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	500
3300017414|Ga0182195_1010094	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza nivara	1459
3300017414|Ga0182195_1073787	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	773
3300017414|Ga0182195_1145185	Not Available	598
3300017414|Ga0182195_1212226	Not Available	512
3300017421|Ga0182213_1127364	Not Available	712
3300017421|Ga0182213_1184142	Not Available	593
3300017421|Ga0182213_1213605	Not Available	551
3300017422|Ga0182201_1085081	Not Available	606
3300017422|Ga0182201_1112161	Not Available	550
3300017432|Ga0182196_1008911	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1298
3300017432|Ga0182196_1037237	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	819
3300017432|Ga0182196_1104209	Not Available	580
3300017432|Ga0182196_1112408	Not Available	565
3300017432|Ga0182196_1144811	Not Available	516
3300017435|Ga0182194_1030770	Not Available	910
3300017435|Ga0182194_1108546	Not Available	575
3300017439|Ga0182200_1061813	Not Available	707
3300017440|Ga0182214_1022514	Not Available	1224
3300017440|Ga0182214_1044395	Not Available	885
3300017440|Ga0182214_1100292	Not Available	617
3300017440|Ga0182214_1140799	Not Available	532
3300017445|Ga0182198_1117608	Not Available	623
3300017445|Ga0182198_1183483	Not Available	523
3300017446|Ga0182217_1123155	Not Available	609
3300017447|Ga0182215_1082691	Not Available	705
3300017447|Ga0182215_1127622	Not Available	578
3300017447|Ga0182215_1155102	Not Available	530
3300017691|Ga0182212_1122364	Not Available	589
3300017691|Ga0182212_1161205	Not Available	512
3300017692|Ga0182210_1098942	Not Available	627
3300017692|Ga0182210_1155792	Not Available	510
3300017693|Ga0182216_1088823	Not Available	725
3300017693|Ga0182216_1095563	Not Available	706
3300017693|Ga0182216_1122821	Not Available	640
3300017693|Ga0182216_1212930	Not Available	513
3300017694|Ga0182211_1025536	Not Available	1312
3300017694|Ga0182211_1125561	Not Available	606
3300017694|Ga0182211_1138574	Not Available	577
3300020031|Ga0182119_100218	Not Available	1424
3300020223|Ga0182118_101414	Not Available	997
3300025972|Ga0207668_10512877	Not Available	1033
3300025972|Ga0207668_10632957	Not Available	935
3300025986|Ga0207658_11998694	Not Available	528
3300026088|Ga0207641_11258178	Not Available	740
3300026088|Ga0207641_11947503	Not Available	589
3300026095|Ga0207676_11250072	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	737
3300026095|Ga0207676_11392270	Not Available	697
3300026118|Ga0207675_100531872	Not Available	1173
3300026118|Ga0207675_101154459	Not Available	795
3300028049|Ga0268322_1003460	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1144
3300028049|Ga0268322_1018640	Not Available	725
3300028049|Ga0268322_1034134	Not Available	600
3300028049|Ga0268322_1034499	Not Available	598
3300028050|Ga0268328_1000519	Not Available	2203
3300028050|Ga0268328_1059527	Not Available	539
3300028050|Ga0268328_1067541	Not Available	514
3300028051|Ga0268344_1019412	Not Available	554
3300028053|Ga0268346_1004849	Not Available	969
3300028054|Ga0268306_1004485	Not Available	940
3300028054|Ga0268306_1007880	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	799
3300028054|Ga0268306_1008770	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	776
3300028054|Ga0268306_1011323	Not Available	721
3300028055|Ga0268338_1041538	Not Available	515
3300028056|Ga0268330_1013938	Not Available	838
3300028056|Ga0268330_1051292	Not Available	541
3300028057|Ga0268352_1019555	Not Available	718
3300028058|Ga0268332_1013694	Not Available	906
3300028058|Ga0268332_1046882	Not Available	612
3300028058|Ga0268332_1065020	Not Available	542
3300028061|Ga0268314_1005302	Not Available	1090
3300028061|Ga0268314_1030828	Not Available	616
3300028064|Ga0268340_1061559	Not Available	572
3300028139|Ga0268355_1014463	Not Available	548
3300028141|Ga0268326_1011309	Not Available	541
3300028142|Ga0268347_1009842	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	740
3300028142|Ga0268347_1021582	Not Available	585
3300028143|Ga0268348_1013888	Not Available	612
3300028143|Ga0268348_1017259	Not Available	573
3300028147|Ga0268303_102686	Not Available	718
3300028150|Ga0268343_1010537	Not Available	625
3300028151|Ga0268308_1032528	Not Available	509
3300028152|Ga0268336_1000579	Not Available	1558
3300028153|Ga0268320_1023530	Not Available	545
3300028248|Ga0268312_1014137	Not Available	690
3300028248|Ga0268312_1023241	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	592
3300028251|Ga0268324_1015095	Not Available	598
3300028381|Ga0268264_10755882	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	969
3300028381|Ga0268264_12285810	Not Available	548
3300028464|Ga0268302_106224	Not Available	567
3300028466|Ga0268321_104211	Not Available	672
3300028472|Ga0268315_1011928	Not Available	653
3300028473|Ga0268319_1007322	Not Available	723
3300028474|Ga0268331_1013578	Not Available	632
3300028476|Ga0268329_1003251	Not Available	934
3300028476|Ga0268329_1008795	Not Available	719
3300028477|Ga0268309_1013282	Not Available	584
3300028529|Ga0268311_1013961	Not Available	639
3300032465|Ga0214493_1166346	Not Available	506
3300032466|Ga0214503_1031674	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1510
3300032467|Ga0214488_1128628	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	534
3300032490|Ga0214495_1004455	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2385
3300032490|Ga0214495_1144361	Not Available	529
3300032502|Ga0214490_1057467	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	886
3300032502|Ga0214490_1103309	Not Available	651
3300032502|Ga0214490_1112336	Not Available	621
3300032502|Ga0214490_1116414	Not Available	609
3300032514|Ga0214502_1302156	Not Available	607
3300032548|Ga0214483_1060581	Not Available	632
3300032625|Ga0214501_1071621	Not Available	1093
3300032697|Ga0214499_1248359	Not Available	548
3300032812|Ga0314745_1130783	Not Available	506
3300032888|Ga0314728_114537	Not Available	612
3300032889|Ga0314751_1009759	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	1667
3300032890|Ga0314747_1002777	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2114
3300032959|Ga0314738_1063396	Not Available	666

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	97.20%
Environmental	Environmental	2.79%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	97.20%
Terrestrial	Environmental → Terrestrial	2.79%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	81.68%
Rhizoplane	Host-Associated → Plants → Rhizoplane	8.70%
Unclassified	Host-Associated → Plants → Unclassified	3.73%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.11%
Soil	Environmental → Terrestrial → Soil	2.79%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	81.68%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.70%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	3.73%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.86%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.55%
Loam	Environmental → Terrestrial → Soil → Loam	1.24%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.24%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	81.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.70%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	3.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.86%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.55%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.24%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.24%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	67.39%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	14.29%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	8.70%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	3.73%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.86%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.55%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.31%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.31%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated
3300009973	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG	Host-Associated
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017446	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300020031	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MG	Host-Associated
3300020223	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG	Host-Associated
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated
3300028055	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1	Host-Associated
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated
3300028057	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1	Host-Associated
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated
3300028139	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1	Host-Associated
3300028141	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1	Host-Associated
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated
3300028147	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1	Host-Associated
3300028150	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1	Host-Associated
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated
3300028251	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1	Host-Associated
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300028464	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1	Host-Associated
3300028466	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1	Host-Associated
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated
3300028474	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1	Host-Associated
3300028476	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1	Host-Associated
3300028477	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1	Host-Associated
3300028529	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1	Host-Associated
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032490	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032514	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032548	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032625	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032888	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032889	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032890	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032959	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070690_1016034771	3300005330	Switchgrass Rhizosphere	MYLSFKLYLSNEASNELLPKTKVVDLEILSKFGIQKFFI*GHVEGE
Ga0070689_1017142481	3300005340	Switchgrass Rhizosphere	MHLSFKLYLSNEASNELLPKTKVVDLEILSKFGIQKFFI*
Ga0070668_1019121962	3300005347	Switchgrass Rhizosphere	MHSSFNFYLSNEVSNEKVPKTKVVDLEILSKFGIQKFFI*
Ga0070669_1017970051	3300005353	Switchgrass Rhizosphere	MHPSFKFYLSNHCSIEKVPETKVEDLKILNNFRIQKFFI*
Ga0070688_1014160321	3300005365	Switchgrass Rhizosphere	MHSSFKFYLSNLCSNEKVPETKFEDLKILNNFRIQKFFI*
Ga0070667_1021047151	3300005367	Switchgrass Rhizosphere	MVPFQMYSSFKFYLSNEVSNELLAETKVVDLEILNNFGIQKFFI*GH
Ga0070702_1014573051	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	MHSSFKFYLSNHCSNEKVPETKVEDLKILNNFCIQKFFI*
Ga0068859_1003955911	3300005617	Switchgrass Rhizosphere	MHPSFKFYLSNHCSNEKVPETKVEDLKILNNFRIQKFFI*
Ga0068859_1023506852	3300005617	Switchgrass Rhizosphere	HSSFNFYLSNHCSNEKVPKTKVVDLEILNNFGIQEFFI*
Ga0068864_1019870831	3300005618	Switchgrass Rhizosphere	MHSSFKFYFSNEASNEKVTKMKVVDLEILSKFGIQKFFV*PREQ
Ga0068864_1026649042	3300005618	Switchgrass Rhizosphere	FQMHSSFNFYLSNEVSNEKVSKTKVVDLEIISKFDIQKFFILPLE*
Ga0068864_1026845191	3300005618	Switchgrass Rhizosphere	MHSSFKFYLSNEASNEFVPETKVVAFEVLNNFCIQNFFV*
Ga0068861_1010177662	3300005719	Switchgrass Rhizosphere	LFKRTQVSNFIFSNEASNEKVPKTKVVDLEILSKFDIQKFFI*
Ga0068861_1025956341	3300005719	Switchgrass Rhizosphere	MHSSFKFYFSNEASNELLPKTKVVDLEILNNFGIQKFFV*
Ga0068863_1007048634	3300005841	Switchgrass Rhizosphere	MHSSFNFYLLNETSNELFPKTKVVDLEILSKFGIQKFFI*
Ga0068863_1016492442	3300005841	Switchgrass Rhizosphere	MHTSFKFYLSNHCSNEKVPETKVEDLKILNNFRIQKFFI*
Ga0068863_1019417713	3300005841	Switchgrass Rhizosphere	MHSSFKFYLSNKASNEKVPKTKVVDLKILSKFDIQKFFI*
Ga0068863_1026262961	3300005841	Switchgrass Rhizosphere	MHPSFKFYLSNHCSNEKVPETKVEDLKILNNFRIQKFF
Ga0068858_1007372802	3300005842	Switchgrass Rhizosphere	MYLSFKLYLSNEASNELLPKTKVVDLEILSKFGIQKFFI*
Ga0068858_1008037012	3300005842	Switchgrass Rhizosphere	SSFKFYLSNYCSNGNVPKTKVVDLEILSKFGIQKFFI*
Ga0068858_1012325761	3300005842	Switchgrass Rhizosphere	MYSSFKFYLSNEASNELLPKMKVVDLEILSKFGIQKFFI*
Ga0068860_1011286502	3300005843	Switchgrass Rhizosphere	MHSSFIFYLSNEVSNEKVPKTKVVDLEILSKFGIQKFFI*
Ga0068860_1016922322	3300005843	Switchgrass Rhizosphere	MVPFQMYSSFKFYLSNEVSNELLPETKVVDLKILNNFGIQKFFI*
Ga0068860_1023391791	3300005843	Switchgrass Rhizosphere	MHSSFKFYLSNHYSNRNVPKTKVVDLEILSKFGIQKFFI*
Ga0068862_1013880191	3300005844	Switchgrass Rhizosphere	MHSSFNFYLSNEVSNEKVPKTKVVDLEILSKFGIQKFFV*
Ga0068862_1022409981	3300005844	Switchgrass Rhizosphere	MHSSFNFYLSNQCSNEKVPKTKVVDLEILNNFGIQEFFI*
Ga0068862_1027287812	3300005844	Switchgrass Rhizosphere	MYLSFKLYLSNKASNELLPKTKVVDLEILSKFGIQKFFI*
Ga0105249_123260261	3300009553	Switchgrass Rhizosphere	MRSSFKFYLLNHCSNGNVPKTKVVDLEILSKFGIQKFFI*GSEEG
Ga0105137_1062401	3300009972	Switchgrass Associated	IVPFQMRSSFKFYLSNHCSNEKVPKKKVVDLEILSKFGTHKFFI*
Ga0105136_1084642	3300009973	Switchgrass Associated	MRENFKLYLSNEASNELLPKTKVVDLKILSKLGIQNFFI*
Ga0105129_1001392	3300009975	Switchgrass Associated	FQMHSSFNFYLSNEVSNEKFPKIKVVDLEILNNFGIQEFLI*
Ga0105128_1032621	3300009976	Switchgrass Associated	MHPSFKYYLSTHCSNEKVPETKVEDLKILNNFRIQQFFIRSQK*
Ga0105128_1049252	3300009976	Switchgrass Associated	MHPSFKFYISNLCSNEKVSETKFEDLKILNNFRIQKFFI*
Ga0105128_1111972	3300009976	Switchgrass Associated	MHSSFNFYLSNQCSNEKVPKTKVVDLEILNNFGIQKFFI*
Ga0105135_1055871	3300009980	Switchgrass Associated	IGHFANAPKFKFYLSNHCSNEKVPETKVEDLKILNNFRIQKFFI*
Ga0105135_1283662	3300009980	Switchgrass Associated	IGYFQMHSSFKIYLSNEASNEKVPKTKVVDLKILNNFGIQKFFV*
Ga0105131_1037141	3300009989	Switchgrass Associated	MHSSFNFYLSNQCSNEKVPKTKVVALEILNNFGIQEFFF*
Ga0105132_1096501	3300009990	Switchgrass Associated	VPFQMYSSFKFYLSNEASNELLPETKVVDLEILNNFGIQKFFI*
Ga0105120_10104502	3300009992	Switchgrass Associated	MYSSFKFYLSNEASNELLPETKVVDLEILNNFGIQKFFI*
Ga0105139_10487861	3300009995	Switchgrass Associated	IGHFQMHSNFKLYLSNEASNELLPKTKVVDLEILSKFGILKFFI*
Ga0134125_107811451	3300010371	Terrestrial Soil	MHSSFKFYLSKEVSNEKVPKTKVVDLEILSKFGIQKFF
Ga0134126_105188292	3300010396	Terrestrial Soil	MYSSFNFYLSNQCSNEKVPKTKVVDLEILNNFGIQKFFV*
Ga0134127_126605001	3300010399	Terrestrial Soil	MHSSFNFYLSNQCSNEKVPKTKVVNLEILNNFGIQEFFI*
Ga0134121_108545701	3300010401	Terrestrial Soil	MHLSFKLYLSNEASNELFPKIKVVYLEILNNFGIQMFFV*GHEEG*
Ga0134121_119941421	3300010401	Terrestrial Soil	MHSSFNFYLSNIYSNEKVPETKVEDLKILNNFRIQKFFI*
Ga0157379_106669781	3300014968	Switchgrass Rhizosphere	MHSSFKFYLSNEASNEKVPKTKVVDLEILSKFDIQKFFI*
Ga0157379_107624971	3300014968	Switchgrass Rhizosphere	MHSSFKIYLSNEASNEKVPKTKVVDLEILNNFGIQKFFV*GH*
Ga0157379_123228683	3300014968	Switchgrass Rhizosphere	FQMHSSFKFYLSNEASNELLSKTKVVDLKILSKFGIKKFFI*
Ga0182183_10073183	3300015270	Switchgrass Phyllosphere	MYSSFKFYLSNEALNELLPKTKVVDLKILSKFDIQKFFI*
Ga0182183_10178551	3300015270	Switchgrass Phyllosphere	MHSSFKFYLSNHYLNEKVPETKVEDLKIWNNFHIQKFF
Ga0182183_10773061	3300015270	Switchgrass Phyllosphere	HSSFKFYLSNEASNELLPKTKVVDLEILSKFGIPKFLI*
Ga0182100_10318132	3300015280	Switchgrass Phyllosphere	VPFQMHSSFKFYFSNEASNEKVSKTKVVDLEILSKFDI*
Ga0182100_10753621	3300015280	Switchgrass Phyllosphere	MHSSFNFYLSNEVSNEKVPKTKVVDLEILSKFGIQKFFI*SHE
Ga0182100_10820861	3300015280	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEFVPKTKVVDLEILSKFGIQKFFV*
Ga0182101_10338471	3300015284	Switchgrass Phyllosphere	MHPSFKYYLSNHYSNEKVPETKVVDLEILNNFGIQEFFI*
Ga0182101_10521923	3300015284	Switchgrass Phyllosphere	MHSSFKFYLSNHCSNEKVSETKVEDLKILKNFHIK
Ga0182105_10305023	3300015290	Switchgrass Phyllosphere	MHSSFKFYFSNEASNEKVAKMKVVDLEILSKFDIQNFFI*
Ga0182103_10975951	3300015293	Switchgrass Phyllosphere	KFYFSNHCSNELLPKTKVVDLEILSKFGIQEFFI*
Ga0182104_10095192	3300015297	Switchgrass Phyllosphere	MHSSFNFYLSNQCSNEKVPKTKVVDLEILSKFDIQKFLI*
Ga0182104_10122271	3300015297	Switchgrass Phyllosphere	MYSSFKFYLSNEVSNELLPETKVVDLEILNNFGIQKFFI*
Ga0182104_10144061	3300015297	Switchgrass Phyllosphere	FKFYFSNEASNELLPKTKVVDLEILNNFGIQKFFV*
Ga0182104_10163091	3300015297	Switchgrass Phyllosphere	MHSSFKFYLSNQYSNGNVAKMKVVDLEVLSKFDIQKFFI*
Ga0182104_10396112	3300015297	Switchgrass Phyllosphere	MHPSFKFYLSNHCSNEKVPETKVEDLKILNNFRIQKFFI*GQEQGEK
Ga0182104_10505802	3300015297	Switchgrass Phyllosphere	MHSSFKFYLSNEASNELFPKMKVVDLEILNNFGIQKFFV*
Ga0182104_10538042	3300015297	Switchgrass Phyllosphere	QMHSSFKFYLSNHCSNEKVSKTKVVDLEILSKFGIQKFFI*
Ga0182184_10083351	3300015301	Switchgrass Phyllosphere	HFLMHSSFKFFLSNKASNEKVPKTKVVDLEILSKFDIQKFFI*
Ga0182184_10365742	3300015301	Switchgrass Phyllosphere	SSFKFYFSNEASNEILPKTKVVDLEILNNFGIQKFFV*
Ga0182184_10367701	3300015301	Switchgrass Phyllosphere	MHSSFKFNLSNHYSNEKVPEIKVEDLKMLNNFRIQKFFI*
Ga0182184_11007012	3300015301	Switchgrass Phyllosphere	KFYLSNHCSNEKVPETKVKDLKILNNFRIQKFFI*
Ga0182180_10242932	3300015306	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEKVPKMKVVDLEILSKFGIQKFFI*
Ga0182180_10355471	3300015306	Switchgrass Phyllosphere	NFALIRTFSIAPKFGNFYLSNLCSNEKVLETKVEDLKIVNNFRVQKFFI*
Ga0182180_10448201	3300015306	Switchgrass Phyllosphere	MNSRFKFYFSNHCSNELLPKTKVVDLEILNNFGIQEFFI*GQEEGEKL
Ga0182180_10452942	3300015306	Switchgrass Phyllosphere	MHTSFKFYISNKASNEFVPEKKVVAFEVLNNFHIQKIFV*
Ga0182180_10491031	3300015306	Switchgrass Phyllosphere	MGAKLISESIGYFQMHSSFKFYLSNKVSNEKVPKMKVVDLEFLSKFG
Ga0182098_10350423	3300015309	Switchgrass Phyllosphere	MHSSFNFYLSNQCSNEKVPKTKVVDIEILNNFGIQEFFI*
Ga0182098_10580091	3300015309	Switchgrass Phyllosphere	MHLSFKLYLSKEASNELLPKTKVVDLEILSKFGIQKFFV*
Ga0182098_10677251	3300015309	Switchgrass Phyllosphere	MHSSFKFYLSNHCSNEKVSKTKVEDLKILINFCIKQFFV
Ga0182098_11015881	3300015309	Switchgrass Phyllosphere	MHSTFNFYLSNQCSNEKVPKTKVVDLEILNNFGIQEFVI*
Ga0182162_10047861	3300015310	Switchgrass Phyllosphere	MVPFKMYSSFKFYLSNEASNELLPETKVVDLEILNNFGIQKFFI*
Ga0182162_10465391	3300015310	Switchgrass Phyllosphere	KFYLSNEASNELLPKTKVVDLKILSKFGIKKFFM*
Ga0182162_10928241	3300015310	Switchgrass Phyllosphere	MHSSFNFYLSNEVSNEKVPKTKVVDLEILSKFGIQKF
Ga0182162_10985562	3300015310	Switchgrass Phyllosphere	KFYLSNEASNEFVPETKVVAFEVLNNFCTQKFFV*
Ga0182182_10865821	3300015311	Switchgrass Phyllosphere	HSSFKFYLSNQCSNEKVPETKVEDLKILNNFRIQKFFI*
Ga0182168_10245701	3300015312	Switchgrass Phyllosphere	IGYFQMHSNFKFYLSNEVSNEFVPKMKVVDLEILSKFGIQKFFI*
Ga0182168_10455952	3300015312	Switchgrass Phyllosphere	SFKFYLSNHCSNEKVPETKVEDLKILNNFRIQKFFI*
Ga0182164_10115982	3300015313	Switchgrass Phyllosphere	HSSFNFYLLNKASNELLPKTKVVDLEMLNNFGIQEFFI*
Ga0182164_10474892	3300015313	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEFVPETKVVAFEVLNNFRIQKFFV*PRE
Ga0182164_10578402	3300015313	Switchgrass Phyllosphere	MHSSFNFYLSNEASNEFVPKMKDLEILSKFGIQKFFI*
Ga0182164_10797401	3300015313	Switchgrass Phyllosphere	VLKFYLSNLCSNEKVPETKVEDLKILNNFRIQKFFI*
Ga0182164_10847571	3300015313	Switchgrass Phyllosphere	MHSSFKFYLSNKVSNEKVPKTKVVYLEILSKFGIQKF
Ga0182164_11178581	3300015313	Switchgrass Phyllosphere	MHLSFKLYLSNEASNELLPKTKVVDLEILSKFGIQKFFV*
Ga0182121_10128722	3300015316	Switchgrass Phyllosphere	MHSSFNFYLSNQCSNEKVPKTKVVELEILNNFGIQEFFI*
Ga0182121_10240931	3300015316	Switchgrass Phyllosphere	MYSSFNFYLSNQCANEKVTKTKVVDIEILSKFGIQKFFI*
Ga0182136_10856263	3300015317	Switchgrass Phyllosphere	FNFYLLNETSNELLPKTKVVDLEILSKFGIQKFFI*
Ga0182136_10945601	3300015317	Switchgrass Phyllosphere	KFYLSNHYSNEKVPEIKVEDLQILNNFRIQKFFL*
Ga0182136_10995992	3300015317	Switchgrass Phyllosphere	IGHFQMHSSFKFYLSNEASNEKVPKTKVVDLEILSKFNIQKFFI*
Ga0182181_10211493	3300015318	Switchgrass Phyllosphere	HSSFNFYLSNEVSNEKVTKTKIVDLEILSKFGIQKFFI*
Ga0182181_10604951	3300015318	Switchgrass Phyllosphere	KCIEPFQMHSSFKFYLSNEASNEILPKTKVVGLEILSKFGIKKFFI*
Ga0182181_10819091	3300015318	Switchgrass Phyllosphere	LFKCTQVSKFYLSNEVSNELLPETKIVDLEILNNFGIQKFFI*
Ga0182181_11067171	3300015318	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEFGPKTKVVAFEVLNKFHIQKFFV*PRE
Ga0182130_10053282	3300015319	Switchgrass Phyllosphere	MHSSFNFYLLNETSNELLPKTKVVDIEILSKFGIQKFFI*
Ga0182165_10435722	3300015320	Switchgrass Phyllosphere	KFYLSNEVSNELLPETKVVDLEILNNFGIQKFFI*
Ga0182165_10626331	3300015320	Switchgrass Phyllosphere	MHSSFKFYFSNEASNELLPKTKVVDLEILNNFGIQEFFF*
Ga0182165_10839953	3300015320	Switchgrass Phyllosphere	FQMHSSFNFYLSNQCSNEKVPKTKVVDIEILNNFGIQEFFI*
Ga0182134_10068081	3300015324	Switchgrass Phyllosphere	HLSFKLYLSNEASNELLPKTKVVDLEILSNFGIQKFFI*
Ga0182134_10748101	3300015324	Switchgrass Phyllosphere	KFYLSNKVSNEKVPKTKVVDLKILSKFDIQKFFI*
Ga0182134_10772152	3300015324	Switchgrass Phyllosphere	MHSSFKFYLSNHCSNEKVPETKVEDLKILNNFHIQKFFI*
Ga0182134_10933441	3300015324	Switchgrass Phyllosphere	HIVFFFQMHSSFKLYLSNEASNELLPKTKVVDLEILNNFGIQKFFI*
Ga0182134_11017191	3300015324	Switchgrass Phyllosphere	HKYGRKSGYFQMHSSFKFYFSNHYSNEKVPKTKVVDLEILRKFGIQKFFI*
Ga0182148_10754571	3300015325	Switchgrass Phyllosphere	HSSFKFYFSNEASNELLPKTKVVDLEILNNFGIQKFFV*
Ga0182148_10784502	3300015325	Switchgrass Phyllosphere	MHSSFNFYLSNQCSTEKVPKTKVVDIEILNNFGIQEFFI*
Ga0182148_10839851	3300015325	Switchgrass Phyllosphere	MHSSFNFYLSNHYSNEKVPKTKVVDLENLRKFDIQKFLI*
Ga0182148_10978901	3300015325	Switchgrass Phyllosphere	MYSSFKFYLSNEASNELLPKTKIVDLEILRKFGIQKF
Ga0182148_11221061	3300015325	Switchgrass Phyllosphere	LFQMHSSFKFYLSNHYSNGNVPKTKVVDLEILSKFCIQKFFI*
Ga0182148_11279471	3300015325	Switchgrass Phyllosphere	KFYLSNEASNELLPKTKVVDLEILSKFGIQKFFI*
Ga0182166_10779771	3300015326	Switchgrass Phyllosphere	KFYLSNLCSNEKVPETKVEDLKILNNFRIQKFFI*
Ga0182166_11424491	3300015326	Switchgrass Phyllosphere	MHSSFNFYLSNEVSNEKVPKTKVVDLEILSKFGIQKFF
Ga0182114_10556443	3300015327	Switchgrass Phyllosphere	MHSSFKFYLLNEASNELLLKTKVVDLEILSKFGIQKFFI*
Ga0182114_10644452	3300015327	Switchgrass Phyllosphere	MHSSFKFYFSNEASNEKVTKTKVVDIEILSKFGIQKFFI*
Ga0182114_11228971	3300015327	Switchgrass Phyllosphere	MHSSFKFYLSTETSNEKVPKMKVVDLEILSKFDIQKFLI*PLE*
Ga0182114_11565711	3300015327	Switchgrass Phyllosphere	MHTSFKFYLSNHCSNEKVPETKVEDLKILNNFRIQKFFI*GQEQGEK
Ga0182114_11585231	3300015327	Switchgrass Phyllosphere	CTQVSNFIFSNHCSNEKVPKTKVVDLEILSKFGIQKFFV*
Ga0182153_10308082	3300015328	Switchgrass Phyllosphere	VHSSFKFYLSNHCSNIKVPETKVEDLKIFNNFGIQKFFI*
Ga0182135_10238942	3300015329	Switchgrass Phyllosphere	FQMHSSFKFYLSDEASNEFVPKTKVVDLEISSKFDIHKFSI*
Ga0182135_10409811	3300015329	Switchgrass Phyllosphere	MHSSFNFYLSNEISNEKVPKTKVIDLEILSKFGIQKFFI*
Ga0182135_10807412	3300015329	Switchgrass Phyllosphere	SSFKFYLSNHCSNEKVPETKVEDLKILKHFRIQKFFI*
Ga0182135_11217211	3300015329	Switchgrass Phyllosphere	HSSFKIYFSNHCSNEKVPKTKVVDLEILRKFGIQKFFV*
Ga0182152_10268692	3300015330	Switchgrass Phyllosphere	FKFYFSNKASNELLPKTKVVDLEILNNFVIQKFFV*
Ga0182152_11378212	3300015330	Switchgrass Phyllosphere	RTGHFQMYLSFKLYLSNEASNELLPKTKVVDLEILSKFGIQKFFI*
Ga0182131_10057241	3300015331	Switchgrass Phyllosphere	LSFKLYLSNEASNELLPKTKVVDLEILSKFGIQKFFI*
Ga0182131_10156731	3300015331	Switchgrass Phyllosphere	MYSSFKFYISNEASNELLSKTKVVDLEILSKFGIQKFFV*
Ga0182147_10185522	3300015333	Switchgrass Phyllosphere	MHSSFKIYLSNEASNEKVPKIKVVDLKILNNFGIQKFFV*
Ga0182147_10528321	3300015333	Switchgrass Phyllosphere	MHSSFNFYLSNQCSNEKVPKTKVVDLEILSKFDIQKFFI*
Ga0182147_11514651	3300015333	Switchgrass Phyllosphere	MHLSFKFYLSNEASNEKVPKTKVVDQEILSTFGIQKVFI*
Ga0182147_11543922	3300015333	Switchgrass Phyllosphere	MHTSFKFYISNKASNEFVPETKVVAFEVLNNFHIQKIFV*
Ga0182147_11703691	3300015333	Switchgrass Phyllosphere	MYSSFNFYLLNETSNELLPKTKVVDLEILSKFGIQKF
Ga0182132_10193661	3300015334	Switchgrass Phyllosphere	MYKILFFSNDASNELLPKTKVVDIEILRKFGIQKFFI*
Ga0182132_10819832	3300015334	Switchgrass Phyllosphere	FQMHSSFKFYFSNHCSNEKVPKTKVVDLKILSKFGIQKFFV*
Ga0182132_11197143	3300015334	Switchgrass Phyllosphere	HFLMHSSFKFYLSNKASNEKVPKTKVVDLEILSKFDIQKFFI*
Ga0182132_11564191	3300015334	Switchgrass Phyllosphere	RYSQMHSSFNFYLSNQCTNEKVPKTKVVDLEILNNFGIQEFFF*
Ga0182116_10121461	3300015335	Switchgrass Phyllosphere	MHSSFNFYLSNEVSNEKVPKTKVVDLEILNNFGIQKFFI*
Ga0182116_10297971	3300015335	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEKVPKTKVVDIEILSKFYIQKFFI*
Ga0182116_10604162	3300015335	Switchgrass Phyllosphere	RHFQMHSSFNFYLLNETSNELLPKTKVIDIEILSKFGIQKFFI*
Ga0182116_11399902	3300015335	Switchgrass Phyllosphere	IRYFQMHSSFNFYLSNQYSNEKVAKTKVVDLEILRKFDIQKFLI*
Ga0182116_11620921	3300015335	Switchgrass Phyllosphere	MHSRFKFYLSNEASNELLPKMKVVDLEILNNFGIQKFFV*G
Ga0182116_11758421	3300015335	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEFVPKTKVVDLEILSKFGIHKFFI*GQ
Ga0182150_10619971	3300015336	Switchgrass Phyllosphere	MHSSFNFYLSNHCSNEKVPKTKVVDIEILNNFGIREFFI*
Ga0182150_10635462	3300015336	Switchgrass Phyllosphere	MHTSFKFYISNKASNEFVPEKKVVAFEVLNNFGIQKFFI*
Ga0182150_10943801	3300015336	Switchgrass Phyllosphere	MYIGYFQMNSSFKFYLSNEASNEFVPKTKVVDLEILSKFG
Ga0182150_11453982	3300015336	Switchgrass Phyllosphere	HSSFKFYLSNHCSNVNVPKMKAVDLEILSKFDIQKFFI*
Ga0182150_11615731	3300015336	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEKVPKTKVVDLEILSKFDIQKFFI*PLE*
Ga0182151_10178162	3300015337	Switchgrass Phyllosphere	MHSSFNFYLLNETSNELLPKTKVVDLEILSKFGIQKFFI*
Ga0182151_10217872	3300015337	Switchgrass Phyllosphere	MHSSFNFYLSNQCSNEKVPKTKVVDLEILNNFGIREFFI*
Ga0182151_10341503	3300015337	Switchgrass Phyllosphere	MHPSFKFYLSNLYSNEKVPETKFEDLKILNNFRIQKFFI*
Ga0182151_10568362	3300015337	Switchgrass Phyllosphere	IGHFQVHSSFKFYLSNHCSNKKVTETKVEDLKILNNFRIQKFFI*
Ga0182151_11456581	3300015337	Switchgrass Phyllosphere	FQMHSSFKFYFSNEALNEKVPITKVVDLEILSKFDFQEIFI*
Ga0182137_10281852	3300015338	Switchgrass Phyllosphere	LKFYLSNHCSNEKVLETKVEDLKILNNFHIQNFFI*
Ga0182137_10423141	3300015338	Switchgrass Phyllosphere	MHSSFNFYLSNQCSNEKVPKIKVVDLEILNNFGIQEFF
Ga0182137_11225842	3300015338	Switchgrass Phyllosphere	KFYLSNEVSNELLPETKLVDLEILNNFGIQKFFI*
Ga0182149_10500812	3300015339	Switchgrass Phyllosphere	MHSSFNFYILNKASNELLPKTKVVDLEILNNFGIQEFFI*
Ga0182149_10637821	3300015339	Switchgrass Phyllosphere	FSNAFKFPFYLSNQCLNEKVPKTKVVDLEILNNFCIQEFFI*
Ga0182149_11133651	3300015339	Switchgrass Phyllosphere	MHLSFKLYLSNEALNELLPKTKVVDLEILSKFGIQKFFI*
Ga0182133_10724631	3300015340	Switchgrass Phyllosphere	KFYLSNEASNELFPKMKVVDLEILNNFGIQKFFI*
Ga0182133_10883472	3300015340	Switchgrass Phyllosphere	VHFQIHSSFKFYLSNEASNEKVTKTKVVDLEILSKFGIQKFFI*
Ga0182133_11199402	3300015340	Switchgrass Phyllosphere	QVSNFYLSNEASNEKVTKTKVVDLEILSKFGIQKFFV*
Ga0182133_11563691	3300015340	Switchgrass Phyllosphere	IGHFQMHSSFKFYLSNEASNEKVPKTKVVDLEILSKFGIQKFFI*
Ga0182133_11571281	3300015340	Switchgrass Phyllosphere	MHSSFNFYFSNEASNELFPKTKVVDLEILRKFGIQKFFI*
Ga0182133_11630932	3300015340	Switchgrass Phyllosphere	FKFYFSNKASNELLPKTKVVDLEILNNFGIQKFFI*
Ga0182133_11646362	3300015340	Switchgrass Phyllosphere	MHPSFKFYLSNHCSIEKVPETKVEDLKILNNFRIQKFLI*
Ga0182115_10714992	3300015348	Switchgrass Phyllosphere	MVPFQMYSSFKFYLSNEASNELLPETKVVDFEILNNFGIQKFFI*
Ga0182115_10738363	3300015348	Switchgrass Phyllosphere	MYSSFKFDISNKASNELLPKTKVVDLEILSKFGIQKFLI*
Ga0182115_12426872	3300015348	Switchgrass Phyllosphere	FNFYLSNQCSNEKVHKTKVVDLEILNNFGIQEFFI*
Ga0182115_12470893	3300015348	Switchgrass Phyllosphere	QMYSSFNFYLSNQCANEKVTKTKVVDIEILSKFGIQKFFI*
Ga0182115_12585502	3300015348	Switchgrass Phyllosphere	MHTSFKFYISNKASNEFVPEKKVVAFEVLNNFHIQKFFV*
Ga0182115_12961451	3300015348	Switchgrass Phyllosphere	YTQVSNFYLSNEASNEKVPKTKVVDLEILSKFSIHKFFI*
Ga0182185_10636162	3300015349	Switchgrass Phyllosphere	QMYSSFKFYLSNEVSNEHLPETKVVDLEILNNFGIQKFFV*
Ga0182185_11127901	3300015349	Switchgrass Phyllosphere	SFKFYLSNHCSNEKVPKMKVVDLEILSKFGIQEFFI*
Ga0182185_11283582	3300015349	Switchgrass Phyllosphere	MYSSFKFYFSNEASNEFLPKTKVVDLEILSKFGIQKFFI*
Ga0182185_11941541	3300015349	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEKVPKTKVVDLEILSKFGIQKFFI*P
Ga0182185_12792461	3300015349	Switchgrass Phyllosphere	VHSNFKFYLSNHYSNGNVPKTKVADLEILSKFGIQKFF
Ga0182163_11260702	3300015350	Switchgrass Phyllosphere	MYSSFKIYFSNEVSNEKVTKTKVVDLEILSKFGIQKFFI*
Ga0182163_11298021	3300015350	Switchgrass Phyllosphere	GYFQMHSSFKFNLSNEGSNEFVAKTKVVDLEILSKFGIHKFFI*
Ga0182163_11349732	3300015350	Switchgrass Phyllosphere	MHSSFKFYLSNEASIELFPKMKVVDLEILNNFGIQKFFV*
Ga0182163_11379332	3300015350	Switchgrass Phyllosphere	MHSSFKFYLSNKISNEKVPKMKVVDLEILSKFDIQKFFV*
Ga0182163_12114861	3300015350	Switchgrass Phyllosphere	RIGPFQMHSSFKFYISNEASNELLPKTKVVDIKISSKFGIQKFFI*
Ga0182163_12271841	3300015350	Switchgrass Phyllosphere	HSSFNFYLSNQCSNEKVPKTKVVDLEILNNFGIQKFFV*
Ga0182163_12418202	3300015350	Switchgrass Phyllosphere	IVPFQMHSSFKFYFSNEASNEKVPKMKVVDLEILSKFFI*
Ga0182169_10560781	3300015352	Switchgrass Phyllosphere	MVPFQMYSSFKFYLSNEVSNELLPETKVVYLEILNNFGIQKFFI*
Ga0182169_10743643	3300015352	Switchgrass Phyllosphere	KHIGPFQMHSSFKFYLSNHCSNEKLPKTKVVDLEILSKFGIQEFFI*
Ga0182169_10771952	3300015352	Switchgrass Phyllosphere	FKFYLSNLCSNEKVPETKVEDLEILNNFRIQKFSI*
Ga0182169_11836632	3300015352	Switchgrass Phyllosphere	MHSSFNFYLSYQCSNEKVPKTKVVDLEILNNFGIQEFVI*
Ga0182169_12874361	3300015352	Switchgrass Phyllosphere	MHSSFNFYLLNKASNELLPKTKVVDLEILNNFGIQEFFI
Ga0182169_13103643	3300015352	Switchgrass Phyllosphere	MHSSFKFYLSNQCSNEKVPETKVEDIKILNNFRIQKFFI*DKEKGEKLN
Ga0182179_10855731	3300015353	Switchgrass Phyllosphere	SSFKFYLSNKASNEKVPKTKVVDLEILNKFDIQKFFI*
Ga0182179_11237151	3300015353	Switchgrass Phyllosphere	FNFYLSKEVSNEKVPKTKVADLESLSKFSIQKFFI*
Ga0182179_11284412	3300015353	Switchgrass Phyllosphere	IQHFQIHSSFNFYLSNLCSNEKVPKTNVVDLEILNNFGIQEFFI*
Ga0182179_12034411	3300015353	Switchgrass Phyllosphere	MHSSFNFYILNETSNELLPKTKVVDLEILNNFGIQKFFV*
Ga0182179_12531002	3300015353	Switchgrass Phyllosphere	MYSSFKFYFSNEASNEKVTKTKVVDIEILSKFGIQKFFI*
Ga0182167_11354891	3300015354	Switchgrass Phyllosphere	IRHFQMHSSFNFYLLNETSNELLPKTKVVDLEILSKFGIQKFFI*
Ga0182167_12020962	3300015354	Switchgrass Phyllosphere	MHSSFKFYLSNHYSNEKVPETKVEDLKILNNFHIQKFFI*
Ga0182167_12091721	3300015354	Switchgrass Phyllosphere	FQMHSSFNFYLSNQCSNEKVSKTIVVDLEILNNFGIQNFFV*
Ga0182197_10847121	3300017408	Switchgrass Phyllosphere	MHSSFKFYLSNHYSNENVPETKVEDLKIWNNFRIQKFFIRD
Ga0182197_10940721	3300017408	Switchgrass Phyllosphere	MHPSFKYYLSNHCSNEKVPETKVVDLEILNNFGIQEFFI
Ga0182197_11088591	3300017408	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEFVPETKVVAFDVLNNFRIQKFFV
Ga0182199_10266231	3300017412	Switchgrass Phyllosphere	RHFQMHSSFNFYLLNETSNELLPKTKVVDLEILSNFGIQKFFI
Ga0182199_10642892	3300017412	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEKVPKTKVVDLEILSKFVIQKFFI
Ga0182199_12071121	3300017412	Switchgrass Phyllosphere	MYSSFKFYLSNEVLNELLPETKVVDLEILNNFGIQKFFI
Ga0182195_10100941	3300017414	Switchgrass Phyllosphere	KYTQVSIFYHSNEASNEKVPKMKVVYFKILSKFGIQKFFV
Ga0182195_10737871	3300017414	Switchgrass Phyllosphere	GNFQMHSSFKFYLSNEVSNELLPTMKVVDIEILNNFGIQKFFV
Ga0182195_11451852	3300017414	Switchgrass Phyllosphere	HSSFKFYVSNHCSNEKVPETKVEDLKILNNFRIQKFFI
Ga0182195_12122261	3300017414	Switchgrass Phyllosphere	MHLGFKFYVSNLCSNEKVPETKVEDLEILNNFRIQKFFI
Ga0182213_11273641	3300017421	Switchgrass Phyllosphere	PFQMYSSFKFYLSNEVSNELLPETKVVYLEILNNFGIQKFFI
Ga0182213_11841421	3300017421	Switchgrass Phyllosphere	MHSSFKFYISNEASNELLPKTKVVDLKISSKFGIQKFFI
Ga0182213_12136051	3300017421	Switchgrass Phyllosphere	RHFQMHSSFNFYILNETSNELLPKTKIVDLEILSKFGIQKIFI
Ga0182201_10850811	3300017422	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEKVPKTKVVDIEILSKFDIQKFFIXPLE
Ga0182201_11121612	3300017422	Switchgrass Phyllosphere	MHSSFNFYLSNQCSNEKVPKTKVADLEILNNFGIQEFFG
Ga0182196_10089111	3300017432	Switchgrass Phyllosphere	MHSSFEFYFSNEASNEKVPKTKIVDLEILSKFDIQNFFV
Ga0182196_10372371	3300017432	Switchgrass Phyllosphere	MYSSFKFYFSNEASNELLPKMKVVDLEILNNFGIQKFFV
Ga0182196_11042091	3300017432	Switchgrass Phyllosphere	SFKFYLSNHCSNEKVPETKVEDLKILNNFRIQKFFN
Ga0182196_11124081	3300017432	Switchgrass Phyllosphere	MYSSFKFYLSNEASNEILTKTEVVDLEILSKFGIQ
Ga0182196_11448111	3300017432	Switchgrass Phyllosphere	MHSSFKFYFSNHYSNEKVPKTKVVDLEILSKFGIQKFFV
Ga0182194_10307701	3300017435	Switchgrass Phyllosphere	SFNFYLLNETSNELLPKTEVVDLEILSKFGIQKFFI
Ga0182194_11085461	3300017435	Switchgrass Phyllosphere	MHSSFKIYLSNEASNEKVTKIKVVDLEILNNFGIQKFFVXGHE
Ga0182200_10618132	3300017439	Switchgrass Phyllosphere	MYSSFNFYLSNQCANEKVTKTKVVDIEILSKFGIQKFFI
Ga0182214_10225141	3300017440	Switchgrass Phyllosphere	MYSSFKFYLSNEVSNELFPETKVVDLEILNNFGIQKFFI
Ga0182214_10443951	3300017440	Switchgrass Phyllosphere	HFQIHSSFEFYLSNEASNEKVPKTKVVDLEILNNFGIQKFFV
Ga0182214_11002921	3300017440	Switchgrass Phyllosphere	MHSNFKLYLSNEASNEKVPKTKVVDLEILSKFGIQ
Ga0182214_11407991	3300017440	Switchgrass Phyllosphere	QMHSCFKFYLSNHYSNEKVPEIKVEDLQILNNFRIQKFFI
Ga0182198_11176081	3300017445	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEKVPKTKVVDIEILSKFYIQKFFIXPLE
Ga0182198_11834831	3300017445	Switchgrass Phyllosphere	SSFKIYLSNEASNEKVPKTKVVDLEILNNFGIQKFFV
Ga0182217_11231551	3300017446	Switchgrass Phyllosphere	MHLSFKLYLSNEASNELLLKTKVVDLEILSKFGIQKFFIXGHVE
Ga0182215_10826912	3300017447	Switchgrass Phyllosphere	QMHSSFNFYLSNQCSNEKVPETKVEDIKILNNFRIQKFFI
Ga0182215_11276221	3300017447	Switchgrass Phyllosphere	CFQMYSSFNFYLSNQCANERVPKTKVVDLEILNNFGIQKFFI
Ga0182215_11551021	3300017447	Switchgrass Phyllosphere	CFQMYSSFNFYLSNQCANERVPKMKVVDLEILNNFGIQKFFI
Ga0182212_11223643	3300017691	Switchgrass Phyllosphere	SKRIVPFHMHSSFKFYFSNEASNELLPKTKVVDIEILSKFGIQKFFI
Ga0182212_11612052	3300017691	Switchgrass Phyllosphere	FQMYSSFKFYLSNEVSNELFPETNVVDLEILNNLGIQKFFI
Ga0182210_10989421	3300017692	Switchgrass Phyllosphere	MHSSFKFYLSNHCSNEKVSKTKVVDLEILSKFGIQKFFIXGKETGEK
Ga0182210_11557922	3300017692	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEKVPKTKVVDLEILSKFGIQKFFS
Ga0182216_10888231	3300017693	Switchgrass Phyllosphere	QMYSSFKFYLSNEVSNELLPETKVVDLEILNNFGIQKFFI
Ga0182216_10955631	3300017693	Switchgrass Phyllosphere	MHSSFKFYLSNKVSNEKVPKTKVVDLEILSKFDIQK
Ga0182216_11228211	3300017693	Switchgrass Phyllosphere	MHSSFKFYLSNEVSNEKVPKTKVVDLEILGKFYIQKFFIXPLE
Ga0182216_12129301	3300017693	Switchgrass Phyllosphere	PFQMYSSFKFYFSNEVSNEKVTKTKVVDLEILSKFGNQNFFI
Ga0182211_10255361	3300017694	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEKVPKTKVVDLKILSKFDIQKFFI
Ga0182211_11255611	3300017694	Switchgrass Phyllosphere	MHSSFKFYLSNHYSNGNMPKTKVVDLEILSKFGIRKFFV
Ga0182211_11385741	3300017694	Switchgrass Phyllosphere	MHSSFKFYLSNEASNEKVAKTKVVDLEILSKFDIQKFFI
Ga0182119_1002182	3300020031	Switchgrass Phyllosphere	MYLSFKLYLSNEASNELLAKTKDVDLEILSKFGIQ
Ga0182118_1014143	3300020223	Switchgrass Phyllosphere	MHSSFKFYLSNEASNENVPKTKVVDLEILSKFDIQKFFI
Ga0207668_105128771	3300025972	Switchgrass Rhizosphere	FQMYLSFKLYLSNEASNELLPKTKVVDLEILSKFGIQKFFI
Ga0207668_106329573	3300025972	Switchgrass Rhizosphere	FQMHSSFNFYLSNEVSNEKVPKTKVVDLEILSKFGIQKFFI
Ga0207658_119986941	3300025986	Switchgrass Rhizosphere	FKLYLSNEASNELLPKTKVVDLEILSKFGIQKFFI
Ga0207641_112581782	3300026088	Switchgrass Rhizosphere	MVTFQMYSSFKFYLSNEVSNELLPETKVVDLEILNNFGIQKFFV
Ga0207641_119475032	3300026088	Switchgrass Rhizosphere	IGHFQMHSSFKFYFSNEASNEKVPKTKVVYLEILSEFGIQNIFI
Ga0207676_112500721	3300026095	Switchgrass Rhizosphere	MHSSFKFYLSNEASNEFVPETKVVAFEVLNNFRIQKFFV
Ga0207676_113922702	3300026095	Switchgrass Rhizosphere	YLRFKLYLSNEASNELLPKTKVVDLEILSKFGIQKFFI
Ga0207675_1005318722	3300026118	Switchgrass Rhizosphere	MHSSFNFYLSNQCSNEKVPKTKVVDLEILNNFGIQEFFI
Ga0207675_1011544591	3300026118	Switchgrass Rhizosphere	MHSSFNFYLSNEVLNEKVPKMKVVDLKMLSKFDIQNIFI
Ga0268322_10034601	3300028049	Phyllosphere	MHSSFNFYLSNEVSNEKVPKTKVVDLEILSKFGIQKFFI
Ga0268322_10186401	3300028049	Phyllosphere	MYSSFKFYLSNEVSNELLPETKVVDLEILNNFGIQKFFI
Ga0268322_10341342	3300028049	Phyllosphere	RYFQIHSSFKFYFSNEASNELLPKTKVVDLEILNNFGIQEFFV
Ga0268322_10344991	3300028049	Phyllosphere	FNFYLSNQCSNEKVPKTKVVDLEILNNFGIQEFFI
Ga0268328_10005191	3300028050	Phyllosphere	VPFQMHSSFEFYFSNEASNEKVPKTKVVDIEILSKFDIQKFFI
Ga0268328_10595271	3300028050	Phyllosphere	MHSSFKIYFSNHCSNEKVPKTKVVDLEILRKFGIQKFFV
Ga0268328_10675411	3300028050	Phyllosphere	CIVHFQIHSSFEFYLSNEASNEKVPKTKVVDLEILNNFGIQEFFI
Ga0268344_10194121	3300028051	Phyllosphere	MHSSFKFYLSNEASNEKVPKTKVVDLEILSKFDIQKFFI
Ga0268346_10048492	3300028053	Phyllosphere	MYLSFKLYLSNEASNELLPKTKVVDLEILSKFGIQKFFI
Ga0268306_10044853	3300028054	Phyllosphere	HSSFKFYLSNEASNEFVPETKVVEFEVLNNFRIQKFFV
Ga0268306_10078802	3300028054	Phyllosphere	MYLSFKLYLSNEASNELLPKTKVVDLEILSKFGIQKF
Ga0268306_10087701	3300028054	Phyllosphere	MVPFQMYSSFKFYLSNEVSNELLPETKVVDLEILNNFGIQKFFI
Ga0268306_10113231	3300028054	Phyllosphere	QMHSSFNFYLSNQCSNEKVPKTKVVDIEILNNFGIQEFFI
Ga0268338_10415381	3300028055	Phyllosphere	MYSSFKFDLSNEASNELLPKTKVVDLEILSKFGIQK
Ga0268330_10139381	3300028056	Phyllosphere	MYSSFKFYLSNEASNEFLSKTKVVNLEILSKFGIQKFFIXGHVEGEKF
Ga0268330_10512922	3300028056	Phyllosphere	VALNRTFSMHPSFKFYLSNHCSNEKVPETKVEDLKILNNFRIQKFFI
Ga0268352_10195552	3300028057	Phyllosphere	MHPSFKFYLSNHCSNEKVPETKVEDLKILNNFRIQKFFI
Ga0268332_10136941	3300028058	Phyllosphere	MQKSFKFYLSNLCSNEKVPETKVEDLKILNNFRVQKFFI
Ga0268332_10468821	3300028058	Phyllosphere	HMHSSFKFYFSNEASNELLPKTKVVDLEILNNFGIQKFFV
Ga0268332_10650201	3300028058	Phyllosphere	MYSSFNFYLSNQCENEKVPKTKVVDLEILNNFGIQKFFI
Ga0268314_10053022	3300028061	Phyllosphere	MHLSFKLYLSTEASNELLPKTKVVDLEIWNNFGIQKFFI
Ga0268314_10308281	3300028061	Phyllosphere	MHSTFNFYLSNQCSNEKVPKTKVVDLEILSKFDIQKFFVXGHVEGE
Ga0268340_10615591	3300028064	Phyllosphere	MHSTFNFYLSNQCSNEKVPKTKVVDLEILSKFDIQKFFVXGH
Ga0268355_10144632	3300028139	Phyllosphere	SMHTSFKFYLSNHCSNEKVPETKVEDLKILNNFRIQKFFI
Ga0268326_10113091	3300028141	Phyllosphere	MHSSFKFYLSNEASNENVPKTKVVDLEILSKFDIQKFFIXPLE
Ga0268347_10098422	3300028142	Phyllosphere	GYFQMHSSFNFYLSNEVSNEKVPKTKVVDLEILSKFGIQKFFI
Ga0268347_10215822	3300028142	Phyllosphere	RTFSMHTSFKFYLSNHCSNEKVPETKVEDLKILNNFRIQKFFI
Ga0268348_10138881	3300028143	Phyllosphere	MHSSFKFYLSNEASNEKVPKTKVVDIEILSKFDIQKFFI
Ga0268348_10172591	3300028143	Phyllosphere	CIQVSIFYLSNHCSNEKVPKTKVVDLEILNNFGIQEFFI
Ga0268303_1026861	3300028147	Phyllosphere	MHSSFNFYLSNQCSNEKVPKTNVVDLEILNNFGIQEFFIXGQEN
Ga0268343_10105371	3300028150	Phyllosphere	MHSSFKFYLSNEASNEFVPETKVVAFEVLNNFHIQKFFV
Ga0268308_10325281	3300028151	Phyllosphere	MHSSFNFYLSNQCSNEKVPKTKVVDLEILNNFGIQEFFIXGKENG
Ga0268336_10005792	3300028152	Phyllosphere	MHSSFNFYLLNETSNELLPKTKVVDLEILSKFGIQKFFI
Ga0268320_10235301	3300028153	Phyllosphere	MHSSFKFYLSTETSNEKVPKMKVVDLEILSKFGIQKFFHLR
Ga0268312_10141371	3300028248	Phyllosphere	MHSSFKFYLSNETPNEKVHKMKVVDLEILSKFGIQKFFIXL
Ga0268312_10232411	3300028248	Phyllosphere	MHSSFNFYLSNEVSNEKVPKTKVVDLEILNNFGIQKFFI
Ga0268324_10150951	3300028251	Phyllosphere	QMHSSFNFYLSNQCSNEKVPKTKVVDLEILNNFGIQEFFI
Ga0268264_107558822	3300028381	Switchgrass Rhizosphere	MHSSFNFYLSNQCSNEKVPKTKVVDIEILNNFGIQEFFI
Ga0268264_122858102	3300028381	Switchgrass Rhizosphere	SFKFYFSNHYSNEKVPEMKVVDLKILSKFGIQKFFI
Ga0268302_1062241	3300028464	Phyllosphere	MHSSFKFYFSNEASNEKVPKTKFVDLKILNNFGIQEFVI
Ga0268321_1042111	3300028466	Phyllosphere	MHSSFKFYLSNEVSNEKVPKTKVVDLEILSKFDIQKFFI
Ga0268315_10119282	3300028472	Phyllosphere	MHSSFNFYLSNEVSNEKVLKTKVVDLEILSKFDIQKFFV
Ga0268319_10073222	3300028473	Phyllosphere	MYSSFKFDLSNEASNELLPKTKVVDLEILSKFGIQKFFL
Ga0268331_10135781	3300028474	Phyllosphere	MHSSFNFYLLNETSNELFPKTKVVDLEILSKFGIQKFFIXPL
Ga0268329_10032511	3300028476	Phyllosphere	SKHTGHFQMHLSFKLYLSNEASNELFPKTKVVDLEILSKFGIQKFFI
Ga0268329_10087951	3300028476	Phyllosphere	MVPFQMYSSFKFYLSNEVSNELLPETKVVDLEILSKFGI
Ga0268309_10132821	3300028477	Phyllosphere	MHSSFNFYLSNEASNEKVPKTKVVDLEILNNFGIQEFFI
Ga0268311_10139611	3300028529	Phyllosphere	SFNFYLLNETSNELLPKTKVVDLEILSKFGIQKFFI
Ga0214493_11663461	3300032465	Switchgrass Phyllosphere	FKYTQVSNFYLSNEDSNEKVPKTKVVDLEILSKFCIQKFFV
Ga0214503_10316742	3300032466	Switchgrass Phyllosphere	MHSSFKFYFSNKASNEKVPKTKVVDLEILSKFGIQKFFI
Ga0214488_11286282	3300032467	Switchgrass Phyllosphere	MVPFQMYSSFKFYLSNEVSNELLPETKVVYLEILN
Ga0214495_10044553	3300032490	Switchgrass Phyllosphere	MYLSFKLYLSNEDSNELLPKTKVVDLEILSKFSIQKFFI
Ga0214495_11443612	3300032490	Switchgrass Phyllosphere	MVPFQMYSSFKFYLSNEVSNENVPKTKVVDIEILNNFGIQKFFI
Ga0214490_10574672	3300032502	Switchgrass Phyllosphere	YTTFQMHSSFNFYLPNQCSNEKVPKTKVVDLEILSKFGIQKFFV
Ga0214490_11033092	3300032502	Switchgrass Phyllosphere	FQTHSSFKFYFSNEASNEKVPKMKVVDLEILSKFDIQKFFI
Ga0214490_11123362	3300032502	Switchgrass Phyllosphere	FQMHSSFNFYLSNEASNEKVPKTKVVDLEILNNFGIQEFFI
Ga0214490_11164142	3300032502	Switchgrass Phyllosphere	MHSSFNFYLSNEASNELLPKTKVVDLEILNNFGIQKFFV
Ga0214502_13021562	3300032514	Switchgrass Phyllosphere	MHPSFKYYLSNHYSNEKVPETKVVDLEILNNFGIQEFFI
Ga0214483_10605811	3300032548	Switchgrass Phyllosphere	MHPSFKYYLSNHYSNEKVPETKVVDLEILNNFGIQKFFI
Ga0214501_10716212	3300032625	Switchgrass Phyllosphere	MHSSFKFELSKEASNELLPKTKVVDLEILSKFDIQKFFT
Ga0214499_12483591	3300032697	Switchgrass Phyllosphere	MHLSFKLYLSNEASNELLPKTKVVDLEILSKFDIQNFFI
Ga0314745_11307831	3300032812	Switchgrass Phyllosphere	MYSSFKFYFSNEASNELLPKTKVVDLKILSKFCIQKFFISGHVEG
Ga0314728_1145371	3300032888	Switchgrass Phyllosphere	MVPFQMYSSFKFYLSNEVSNELLPETKVVDLEILNNF
Ga0314751_10097592	3300032889	Switchgrass Phyllosphere	MHSSFKFYFSNEASNEKMPKTKVVDLEILSKFDIQKFFI
Ga0314747_10027774	3300032890	Switchgrass Phyllosphere	MHPSFKYYLSNHYSNEKVPETKVIDLEILNNFGIQEFFI
Ga0314738_10633961	3300032959	Switchgrass Phyllosphere	MHSSFKFYFSNEASNEKMPKMKVVDLEILSKFDIQMFF