| Basic Information | |
|---|---|
| Family ID | F007823 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 344 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKE |
| Number of Associated Samples | 199 |
| Number of Associated Scaffolds | 344 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.42 % |
| % of genes near scaffold ends (potentially truncated) | 15.70 % |
| % of genes from short scaffolds (< 2000 bps) | 76.74 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.872 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.593 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.674 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.105 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.44% β-sheet: 0.00% Coil/Unstructured: 51.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 344 Family Scaffolds |
|---|---|---|
| PF05559 | DUF763 | 28.49 |
| PF00903 | Glyoxalase | 6.10 |
| PF08487 | VIT | 6.10 |
| PF00488 | MutS_V | 4.36 |
| PF12681 | Glyoxalase_2 | 2.62 |
| PF04234 | CopC | 2.33 |
| PF00691 | OmpA | 1.74 |
| PF07883 | Cupin_2 | 1.74 |
| PF13768 | VWA_3 | 1.45 |
| PF05192 | MutS_III | 1.45 |
| PF05096 | Glu_cyclase_2 | 1.16 |
| PF02368 | Big_2 | 0.87 |
| PF00905 | Transpeptidase | 0.87 |
| PF02633 | Creatininase | 0.87 |
| PF02441 | Flavoprotein | 0.87 |
| PF00498 | FHA | 0.58 |
| PF13649 | Methyltransf_25 | 0.58 |
| PF01408 | GFO_IDH_MocA | 0.29 |
| PF08808 | RES | 0.29 |
| PF02563 | Poly_export | 0.29 |
| PF13414 | TPR_11 | 0.29 |
| PF13787 | HXXEE | 0.29 |
| PF11992 | TgpA_N | 0.29 |
| PF02190 | LON_substr_bdg | 0.29 |
| PF01381 | HTH_3 | 0.29 |
| PF00797 | Acetyltransf_2 | 0.29 |
| PF13424 | TPR_12 | 0.29 |
| PF08352 | oligo_HPY | 0.29 |
| PF00484 | Pro_CA | 0.29 |
| PF12704 | MacB_PCD | 0.29 |
| PF12850 | Metallophos_2 | 0.29 |
| PF00884 | Sulfatase | 0.29 |
| PF01855 | POR_N | 0.29 |
| PF05190 | MutS_IV | 0.29 |
| PF12606 | RELT | 0.29 |
| PF03734 | YkuD | 0.29 |
| PF10236 | DAP3 | 0.29 |
| PF13672 | PP2C_2 | 0.29 |
| PF00106 | adh_short | 0.29 |
| PF05532 | CsbD | 0.29 |
| PF17164 | DUF5122 | 0.29 |
| PF02390 | Methyltransf_4 | 0.29 |
| PF08281 | Sigma70_r4_2 | 0.29 |
| PF12680 | SnoaL_2 | 0.29 |
| PF00571 | CBS | 0.29 |
| PF11937 | DUF3455 | 0.29 |
| PF03476 | MOSC_N | 0.29 |
| PF01243 | Putative_PNPOx | 0.29 |
| PF03824 | NicO | 0.29 |
| PF00041 | fn3 | 0.29 |
| PF13701 | DDE_Tnp_1_4 | 0.29 |
| PF08309 | LVIVD | 0.29 |
| PF02371 | Transposase_20 | 0.29 |
| PF01842 | ACT | 0.29 |
| PF14903 | WG_beta_rep | 0.29 |
| PF10531 | SLBB | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 344 Family Scaffolds |
|---|---|---|---|
| COG1415 | Uncharacterized conserved protein, DUF763 domain | Function unknown [S] | 28.49 |
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 6.10 |
| COG1193 | dsDNA-specific endonuclease/ATPase MutS2 | Replication, recombination and repair [L] | 4.36 |
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 2.33 |
| COG3823 | Glutamine cyclotransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.16 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.87 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.29 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.29 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.29 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.29 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.29 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.29 |
| COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.29 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.29 |
| COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.29 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.29 |
| COG0220 | tRNA G46 N7-methylase TrmB | Translation, ribosomal structure and biogenesis [J] | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.87 % |
| Unclassified | root | N/A | 24.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17173207 | All Organisms → cellular organisms → Bacteria | 12090 | Open in IMG/M |
| 2162886012|MBSR1b_contig_10022502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer | 1269 | Open in IMG/M |
| 2228664021|ICCgaii200_c0635850 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 2228664022|INPgaii200_c0900617 | Not Available | 666 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0564004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2031586 | Not Available | 640 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11097889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1292 | Open in IMG/M |
| 3300000531|CNBas_1005611 | Not Available | 720 | Open in IMG/M |
| 3300000532|CNAas_1000200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5549 | Open in IMG/M |
| 3300000559|F14TC_100538703 | Not Available | 1602 | Open in IMG/M |
| 3300000787|JGI11643J11755_11650584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales | 969 | Open in IMG/M |
| 3300000891|JGI10214J12806_11671066 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
| 3300000953|JGI11615J12901_10053053 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300000953|JGI11615J12901_11743929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300000953|JGI11615J12901_12001664 | Not Available | 523 | Open in IMG/M |
| 3300000955|JGI1027J12803_101383935 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300000956|JGI10216J12902_101566329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 4277 | Open in IMG/M |
| 3300000956|JGI10216J12902_102901852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1522 | Open in IMG/M |
| 3300000956|JGI10216J12902_107802608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1726 | Open in IMG/M |
| 3300000956|JGI10216J12902_118849356 | Not Available | 865 | Open in IMG/M |
| 3300001139|JGI10220J13317_10231341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300001139|JGI10220J13317_11461298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300001157|JGI12686J13345_100605 | All Organisms → cellular organisms → Bacteria | 4748 | Open in IMG/M |
| 3300003267|soilL1_10170566 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300003999|Ga0055469_10104292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 819 | Open in IMG/M |
| 3300004016|Ga0058689_10107884 | Not Available | 597 | Open in IMG/M |
| 3300004114|Ga0062593_101888258 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300004156|Ga0062589_101305000 | Not Available | 702 | Open in IMG/M |
| 3300005093|Ga0062594_100246396 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300005280|Ga0065696_1439520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300005328|Ga0070676_10534031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| 3300005345|Ga0070692_10019049 | All Organisms → cellular organisms → Bacteria | 3309 | Open in IMG/M |
| 3300005364|Ga0070673_100131409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2101 | Open in IMG/M |
| 3300005444|Ga0070694_100012608 | All Organisms → cellular organisms → Bacteria | 5261 | Open in IMG/M |
| 3300005459|Ga0068867_100064237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2729 | Open in IMG/M |
| 3300005467|Ga0070706_100681115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 954 | Open in IMG/M |
| 3300005471|Ga0070698_102048257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300005539|Ga0068853_100448420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer | 1213 | Open in IMG/M |
| 3300005543|Ga0070672_100655123 | Not Available | 917 | Open in IMG/M |
| 3300005543|Ga0070672_101180971 | Not Available | 681 | Open in IMG/M |
| 3300005543|Ga0070672_101256729 | Not Available | 660 | Open in IMG/M |
| 3300005549|Ga0070704_101200488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300005564|Ga0070664_100224728 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300005564|Ga0070664_100423198 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300005564|Ga0070664_100540763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300005566|Ga0066693_10241057 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005577|Ga0068857_100210020 | All Organisms → cellular organisms → Bacteria | 1776 | Open in IMG/M |
| 3300005577|Ga0068857_100604556 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300005577|Ga0068857_101170620 | Not Available | 744 | Open in IMG/M |
| 3300005577|Ga0068857_101897557 | Not Available | 584 | Open in IMG/M |
| 3300005577|Ga0068857_102558995 | Not Available | 501 | Open in IMG/M |
| 3300005578|Ga0068854_100818808 | Not Available | 813 | Open in IMG/M |
| 3300005578|Ga0068854_101207881 | Not Available | 678 | Open in IMG/M |
| 3300005578|Ga0068854_101824025 | Not Available | 558 | Open in IMG/M |
| 3300005616|Ga0068852_100969099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300005617|Ga0068859_100018701 | All Organisms → cellular organisms → Bacteria | 6962 | Open in IMG/M |
| 3300005617|Ga0068859_100155962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2360 | Open in IMG/M |
| 3300005617|Ga0068859_100180533 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
| 3300005617|Ga0068859_100333077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1612 | Open in IMG/M |
| 3300005617|Ga0068859_100405734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1459 | Open in IMG/M |
| 3300005617|Ga0068859_101605306 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005617|Ga0068859_102012007 | Not Available | 638 | Open in IMG/M |
| 3300005618|Ga0068864_100031523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4498 | Open in IMG/M |
| 3300005618|Ga0068864_100087467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2743 | Open in IMG/M |
| 3300005618|Ga0068864_102060156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300005718|Ga0068866_10561669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300005719|Ga0068861_100002001 | All Organisms → cellular organisms → Bacteria | 13180 | Open in IMG/M |
| 3300005719|Ga0068861_100048586 | All Organisms → cellular organisms → Bacteria | 3208 | Open in IMG/M |
| 3300005719|Ga0068861_100684684 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300005834|Ga0068851_10635284 | Not Available | 652 | Open in IMG/M |
| 3300005840|Ga0068870_10138264 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300005841|Ga0068863_100850774 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300005843|Ga0068860_100018636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6750 | Open in IMG/M |
| 3300005843|Ga0068860_101727418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300005844|Ga0068862_100006048 | All Organisms → cellular organisms → Bacteria | 10078 | Open in IMG/M |
| 3300005844|Ga0068862_100289391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1504 | Open in IMG/M |
| 3300005844|Ga0068862_100541268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1111 | Open in IMG/M |
| 3300005844|Ga0068862_101207125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300005844|Ga0068862_101348337 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300005875|Ga0075293_1000594 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
| 3300005985|Ga0081539_10012371 | All Organisms → cellular organisms → Bacteria | 6584 | Open in IMG/M |
| 3300006049|Ga0075417_10534208 | Not Available | 592 | Open in IMG/M |
| 3300006169|Ga0082029_1037318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300006169|Ga0082029_1062544 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300006169|Ga0082029_1154053 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300006169|Ga0082029_1222854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 26632 | Open in IMG/M |
| 3300006169|Ga0082029_1733431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300006169|Ga0082029_1777827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300006173|Ga0070716_100470133 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300006173|Ga0070716_100910850 | Not Available | 689 | Open in IMG/M |
| 3300006358|Ga0068871_101829734 | Not Available | 577 | Open in IMG/M |
| 3300006755|Ga0079222_10397701 | Not Available | 957 | Open in IMG/M |
| 3300006755|Ga0079222_10477382 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300006755|Ga0079222_11180800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300006794|Ga0066658_10318572 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300006796|Ga0066665_10360083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum saxi | 1190 | Open in IMG/M |
| 3300006844|Ga0075428_100123419 | All Organisms → cellular organisms → Bacteria | 2819 | Open in IMG/M |
| 3300006844|Ga0075428_100551229 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300006844|Ga0075428_102300417 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300006844|Ga0075428_102404403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300006852|Ga0075433_10019581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5642 | Open in IMG/M |
| 3300006852|Ga0075433_10118106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2354 | Open in IMG/M |
| 3300006852|Ga0075433_11355902 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300006854|Ga0075425_100109862 | All Organisms → cellular organisms → Bacteria | 3142 | Open in IMG/M |
| 3300006854|Ga0075425_100741164 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300006871|Ga0075434_100100060 | All Organisms → cellular organisms → Bacteria | 2905 | Open in IMG/M |
| 3300006871|Ga0075434_100203370 | All Organisms → cellular organisms → Bacteria | 2001 | Open in IMG/M |
| 3300006876|Ga0079217_10000511 | All Organisms → cellular organisms → Bacteria | 9805 | Open in IMG/M |
| 3300006876|Ga0079217_10031723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1979 | Open in IMG/M |
| 3300006876|Ga0079217_10039222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1832 | Open in IMG/M |
| 3300006876|Ga0079217_10278110 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300006876|Ga0079217_11410388 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006876|Ga0079217_11456335 | Not Available | 539 | Open in IMG/M |
| 3300006876|Ga0079217_11652117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300006894|Ga0079215_10131636 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300006894|Ga0079215_10662184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300006904|Ga0075424_101800880 | Not Available | 648 | Open in IMG/M |
| 3300006918|Ga0079216_10638091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300006918|Ga0079216_10819494 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300006969|Ga0075419_11120356 | Not Available | 577 | Open in IMG/M |
| 3300007004|Ga0079218_10050716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2576 | Open in IMG/M |
| 3300007004|Ga0079218_12419945 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300009012|Ga0066710_100077779 | All Organisms → cellular organisms → Bacteria | 4304 | Open in IMG/M |
| 3300009038|Ga0099829_10199158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1620 | Open in IMG/M |
| 3300009092|Ga0105250_10068078 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300009094|Ga0111539_10003278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 21398 | Open in IMG/M |
| 3300009098|Ga0105245_10497956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1234 | Open in IMG/M |
| 3300009098|Ga0105245_11280246 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300009098|Ga0105245_11429261 | Not Available | 742 | Open in IMG/M |
| 3300009098|Ga0105245_13059175 | Not Available | 518 | Open in IMG/M |
| 3300009100|Ga0075418_10110884 | All Organisms → cellular organisms → Bacteria | 2914 | Open in IMG/M |
| 3300009100|Ga0075418_10229141 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
| 3300009100|Ga0075418_10546136 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300009100|Ga0075418_11450744 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300009100|Ga0075418_12924875 | Not Available | 521 | Open in IMG/M |
| 3300009101|Ga0105247_10294560 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300009101|Ga0105247_10916756 | Not Available | 678 | Open in IMG/M |
| 3300009147|Ga0114129_10100078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4011 | Open in IMG/M |
| 3300009147|Ga0114129_10182813 | All Organisms → cellular organisms → Bacteria | 2852 | Open in IMG/M |
| 3300009147|Ga0114129_10265812 | All Organisms → cellular organisms → Bacteria | 2297 | Open in IMG/M |
| 3300009147|Ga0114129_11106094 | Not Available | 992 | Open in IMG/M |
| 3300009147|Ga0114129_12144874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus asticus | 673 | Open in IMG/M |
| 3300009147|Ga0114129_12511518 | Not Available | 616 | Open in IMG/M |
| 3300009148|Ga0105243_10738159 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300009148|Ga0105243_10772889 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300009148|Ga0105243_11393052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus asticus | 721 | Open in IMG/M |
| 3300009148|Ga0105243_12490511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300009148|Ga0105243_12734491 | Not Available | 534 | Open in IMG/M |
| 3300009162|Ga0075423_12520200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300009553|Ga0105249_10808614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
| 3300009553|Ga0105249_11391701 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300009553|Ga0105249_11861881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300009553|Ga0105249_13215381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300009789|Ga0126307_10767604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300009789|Ga0126307_11174394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300009789|Ga0126307_11364100 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300009789|Ga0126307_11739920 | Not Available | 507 | Open in IMG/M |
| 3300009792|Ga0126374_10904606 | Not Available | 684 | Open in IMG/M |
| 3300009840|Ga0126313_11319775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300010036|Ga0126305_10039056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2636 | Open in IMG/M |
| 3300010036|Ga0126305_10220912 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300010036|Ga0126305_10376336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
| 3300010036|Ga0126305_10688066 | Not Available | 691 | Open in IMG/M |
| 3300010038|Ga0126315_10001770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8669 | Open in IMG/M |
| 3300010038|Ga0126315_10166238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1314 | Open in IMG/M |
| 3300010040|Ga0126308_11234266 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300010040|Ga0126308_11341667 | Not Available | 508 | Open in IMG/M |
| 3300010042|Ga0126314_10381130 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300010042|Ga0126314_10640707 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300010044|Ga0126310_10137308 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300010044|Ga0126310_11723748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300010045|Ga0126311_10326292 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300010045|Ga0126311_10798343 | Not Available | 761 | Open in IMG/M |
| 3300010045|Ga0126311_11852892 | Not Available | 512 | Open in IMG/M |
| 3300010046|Ga0126384_11063809 | Not Available | 740 | Open in IMG/M |
| 3300010047|Ga0126382_10292890 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300010359|Ga0126376_10000554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 18496 | Open in IMG/M |
| 3300010359|Ga0126376_10006717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 6952 | Open in IMG/M |
| 3300010359|Ga0126376_10084526 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2371 | Open in IMG/M |
| 3300010359|Ga0126376_10133813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1957 | Open in IMG/M |
| 3300010359|Ga0126376_10791425 | Not Available | 925 | Open in IMG/M |
| 3300010364|Ga0134066_10387707 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300010373|Ga0134128_12080684 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010373|Ga0134128_12495718 | Not Available | 570 | Open in IMG/M |
| 3300010375|Ga0105239_10424062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1507 | Open in IMG/M |
| 3300010396|Ga0134126_12146011 | Not Available | 610 | Open in IMG/M |
| 3300010399|Ga0134127_10055926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3286 | Open in IMG/M |
| 3300010399|Ga0134127_11646741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300010399|Ga0134127_13043966 | Not Available | 547 | Open in IMG/M |
| 3300010400|Ga0134122_10534373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300010400|Ga0134122_11448633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300010401|Ga0134121_10000922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 29866 | Open in IMG/M |
| 3300010401|Ga0134121_10249083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer | 1554 | Open in IMG/M |
| 3300010401|Ga0134121_11036347 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300010401|Ga0134121_12448154 | Not Available | 563 | Open in IMG/M |
| 3300010403|Ga0134123_10366496 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300010403|Ga0134123_10483661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1160 | Open in IMG/M |
| 3300010403|Ga0134123_10531238 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300010403|Ga0134123_10977504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300011333|Ga0127502_10844411 | Not Available | 512 | Open in IMG/M |
| 3300011993|Ga0120182_1021128 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012015|Ga0120187_1002766 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300012022|Ga0120191_10124959 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300012045|Ga0136623_10000398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12724 | Open in IMG/M |
| 3300012210|Ga0137378_10803843 | Not Available | 853 | Open in IMG/M |
| 3300012360|Ga0137375_10134062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2449 | Open in IMG/M |
| 3300012474|Ga0157356_1017005 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012684|Ga0136614_10016328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5374 | Open in IMG/M |
| 3300012923|Ga0137359_10034555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4354 | Open in IMG/M |
| 3300012929|Ga0137404_10000948 | All Organisms → cellular organisms → Bacteria | 19127 | Open in IMG/M |
| 3300012929|Ga0137404_11215927 | Not Available | 693 | Open in IMG/M |
| 3300012957|Ga0164303_10160896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1200 | Open in IMG/M |
| 3300013100|Ga0157373_10727160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300013102|Ga0157371_10775797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 721 | Open in IMG/M |
| 3300013296|Ga0157374_10973286 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300013296|Ga0157374_12575328 | Not Available | 536 | Open in IMG/M |
| 3300013297|Ga0157378_10661240 | Not Available | 1061 | Open in IMG/M |
| 3300013306|Ga0163162_10952095 | Not Available | 970 | Open in IMG/M |
| 3300013306|Ga0163162_11676660 | Not Available | 726 | Open in IMG/M |
| 3300013307|Ga0157372_11804270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300013760|Ga0120188_1020240 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300013760|Ga0120188_1030713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300014487|Ga0182000_10426092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300014487|Ga0182000_10542847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300014969|Ga0157376_11644546 | Not Available | 677 | Open in IMG/M |
| 3300015262|Ga0182007_10197800 | Not Available | 701 | Open in IMG/M |
| 3300015371|Ga0132258_10048200 | All Organisms → cellular organisms → Bacteria | 9727 | Open in IMG/M |
| 3300015371|Ga0132258_10346687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 3670 | Open in IMG/M |
| 3300015371|Ga0132258_10855222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2295 | Open in IMG/M |
| 3300015373|Ga0132257_103286767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300015374|Ga0132255_100044932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5708 | Open in IMG/M |
| 3300015374|Ga0132255_100064237 | All Organisms → cellular organisms → Bacteria | 4846 | Open in IMG/M |
| 3300018422|Ga0190265_10468625 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300018422|Ga0190265_10893300 | Not Available | 1011 | Open in IMG/M |
| 3300018422|Ga0190265_11753797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300018429|Ga0190272_12524442 | Not Available | 560 | Open in IMG/M |
| 3300018469|Ga0190270_10726471 | Not Available | 989 | Open in IMG/M |
| 3300018469|Ga0190270_11338673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300018469|Ga0190270_13110302 | Not Available | 525 | Open in IMG/M |
| 3300018476|Ga0190274_10418354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1307 | Open in IMG/M |
| 3300018476|Ga0190274_13369659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300019360|Ga0187894_10000688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 45530 | Open in IMG/M |
| 3300019458|Ga0187892_10027826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 4795 | Open in IMG/M |
| 3300020003|Ga0193739_1024610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1569 | Open in IMG/M |
| 3300020146|Ga0196977_1004267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3994 | Open in IMG/M |
| 3300024179|Ga0247695_1002257 | All Organisms → cellular organisms → Bacteria | 2800 | Open in IMG/M |
| 3300025567|Ga0210076_1133257 | Not Available | 541 | Open in IMG/M |
| 3300025893|Ga0207682_10355017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300025900|Ga0207710_10000609 | All Organisms → cellular organisms → Bacteria | 20923 | Open in IMG/M |
| 3300025900|Ga0207710_10060510 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300025904|Ga0207647_10006263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8666 | Open in IMG/M |
| 3300025904|Ga0207647_10152475 | Not Available | 1350 | Open in IMG/M |
| 3300025904|Ga0207647_10239845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
| 3300025906|Ga0207699_11085854 | Not Available | 592 | Open in IMG/M |
| 3300025907|Ga0207645_10231540 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300025907|Ga0207645_10595877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300025907|Ga0207645_10687588 | Not Available | 695 | Open in IMG/M |
| 3300025908|Ga0207643_10001777 | All Organisms → cellular organisms → Bacteria | 12034 | Open in IMG/M |
| 3300025908|Ga0207643_10256660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1078 | Open in IMG/M |
| 3300025911|Ga0207654_10149629 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300025911|Ga0207654_10160926 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300025913|Ga0207695_10360764 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300025923|Ga0207681_10044463 | All Organisms → cellular organisms → Bacteria | 2976 | Open in IMG/M |
| 3300025923|Ga0207681_10721248 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300025924|Ga0207694_10002866 | All Organisms → cellular organisms → Bacteria | 13882 | Open in IMG/M |
| 3300025925|Ga0207650_10000027 | All Organisms → cellular organisms → Bacteria | 257466 | Open in IMG/M |
| 3300025925|Ga0207650_10143170 | Not Available | 1881 | Open in IMG/M |
| 3300025925|Ga0207650_10715410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300025925|Ga0207650_11064435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300025932|Ga0207690_10129872 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300025935|Ga0207709_10005466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 7217 | Open in IMG/M |
| 3300025935|Ga0207709_10831353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300025935|Ga0207709_11405353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus asticus | 578 | Open in IMG/M |
| 3300025936|Ga0207670_10000316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 28993 | Open in IMG/M |
| 3300025938|Ga0207704_10736025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300025939|Ga0207665_10934212 | Not Available | 689 | Open in IMG/M |
| 3300025940|Ga0207691_11056236 | Not Available | 677 | Open in IMG/M |
| 3300025942|Ga0207689_10275450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1393 | Open in IMG/M |
| 3300025945|Ga0207679_10411651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1191 | Open in IMG/M |
| 3300025945|Ga0207679_10579052 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300025945|Ga0207679_11579926 | Not Available | 601 | Open in IMG/M |
| 3300025949|Ga0207667_11468439 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300025960|Ga0207651_12136559 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025961|Ga0207712_10405427 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300025971|Ga0210102_1065637 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 783 | Open in IMG/M |
| 3300025981|Ga0207640_10057186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2564 | Open in IMG/M |
| 3300026023|Ga0207677_10312685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1302 | Open in IMG/M |
| 3300026071|Ga0208537_1018665 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300026075|Ga0207708_12058765 | Not Available | 500 | Open in IMG/M |
| 3300026088|Ga0207641_10581761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1094 | Open in IMG/M |
| 3300026088|Ga0207641_12548720 | Not Available | 509 | Open in IMG/M |
| 3300026089|Ga0207648_10094751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2611 | Open in IMG/M |
| 3300026089|Ga0207648_10212985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1715 | Open in IMG/M |
| 3300026089|Ga0207648_10987569 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300026089|Ga0207648_11732115 | Not Available | 586 | Open in IMG/M |
| 3300026095|Ga0207676_10991644 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300026116|Ga0207674_10568232 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300026116|Ga0207674_10603794 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300026118|Ga0207675_100180776 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
| 3300026312|Ga0209153_1031598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1811 | Open in IMG/M |
| 3300026377|Ga0257171_1032751 | Not Available | 890 | Open in IMG/M |
| 3300026535|Ga0256867_10005522 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 5524 | Open in IMG/M |
| 3300026538|Ga0209056_10129556 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300027266|Ga0209215_1000127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 22820 | Open in IMG/M |
| 3300027530|Ga0209216_1000012 | All Organisms → cellular organisms → Bacteria | 165233 | Open in IMG/M |
| 3300027637|Ga0209818_1001011 | All Organisms → cellular organisms → Bacteria | 5839 | Open in IMG/M |
| 3300027637|Ga0209818_1023946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1347 | Open in IMG/M |
| 3300027637|Ga0209818_1146296 | Not Available | 660 | Open in IMG/M |
| 3300027639|Ga0209387_1251391 | Not Available | 504 | Open in IMG/M |
| 3300027691|Ga0209485_1045870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1107 | Open in IMG/M |
| 3300027775|Ga0209177_10452115 | Not Available | 526 | Open in IMG/M |
| 3300027873|Ga0209814_10290350 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira alexanderi | 711 | Open in IMG/M |
| 3300027880|Ga0209481_10045589 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
| 3300027886|Ga0209486_10151241 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300027907|Ga0207428_10010326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8347 | Open in IMG/M |
| 3300027907|Ga0207428_10060293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3006 | Open in IMG/M |
| 3300027909|Ga0209382_11432743 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300028379|Ga0268266_11399619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300028380|Ga0268265_10420428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
| 3300028380|Ga0268265_12135774 | Not Available | 567 | Open in IMG/M |
| 3300028381|Ga0268264_10707480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300030510|Ga0268243_1123123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300030511|Ga0268241_10054519 | Not Available | 864 | Open in IMG/M |
| 3300031538|Ga0310888_10000985 | All Organisms → cellular organisms → Bacteria | 7832 | Open in IMG/M |
| 3300031538|Ga0310888_10870588 | Not Available | 561 | Open in IMG/M |
| 3300031548|Ga0307408_100209873 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300031548|Ga0307408_100210712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1579 | Open in IMG/M |
| 3300031548|Ga0307408_100282736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas crusticola | 1382 | Open in IMG/M |
| 3300031731|Ga0307405_10097489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1963 | Open in IMG/M |
| 3300031731|Ga0307405_10695409 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300031740|Ga0307468_100263688 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300031854|Ga0310904_10696364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300031858|Ga0310892_11001988 | Not Available | 589 | Open in IMG/M |
| 3300031901|Ga0307406_10461777 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300031903|Ga0307407_10355694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300031938|Ga0308175_102462219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300031995|Ga0307409_101885355 | Not Available | 627 | Open in IMG/M |
| 3300032002|Ga0307416_102678305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300032157|Ga0315912_10175324 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.14% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.23% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.74% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.74% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.16% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.58% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.29% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.29% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.29% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.29% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.29% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.29% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.29% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.29% |
| Switchgrass Rhizosphere Bulk Soil | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.29% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.29% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.29% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.29% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300001157 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005280 | Switchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soil | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011993 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1 | Environmental | Open in IMG/M |
| 3300012015 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020146 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026071 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027530 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03496800 | 2088090014 | Soil | MLQEIWDSFIMLIPVFILLTMIFGAGFYIGRVSKKQK |
| MBSR1b_0662.00002680 | 2162886012 | Miscanthus Rhizosphere | MITQVWDTFVMLIPVFILLTMIFGAGFYIGRVSKKE |
| ICCgaii200_06358502 | 2228664021 | Soil | MTIIQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER |
| INPgaii200_09006171 | 2228664022 | Soil | MLKEVWDAFVMLIPVFFLLLMIFGAGFYIGRISKRTE |
| ICChiseqgaiiDRAFT_05640042 | 3300000033 | Soil | MLQQVWDSFVLLIPVFFLLIMIFGAGFFIGRASKKDC* |
| ICChiseqgaiiDRAFT_20315861 | 3300000033 | Soil | MLQQVWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE* |
| ICChiseqgaiiFebDRAFT_110978892 | 3300000363 | Soil | MFQQLWDGFIMLIPVFFLLTLIFGAGVYVGRVSKKER* |
| CNBas_10056112 | 3300000531 | Quercus Rhizosphere | MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVTKRE* |
| CNAas_10002009 | 3300000532 | Quercus Rhizosphere | MLEQIWGTFVMMIPVFLLLTMIFGAGFFIGRVTRKE* |
| F14TC_1005387032 | 3300000559 | Soil | MLTQVWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKEQ* |
| JGI11643J11755_116505842 | 3300000787 | Soil | MTIIQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER* |
| JGI10214J12806_116710664 | 3300000891 | Soil | MLTQVWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKER* |
| JGI11615J12901_100530532 | 3300000953 | Soil | MLEELWQSFIVMIPIFFLLTMIFGAGFYIGRVTKKDT* |
| JGI11615J12901_117439292 | 3300000953 | Soil | MIQQIWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKER* |
| JGI11615J12901_120016642 | 3300000953 | Soil | MTSLNLKEVARMLQQLWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE* |
| JGI1027J12803_1013839352 | 3300000955 | Soil | MLKEVWDAFVMLIPVFFLLLMIFGAGFYIGRISKRTE* |
| JGI10216J12902_1015663292 | 3300000956 | Soil | MLEELWNSFVILIPVFFLLTLIFAAGFYIGRVTKRE* |
| JGI10216J12902_1029018521 | 3300000956 | Soil | MIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDT* |
| JGI10216J12902_1078026082 | 3300000956 | Soil | MRELWDTFVLLIPVFFLLTLMFGAGFVIGRISKREH* |
| JGI10216J12902_1188493561 | 3300000956 | Soil | MLEELWTNFVILIPVFILLTMIFGAGFYIGRVSKRE* |
| JGI10220J13317_102313412 | 3300001139 | Soil | MIQQLWDSFVMLIPVFFLLTMIFGAGFYVGRVSKKDT* |
| JGI10220J13317_114612982 | 3300001139 | Soil | MLQQVWDSFVLLIPVFFLLIMIFGAGFFIGRASKRDC* |
| JGI12686J13345_1006057 | 3300001157 | Forest Soil | MDQIWGTFVTLIPVFFLLTIVFGAGIYIGRVSKRE* |
| soilL1_101705662 | 3300003267 | Sugarcane Root And Bulk Soil | MLQQLWDSFVMLIPVFFLLTMIFGAGFFIGRASKKESRE* |
| Ga0055469_101042922 | 3300003999 | Natural And Restored Wetlands | MQSCLTEVVEMLEQLWGSFVLLIPVFFLLMMIFGAGFYIGRVSKRE* |
| Ga0058689_101078841 | 3300004016 | Agave | MSLIQQIWDSFIMLIPVFLLLTMIFGAGFYIGRVSKKER* |
| Ga0062593_1018882581 | 3300004114 | Soil | KGDQNMLENLWGTFVMMIPVFLLLTMIFGAGFYIGRVSKKE* |
| Ga0062589_1013050002 | 3300004156 | Soil | MTSLNLKEVARMLQQVWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE* |
| Ga0063356_1010072311 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RTPKNLRREICPMVRELWETFVMLIPVFFLLTMIFGAGFYIGRVSKREQ* |
| Ga0062594_1002463963 | 3300005093 | Soil | MLEQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDSRE* |
| Ga0065696_14395201 | 3300005280 | Switchgrass Rhizosphere Bulk Soil | RMLQQLWDTFIMLIPVFVLLTMIFGAGFYIGRVSKENSAAD* |
| Ga0070676_105340311 | 3300005328 | Miscanthus Rhizosphere | MSIVQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER* |
| Ga0066388_1007990891 | 3300005332 | Tropical Forest Soil | EEVIFCLKEGSEMLEDLWTNFILLIPVFILLTMIFGAGFYIGRVSKKE* |
| Ga0070692_100190493 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDSRE* |
| Ga0070673_1001314092 | 3300005364 | Switchgrass Rhizosphere | RRPQMLQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER* |
| Ga0070694_1000126084 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVIRPETSLTKEISMLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDSRE* |
| Ga0068867_1000642372 | 3300005459 | Miscanthus Rhizosphere | MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDTEAAD* |
| Ga0070706_1006811152 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LFMLSELWGTFVLLIPVFFLLTIIFFAGFVIGRVSKREQ* |
| Ga0070698_1020482572 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VVKVLQQLWDSFVIMIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0068853_1004484202 | 3300005539 | Corn Rhizosphere | HCPAQSVFPTVWLRRRCIQMITQVWDTFVMLIPVFILLTMIFGAGFYIGRVSKKE* |
| Ga0070672_1006551231 | 3300005543 | Miscanthus Rhizosphere | MLQEIWGSFIMLIPVFILLTMIFGAGVYIGRVSKKQE* |
| Ga0070672_1011809712 | 3300005543 | Miscanthus Rhizosphere | MLQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER* |
| Ga0070672_1012567291 | 3300005543 | Miscanthus Rhizosphere | WLRRRCIQMITQVWDTFVMLIPVFILLTMIFGAGFYIGRVSKKE* |
| Ga0070704_1012004882 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TEVNQMIEELWNSFVLLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0070664_1002247282 | 3300005564 | Corn Rhizosphere | MLEELWNSFVILIPVFFLLTLIFAAGFYIGRVSKRE* |
| Ga0070664_1004231981 | 3300005564 | Corn Rhizosphere | MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0070664_1005407631 | 3300005564 | Corn Rhizosphere | MQQLWDTFIMMIPVFLLLTMIFGAGFFIGRVSKKER* |
| Ga0066693_102410572 | 3300005566 | Soil | MLQQIWDTFVMMIPVFFLLTIVFGAGFYIGRVTKRE* |
| Ga0068857_1002100202 | 3300005577 | Corn Rhizosphere | MSIIQQIWDSFIMLIPVFFLLTLIFGAGFYIGRVSKKER* |
| Ga0068857_1006045562 | 3300005577 | Corn Rhizosphere | MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDS* |
| Ga0068857_1011706202 | 3300005577 | Corn Rhizosphere | MLQQVWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE* |
| Ga0068857_1018975572 | 3300005577 | Corn Rhizosphere | MMQQLWGTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS* |
| Ga0068857_1025589951 | 3300005577 | Corn Rhizosphere | MLQQVWDTFVMMIPVFFLLTMIFGAGFYIGRVSKKDS* |
| Ga0068854_1008188082 | 3300005578 | Corn Rhizosphere | MVSELWNTFVMLIPVFVLLTLIFGAGFYIGRVSKREQ* |
| Ga0068854_1012078812 | 3300005578 | Corn Rhizosphere | MLQQLWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE* |
| Ga0068854_1018240251 | 3300005578 | Corn Rhizosphere | MLQQVWDSFILLIPVFFLLTLIFGAGFYIGRVSKRE* |
| Ga0068852_1009690992 | 3300005616 | Corn Rhizosphere | MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKD* |
| Ga0068859_1000187013 | 3300005617 | Switchgrass Rhizosphere | MIQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRER* |
| Ga0068859_1001559621 | 3300005617 | Switchgrass Rhizosphere | MFDELWRSFVVMIPIFFLLTMIFGAGFYIGRVTKKE* |
| Ga0068859_1001805332 | 3300005617 | Switchgrass Rhizosphere | MLQQVWDSFVMLIPVFFLLIMIFGAGFYIGRVSKRE* |
| Ga0068859_1003330773 | 3300005617 | Switchgrass Rhizosphere | MITQVWDTFVMLIPVFILLTMIFGAGFYIGRVSKKE* |
| Ga0068859_1004057342 | 3300005617 | Switchgrass Rhizosphere | MLQQIFDTFVMLIPVFILLTMIFGAGFYIGRVSKRD* |
| Ga0068859_1016053061 | 3300005617 | Switchgrass Rhizosphere | MLQQIWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKE* |
| Ga0068859_1020120072 | 3300005617 | Switchgrass Rhizosphere | MIEQLWGSFVMLIPVFFLLTMIFGAGFYIGRVSKKD* |
| Ga0068864_1000315232 | 3300005618 | Switchgrass Rhizosphere | MLQQIFDTFVILIPVFVLLTMIFGAGFYIGRVSKKER* |
| Ga0068864_1000874672 | 3300005618 | Switchgrass Rhizosphere | MMQQLWDTFVMLIPVFVLLTMIFGAGFYIGRVSKRDS* |
| Ga0068864_1020601562 | 3300005618 | Switchgrass Rhizosphere | PRGLSVPITIEVNLMIEELWNSFVLLIPVFFLLTIIFGAGFYIGRVSKRE* |
| Ga0068866_105616692 | 3300005718 | Miscanthus Rhizosphere | QLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRDS* |
| Ga0068861_10000200114 | 3300005719 | Switchgrass Rhizosphere | MLQQLWDSFVLLIPVFFLLIMVFGAGFYIGRVSVSRRE* |
| Ga0068861_1000485863 | 3300005719 | Switchgrass Rhizosphere | MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS* |
| Ga0068861_1006846842 | 3300005719 | Switchgrass Rhizosphere | MMQQVWDSFVLLIPVFFLLIMIFGAGFYIGRVSKKDS* |
| Ga0068851_106352841 | 3300005834 | Corn Rhizosphere | MLQQVWDSFLMLIPVFFLLTMIFGAGFYIGRVSKKE* |
| Ga0068870_101382642 | 3300005840 | Miscanthus Rhizosphere | MLQQIFDTFVILIPVFVLLTMIFGAGFYIGRVSKKEDS* |
| Ga0068863_1008507742 | 3300005841 | Switchgrass Rhizosphere | MLQTVWDSFVMLIPVFFLLTMIFGAGFYIGRVTKKEE* |
| Ga0068860_1000186366 | 3300005843 | Switchgrass Rhizosphere | MMQQIWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS* |
| Ga0068860_1017274182 | 3300005843 | Switchgrass Rhizosphere | MIQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER* |
| Ga0068862_1000060483 | 3300005844 | Switchgrass Rhizosphere | MLTQVWDAFIMLIPVFILLTMIFGAGFYIGRVSKKER* |
| Ga0068862_1002893912 | 3300005844 | Switchgrass Rhizosphere | MLQTVWDSFVMLIPVFFLLTMIFGAGFYIGRVTKKQE* |
| Ga0068862_1005412682 | 3300005844 | Switchgrass Rhizosphere | MLQQIFDTFVILIPVFVLLTMIFGAGFYIGRVSKKE* |
| Ga0068862_1012071252 | 3300005844 | Switchgrass Rhizosphere | MSIIQQIWDSFILLIPVFFLLTMIFGAGFYIGRVSKKER* |
| Ga0068862_1013483372 | 3300005844 | Switchgrass Rhizosphere | MLQQLLDTFVMLVPVFFLLTMIFGAGFYIGRVSKKDS* |
| Ga0075293_10005941 | 3300005875 | Rice Paddy Soil | MLQQVWDSFIMLIPVFFLLVMIFGAGFYIGRVSKKE* |
| Ga0081539_100123712 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MLDQLWNSFVMLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0075417_105342082 | 3300006049 | Populus Rhizosphere | MLGQVWDTFVMLLPVFFLLTMIFGAGFYIGRVSKKE* |
| Ga0082029_10373181 | 3300006169 | Termite Nest | MMQQLWDTFVLMIPVFVLLTMIFGAGFYIGRVSKKDS* |
| Ga0082029_10625442 | 3300006169 | Termite Nest | MLQQVWDTFVMLIPVFLLLTMIFGVGFYIGRVSKRE* |
| Ga0082029_11540533 | 3300006169 | Termite Nest | MLQQVWDSFVLLIPVFFLLIMIFGAGFYIGRVSKKDS* |
| Ga0082029_122285420 | 3300006169 | Termite Nest | MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDSSSS* |
| Ga0082029_17334312 | 3300006169 | Termite Nest | MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDRSSS* |
| Ga0082029_17778271 | 3300006169 | Termite Nest | MEQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDT* |
| Ga0070716_1004701332 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDELWNSFVLLIPVFFLLTLIFGAGFYVGRVSKRE* |
| Ga0070716_1009108502 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQQIWDTFVMMIPVFFLLTIVFGAGFYIGRVSKRE* |
| Ga0068871_1018297342 | 3300006358 | Miscanthus Rhizosphere | MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDT* |
| Ga0079222_103977012 | 3300006755 | Agricultural Soil | MIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER* |
| Ga0079222_104773822 | 3300006755 | Agricultural Soil | MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKKD* |
| Ga0079222_111808002 | 3300006755 | Agricultural Soil | MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKRDS* |
| Ga0066658_103185723 | 3300006794 | Soil | MLQQIWDTFVMMIPVFFLLTIIFGAGFYIGRVTKRE* |
| Ga0066665_103600832 | 3300006796 | Soil | MLERLWGTFVLLVPVFVLLTMIFGAGFVIGRVSKKQ* |
| Ga0075428_1001234192 | 3300006844 | Populus Rhizosphere | MLQQLWDTFVIMIPVFFLLTMIFGAGFYIGRVSKREQ* |
| Ga0075428_1005512291 | 3300006844 | Populus Rhizosphere | MLAQVWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKE |
| Ga0075428_1023004171 | 3300006844 | Populus Rhizosphere | QLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDGRE* |
| Ga0075428_1024044032 | 3300006844 | Populus Rhizosphere | MSFIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER* |
| Ga0075433_100195813 | 3300006852 | Populus Rhizosphere | MLQQLWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE* |
| Ga0075433_101181062 | 3300006852 | Populus Rhizosphere | MLQKLWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKE* |
| Ga0075433_113559022 | 3300006852 | Populus Rhizosphere | RRPAMMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS* |
| Ga0075425_1001098624 | 3300006854 | Populus Rhizosphere | MLEDLWHTLITLIPVFILLLMIFGAGFYIGRVSMRQ* |
| Ga0075425_1007411642 | 3300006854 | Populus Rhizosphere | MLQTVWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKQE* |
| Ga0075434_1001000603 | 3300006871 | Populus Rhizosphere | MMQQIWDTFVMMIPVFFLLTMIFGAGFYIGRVSKRDS* |
| Ga0075434_1002033703 | 3300006871 | Populus Rhizosphere | MLQQLWDSFVMLIPVFLLLTMIFGAGFYIGRVSKKDT* |
| Ga0079217_100005112 | 3300006876 | Agricultural Soil | MSIIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER* |
| Ga0079217_100317232 | 3300006876 | Agricultural Soil | MSIIQQIWDSFILLIPVFFLLTMIFGAGFYVGRVSKKER* |
| Ga0079217_100392222 | 3300006876 | Agricultural Soil | MVQQLWDSFVLLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0079217_102781101 | 3300006876 | Agricultural Soil | MVRELWETFVMLIPVFFLLTMIFGAGFYIGRVSKREQ* |
| Ga0079217_114103882 | 3300006876 | Agricultural Soil | MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKRER* |
| Ga0079217_114563352 | 3300006876 | Agricultural Soil | MLQQIFDTFVMLIPVFVLLTMIFGAGFYIGRVSKRE* |
| Ga0079217_116521171 | 3300006876 | Agricultural Soil | MLHQMWDSFVLLIPVFFLLLMIFGAGFYIGRVSKKDC* |
| Ga0079215_100001721 | 3300006894 | Agricultural Soil | EECRMSIIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER* |
| Ga0079215_101316362 | 3300006894 | Agricultural Soil | MLHQMWDSFVLLIPVFFLLLMIFGAGFYIGRVSKKDS* |
| Ga0079215_106621842 | 3300006894 | Agricultural Soil | MLQQIWDTFIMMIPVFFLLTMIFGAGFYIGRVSKKE* |
| Ga0075424_1018008801 | 3300006904 | Populus Rhizosphere | MIEELWNSFVLLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0079216_106380911 | 3300006918 | Agricultural Soil | MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKE* |
| Ga0079216_108194942 | 3300006918 | Agricultural Soil | MSFIQQIWDSFIMLIPVFFLLTMIFGAGFYVGRVSKRER* |
| Ga0079219_116961731 | 3300006954 | Agricultural Soil | APSLTVVATQRGEPMLQQLWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE* |
| Ga0075419_111203561 | 3300006969 | Populus Rhizosphere | GAMLGQVWDTFVMLIAVFFLLTMIFGAGVYIGRVSKKSDR* |
| Ga0079218_100507162 | 3300007004 | Agricultural Soil | QIWDSFIMLIPVFFLLTMIFGAGVYVGRVSKKER* |
| Ga0079218_124199451 | 3300007004 | Agricultural Soil | MLQQLVDSIVLLIPVFFLLTIIFGAGFYIGRVSKKE* |
| Ga0066710_1000777792 | 3300009012 | Grasslands Soil | MLERLWGTFVLLIPVFVLLTMIFGAGFYIGRVSKKQ |
| Ga0099829_101991582 | 3300009038 | Vadose Zone Soil | MLDELWGTFVLLIPVFFLLTIIFFAGFIIGRVSKREQ* |
| Ga0105250_100680781 | 3300009092 | Switchgrass Rhizosphere | MLQQVWDSFIMLIPVFFLLTMIFGAGFYVGRVSKK |
| Ga0111539_1000327810 | 3300009094 | Populus Rhizosphere | MFQQIWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKER* |
| Ga0105245_104979562 | 3300009098 | Miscanthus Rhizosphere | MLQQVWDSFIMLIPVFILLIMIFGAGFYIGRVSKKER* |
| Ga0105245_112802463 | 3300009098 | Miscanthus Rhizosphere | SSLTKEISMLQQLWDSFVMLIPVFFLLTMIFGAGFFIVRASKKESRE* |
| Ga0105245_114292611 | 3300009098 | Miscanthus Rhizosphere | MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0105245_130591752 | 3300009098 | Miscanthus Rhizosphere | MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKKNS* |
| Ga0075418_101108843 | 3300009100 | Populus Rhizosphere | MLVQVWETFVMLLPVFFLLTMIFGAGFYIGRVSKKG* |
| Ga0075418_102291412 | 3300009100 | Populus Rhizosphere | MIQQIWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKER* |
| Ga0075418_105461361 | 3300009100 | Populus Rhizosphere | MLTQVWDTFIMLIPVFILLTMIFGAGFYIGRVSKKER* |
| Ga0075418_114507441 | 3300009100 | Populus Rhizosphere | LWPKEVIVVLQQLFDSFVLLIPVFFLLLMIFGAGFYIGRVSKKDS* |
| Ga0075418_129248751 | 3300009100 | Populus Rhizosphere | MSIIQQVWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKE |
| Ga0105247_102945602 | 3300009101 | Switchgrass Rhizosphere | MMQQLWDTFVMLIPVFFLLTMIFGAGFYIGRVSKRDT* |
| Ga0105247_109167561 | 3300009101 | Switchgrass Rhizosphere | MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDT* |
| Ga0114129_101000782 | 3300009147 | Populus Rhizosphere | MLSDVWSAFLALIPVFFLLIMIFAAGIYIGRVSKKERN* |
| Ga0114129_101828132 | 3300009147 | Populus Rhizosphere | MSIIQQVWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKER* |
| Ga0114129_102658123 | 3300009147 | Populus Rhizosphere | MLEELWDTFVLLIPVFFLLTLIFGAGVYIGRASKRQ* |
| Ga0114129_111060942 | 3300009147 | Populus Rhizosphere | QVWDTFVMLIPVFFLLTMIFGAGVYIGRVSKKSDR* |
| Ga0114129_121448742 | 3300009147 | Populus Rhizosphere | MSIIQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER* |
| Ga0114129_125115182 | 3300009147 | Populus Rhizosphere | MLQQLVDTFVMLIPVFFLLTMIFGAGFYIGRVSKKDS* |
| Ga0105243_107381592 | 3300009148 | Miscanthus Rhizosphere | MLQQVWDSFTMLIPVFFLLIMIFGAGFYIGRVSKKE* |
| Ga0105243_107728892 | 3300009148 | Miscanthus Rhizosphere | MLQQIWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKDS* |
| Ga0105243_113930521 | 3300009148 | Miscanthus Rhizosphere | MSIIQQIWDSFIMLIPVFFLLTLIFGAGFYIGRVTKKER* |
| Ga0105243_124905112 | 3300009148 | Miscanthus Rhizosphere | QQLWDSFVMLIPVFLLLTMIFGAGFYIGRVSKKDT* |
| Ga0105243_127344912 | 3300009148 | Miscanthus Rhizosphere | MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKKDS* |
| Ga0075423_118066901 | 3300009162 | Populus Rhizosphere | NLTTEATQMLEELWQSFVVMIPIFILLTMIFGAGFYIGRVTKKDT* |
| Ga0075423_125202001 | 3300009162 | Populus Rhizosphere | PSRFQRRLIMLEELWNSFVIMIPVFFLLTLIFGAGFYIGRVSKRE* |
| Ga0105249_108086142 | 3300009553 | Switchgrass Rhizosphere | MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRDS* |
| Ga0105249_113917012 | 3300009553 | Switchgrass Rhizosphere | MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKKER* |
| Ga0105249_118618811 | 3300009553 | Switchgrass Rhizosphere | QQIFDTFVMLIPVFVLLTMIFGAGFYIGRVSKKE* |
| Ga0105249_132153811 | 3300009553 | Switchgrass Rhizosphere | NGGGQMLQQVWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE* |
| Ga0126307_107676042 | 3300009789 | Serpentine Soil | MLQQIWDTFIMMIPVFFLLTMIFGAGFYIGRVSKKGT* |
| Ga0126307_111743941 | 3300009789 | Serpentine Soil | MLQQLWDTLVMMIPVFVLLTMIFGAGFYIGRVSKRE* |
| Ga0126307_113641001 | 3300009789 | Serpentine Soil | SSTKGGRRMLQQIWDNLVMMIPVFFLLTMIFGAGFYIGRVTRKE* |
| Ga0126307_117399202 | 3300009789 | Serpentine Soil | MEVKVLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0126374_109046062 | 3300009792 | Tropical Forest Soil | MLEDLWTNFILLIPVFILLTMIFGAGFYIGRVSKKE* |
| Ga0126313_113197752 | 3300009840 | Serpentine Soil | MVQQLWDTFVMMIPVFFLLTLIFGAGFYVGRVSKRER* |
| Ga0126305_100390562 | 3300010036 | Serpentine Soil | MLQQVWDSFIMLIPVFLLLTMIFGAGFYIGRVTKRE* |
| Ga0126305_102209122 | 3300010036 | Serpentine Soil | MLEQLWGTFITLIPVFFLLTMVFGAGFYIGRVSKRE* |
| Ga0126305_103763362 | 3300010036 | Serpentine Soil | MLQQLWDNFIMLIPVFFLLTMIFGAGFYIGRVSKRDS* |
| Ga0126305_106880662 | 3300010036 | Serpentine Soil | MLQQLFDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS* |
| Ga0126315_100017705 | 3300010038 | Serpentine Soil | MLQQIWDTFVMLIPVFFLLTMIFGAGFYVGRVSKKE* |
| Ga0126315_101662381 | 3300010038 | Serpentine Soil | MLQQLWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKE* |
| Ga0126308_112342661 | 3300010040 | Serpentine Soil | MLQQIWDTFIMMIPVFFLLTMIFGAGFYIGRVSKKDS* |
| Ga0126308_113416671 | 3300010040 | Serpentine Soil | MLQQLWDSFVVLIPVFFLLTLIFGAGIYIGRVSKRE* |
| Ga0126314_103811301 | 3300010042 | Serpentine Soil | QQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKE* |
| Ga0126314_106407072 | 3300010042 | Serpentine Soil | MLQQLWGSFIMLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0126310_101373081 | 3300010044 | Serpentine Soil | MEASMLQQLFDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS* |
| Ga0126310_117237481 | 3300010044 | Serpentine Soil | LRQKEGEKMLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0126311_103262921 | 3300010045 | Serpentine Soil | MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKR |
| Ga0126311_107983432 | 3300010045 | Serpentine Soil | MEASMLQQLFDSFIMLIPVFFLLTMIFAAGFYIGRVSKKDS* |
| Ga0126311_118528922 | 3300010045 | Serpentine Soil | MQQLWDTFVMMIPVFFLLTMIFGAGFYVGRVSKRER* |
| Ga0126384_110638092 | 3300010046 | Tropical Forest Soil | MLEELWNSFVILIPVFFLLTLIFGAGFYIGRVSKRE* |
| Ga0126382_102928901 | 3300010047 | Tropical Forest Soil | MFQQLWETFVMMIPVFLLLTMIFAAGFYIGRVSKRE* |
| Ga0126376_100005545 | 3300010359 | Tropical Forest Soil | MFQQIWDTFVMMIPVFFLLTMIFGAGFYIGRVTKKE* |
| Ga0126376_100067173 | 3300010359 | Tropical Forest Soil | MFQQLWDTFVMMIPVFLLLTMIFGAGFYIGRVSKRE* |
| Ga0126376_100845263 | 3300010359 | Tropical Forest Soil | MLEELWNSFIILIPVFFLLTLIFAAGFYIGRVTKRE* |
| Ga0126376_101338132 | 3300010359 | Tropical Forest Soil | MFQNLWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE* |
| Ga0126376_107914251 | 3300010359 | Tropical Forest Soil | MFEDLWTNFVLLIPIFILLTMIFGAGFYIGRVSKKE* |
| Ga0134066_103877072 | 3300010364 | Grasslands Soil | VLQQLWDSFVVLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0134128_120806842 | 3300010373 | Terrestrial Soil | MLQQIWDTFVMMIPVFFLLTMVFGAGFYIGRVTKRE* |
| Ga0134128_124957182 | 3300010373 | Terrestrial Soil | MLQQLWDSFVLLIPVFFLLTMIFGAGFYVGRVSKKE* |
| Ga0105239_104240622 | 3300010375 | Corn Rhizosphere | MLQQVWDSFTMLIPVFFLLIMIFGAGFYIGRVSKRE* |
| Ga0134126_121460112 | 3300010396 | Terrestrial Soil | MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKKE* |
| Ga0134127_100559264 | 3300010399 | Terrestrial Soil | MFTQVWDAFVMLIPVFILLTMIFGAGFYIGRVSKKE* |
| Ga0134127_116467412 | 3300010399 | Terrestrial Soil | MLQQIFDTFVMLIPVFVLLTMIFGAGFYIGRVSKKE* |
| Ga0134127_130439661 | 3300010399 | Terrestrial Soil | MIQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVTKKDT* |
| Ga0134122_105343732 | 3300010400 | Terrestrial Soil | MLQQLWDSFVLLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0134122_114486332 | 3300010400 | Terrestrial Soil | QQLWVTFVMMIPVFVLLTMIFGAGFYIGRVSKRDT* |
| Ga0134121_1000092212 | 3300010401 | Terrestrial Soil | MLQQLWDNFIMLIPVFFLLTMIFGAGFYIGRVSKKDS* |
| Ga0134121_102490832 | 3300010401 | Terrestrial Soil | MITQVWDAFVMLIPVFILLTMIFGAGFYIGRVSKKE* |
| Ga0134121_110363471 | 3300010401 | Terrestrial Soil | MFQQLWDTFVMLIPVFLLLTMIFGAGFYIGRVTKKE* |
| Ga0134121_124481541 | 3300010401 | Terrestrial Soil | MLQQLWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRK* |
| Ga0134123_103664962 | 3300010403 | Terrestrial Soil | MLQEIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER* |
| Ga0134123_104836611 | 3300010403 | Terrestrial Soil | MMQQLWDTFVMMIPVYVLLTMLFGAGLYIWRVSKKGSW* |
| Ga0134123_105312383 | 3300010403 | Terrestrial Soil | MLEQLWDSFVMLIPVFFLLTMIFGAGFFIGRASKKESRE* |
| Ga0134123_109775042 | 3300010403 | Terrestrial Soil | TKGERQMFEELWNSFVILIPVFFLLTLIFGAGFYIGRVTKRE* |
| Ga0127502_108444111 | 3300011333 | Soil | PHLSLTTEVLRMLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS* |
| Ga0120182_10211281 | 3300011993 | Terrestrial | MLQQLWDSFVLLIPVFFLLLMIFGAGFFIGRASKKDS* |
| Ga0120187_10027662 | 3300012015 | Terrestrial | MLQQLWDSFVLLIPVFFLLIMIFGAGFFIGRASKKDS* |
| Ga0120191_101249592 | 3300012022 | Terrestrial | MLQQIWDTFIILIPVFVLLTMIFGAGVYIGRASKRQ* |
| Ga0136623_100003986 | 3300012045 | Polar Desert Sand | MINELWGTFVMLIPVFLLLTLIFGAGFYIGRVSKREQ* |
| Ga0137378_108038432 | 3300012210 | Vadose Zone Soil | MLRELWGTFVLLVPVFFLLTIIFAAGFVIGRMSKREQ* |
| Ga0137375_101340622 | 3300012360 | Vadose Zone Soil | MVRELWDVFVLLIPVFFLLTLMFVAGFVIGRISKRER* |
| Ga0157356_10170051 | 3300012474 | Unplanted Soil | LHEIWDSFIMLIPVFILLTMIFGAGFYIGRVSKKEE* |
| Ga0136614_100163283 | 3300012684 | Polar Desert Sand | MLRQLWDTFVLLIPVFFLLTIIFGAGFVIGRISTREQ* |
| Ga0137359_100345553 | 3300012923 | Vadose Zone Soil | MLSELWGTFVLLIPVFFLLTIIFFAGFIIGRVSKREQ* |
| Ga0137404_100009488 | 3300012929 | Vadose Zone Soil | MLEDLWHTFITLIPVFILLLMIFGAGFYIGRVSTRK* |
| Ga0137404_112159271 | 3300012929 | Vadose Zone Soil | MLQQLWDTFTMMIPVFLLLTMIFGAGFYIGRVSKRE* |
| Ga0164303_101608961 | 3300012957 | Soil | MFQQLWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE* |
| Ga0157373_107271602 | 3300013100 | Corn Rhizosphere | MSIVQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0157371_107757973 | 3300013102 | Corn Rhizosphere | LVFSFPFLTTEVFEMLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0157374_109732862 | 3300013296 | Miscanthus Rhizosphere | MLQQVWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS* |
| Ga0157374_125753281 | 3300013296 | Miscanthus Rhizosphere | MLQQVWDSFMMLIPVFFLLIMIFGAGFYIGRVSKRE* |
| Ga0157378_106612403 | 3300013297 | Miscanthus Rhizosphere | MLREIFNSFVLLIPVFILLMLTFGAGFAIGRISRREE* |
| Ga0163162_109520952 | 3300013306 | Switchgrass Rhizosphere | MLTQVWDTFMMLIPVFILLTMIFGAGFYIGRVSKKER* |
| Ga0163162_116766601 | 3300013306 | Switchgrass Rhizosphere | MLQQLWDSFIMLIPVFFLLTMILGAEFYIGRVSKKDS* |
| Ga0157372_118042702 | 3300013307 | Corn Rhizosphere | MLQQLWDSFVLLIPVFFLLTMIFGAGFYIGRVSKKDS* |
| Ga0120188_10202401 | 3300013760 | Terrestrial | MLEQLWDSFVLLIPVFFLLIMIFGAGFFIGRASKKDS* |
| Ga0120188_10307132 | 3300013760 | Terrestrial | LQQLWDSFVMLIPVFFLLTMIFGAGFFIGRVNGKNSRE* |
| Ga0182000_104260921 | 3300014487 | Soil | GGLQMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS* |
| Ga0182000_105428472 | 3300014487 | Soil | MLQQLWDSFVLLIPVFFLLIMIFGAGFFIGRASKKES* |
| Ga0157376_116445462 | 3300014969 | Miscanthus Rhizosphere | RPMLQEIWGSFVMLIPVFILLTMIFGAGVYIGRVSKKQE* |
| Ga0182007_101978002 | 3300015262 | Rhizosphere | MLQQLWDSFVLLIPVFFLLTLIFGVGFYIGRVSKRE* |
| Ga0132258_100482009 | 3300015371 | Arabidopsis Rhizosphere | MITQVWDTFIMLIPVFILLTMIFGAGFYIGRVSKKE* |
| Ga0132258_103466873 | 3300015371 | Arabidopsis Rhizosphere | MLEQLWDSFVLLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0132258_108552221 | 3300015371 | Arabidopsis Rhizosphere | MFDELWRSFVVMIPIFFLLTMIFGAGFYIGRVTKKDT* |
| Ga0132257_1032867672 | 3300015373 | Arabidopsis Rhizosphere | ITTEVNLMIEELWNSFVLLIPVFFLLTMIFGAGFYIGRVSKRE* |
| Ga0132255_1000449326 | 3300015374 | Arabidopsis Rhizosphere | MLQQLWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRDS* |
| Ga0132255_1000642376 | 3300015374 | Arabidopsis Rhizosphere | MTAERQERVRPMLQEIWGSFIMLIPVFILLTMIFGAGVYIGRVSKKQE* |
| Ga0190265_104686251 | 3300018422 | Soil | MLQQIWDTFIMLIPVFFLLTMIFGAGFYVGRVSKKE |
| Ga0190265_108933003 | 3300018422 | Soil | MSFIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKK |
| Ga0190265_117537972 | 3300018422 | Soil | MSFIQQIWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKER |
| Ga0190272_125244421 | 3300018429 | Soil | MVNELWGTFVMLIPVFLLLTLIFGAGFYIGRVSKREQ |
| Ga0190270_107264711 | 3300018469 | Soil | MLEEVWITFVTMIPVFILLTMIFGAGFCIGRFTKRE |
| Ga0190270_113386731 | 3300018469 | Soil | MIQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDS |
| Ga0190270_131103022 | 3300018469 | Soil | MLQQVWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE |
| Ga0190274_104183542 | 3300018476 | Soil | MMQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS |
| Ga0190274_133696591 | 3300018476 | Soil | MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVTKRE |
| Ga0187894_1000068832 | 3300019360 | Microbial Mat On Rocks | MIQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKRE |
| Ga0187892_100278264 | 3300019458 | Bio-Ooze | MLREFWDTFVLLIPVFVLLLMIFGAGFYIGRASTRQ |
| Ga0193739_10246102 | 3300020003 | Soil | MLQNLWDSFLMLIPVFLLLLMMFGAGFFIGRKSKQT |
| Ga0196977_10042676 | 3300020146 | Soil | MIQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDT |
| Ga0247695_10022572 | 3300024179 | Soil | MLEELWNSFVILIPVFFLLTMIFGAGFYIGRVTKRE |
| Ga0210076_11332571 | 3300025567 | Natural And Restored Wetlands | MLEQLWGSFVLLIPVFFLLMMIFGAGFYIGRVSKRE |
| Ga0207682_103550171 | 3300025893 | Miscanthus Rhizosphere | MLQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER |
| Ga0207710_1000060913 | 3300025900 | Switchgrass Rhizosphere | MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKD |
| Ga0207710_100605102 | 3300025900 | Switchgrass Rhizosphere | MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS |
| Ga0207647_100062632 | 3300025904 | Corn Rhizosphere | MMQQIWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS |
| Ga0207647_101524753 | 3300025904 | Corn Rhizosphere | PMLQQVWDSFLMLIPVFFLLTMIFGAGFYIGRVSKKE |
| Ga0207647_102398452 | 3300025904 | Corn Rhizosphere | MMQQVWDSFVLLIPVFFLLIMIFGAGFYIGRVSKKDS |
| Ga0207699_110858541 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQQLWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE |
| Ga0207645_102315402 | 3300025907 | Miscanthus Rhizosphere | MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE |
| Ga0207645_105958772 | 3300025907 | Miscanthus Rhizosphere | MSIVQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER |
| Ga0207645_106875882 | 3300025907 | Miscanthus Rhizosphere | MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKKNS |
| Ga0207643_100017773 | 3300025908 | Miscanthus Rhizosphere | MLQQIFDTFVILIPVFVLLTMIFGAGFYIGRVSKKER |
| Ga0207643_102566602 | 3300025908 | Miscanthus Rhizosphere | MLQQVWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE |
| Ga0207654_101496292 | 3300025911 | Corn Rhizosphere | MMQQLWDTFVIMIPVFFLLTMIFGAGFYIGRVSKRDS |
| Ga0207654_101609261 | 3300025911 | Corn Rhizosphere | DLTVSLTTEVFEMLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE |
| Ga0207695_103607642 | 3300025913 | Corn Rhizosphere | MLQQLWDSFVMLIPVFFLLTMIFGAGFFIGRASKKESRE |
| Ga0207681_100444632 | 3300025923 | Switchgrass Rhizosphere | MLTQVWDAFIMLIPVFILLTMIFGAGFYIGRVSKKER |
| Ga0207681_107212482 | 3300025923 | Switchgrass Rhizosphere | MLEQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDSRE |
| Ga0207694_1000286613 | 3300025924 | Corn Rhizosphere | MLQQVWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRD |
| Ga0207650_1000002767 | 3300025925 | Switchgrass Rhizosphere | MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKRDS |
| Ga0207650_101431702 | 3300025925 | Switchgrass Rhizosphere | MLQQLWDTFVMMIPVFLLLTMIFGAGFYIGRVSKREQ |
| Ga0207650_107154102 | 3300025925 | Switchgrass Rhizosphere | MLQTVWDSFVMLIPVFFLLTMIFGAGFYIGRVTKKQE |
| Ga0207650_110644352 | 3300025925 | Switchgrass Rhizosphere | MLQQLWDNFIMLIPVFVLLTMIFGAGFYIGRVSKKDS |
| Ga0207690_101298722 | 3300025932 | Corn Rhizosphere | MLQQVWDSFIMLIPVFFLLIMIFAAGFYIGRVSKKNS |
| Ga0207709_100054664 | 3300025935 | Miscanthus Rhizosphere | MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDT |
| Ga0207709_108313531 | 3300025935 | Miscanthus Rhizosphere | MLQQIWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKDS |
| Ga0207709_114053531 | 3300025935 | Miscanthus Rhizosphere | MSIIQQIWDSFIMLIPVFFLLTLIFGAGFYIGRVTKKER |
| Ga0207670_100003166 | 3300025936 | Switchgrass Rhizosphere | MLQQIFDTFVLLIPVFILLTMIFGAGFYIGRVSKRD |
| Ga0207704_107360252 | 3300025938 | Miscanthus Rhizosphere | MLQQIFDTFVMLIPVFVLLTMIFGAGFYIGRVSKKE |
| Ga0207665_109342122 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQQIWDTFVMMIPVFFLLTIVFGAGFYIGRVSKRE |
| Ga0207691_110562361 | 3300025940 | Miscanthus Rhizosphere | VFPTVWLRRRCIQMITQVWDTFVMLIPVFILLTMIFGAGFYIGRVSKKE |
| Ga0207689_102754502 | 3300025942 | Miscanthus Rhizosphere | MTSLNLKEVARMLQQVWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE |
| Ga0207679_104116512 | 3300025945 | Corn Rhizosphere | MLEELWNSFVILIPVFCLLTLIFAAGFYIGRVSKRE |
| Ga0207679_105790521 | 3300025945 | Corn Rhizosphere | MLQQLWDNFVMLIPVFFLLTMIFGAGFYIGRVSKKE |
| Ga0207679_115799262 | 3300025945 | Corn Rhizosphere | MIQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE |
| Ga0207667_114684393 | 3300025949 | Corn Rhizosphere | LWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDSRE |
| Ga0207651_121365592 | 3300025960 | Switchgrass Rhizosphere | MLEQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDS |
| Ga0207712_104054273 | 3300025961 | Switchgrass Rhizosphere | MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKKER |
| Ga0210102_10656371 | 3300025971 | Natural And Restored Wetlands | MLEEIWRTFVVMIPVFFLLTMIFGAGFYIGRVTRKE |
| Ga0207640_100571866 | 3300025981 | Corn Rhizosphere | LWDSFVMLIPVFFLLTMIFGAGFFIGRASKKESRE |
| Ga0207677_103126852 | 3300026023 | Miscanthus Rhizosphere | MIQQLWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER |
| Ga0208537_10186652 | 3300026071 | Natural And Restored Wetlands | MQSCLTEVVEMLEQLWGSFVLLIPVFFLLMMIFGAGFYIGRVSKRE |
| Ga0207708_120587651 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | RCIQMITQVWDTFVMLIPVFILLTMIFGAGFYIGRVSKKE |
| Ga0207641_105817612 | 3300026088 | Switchgrass Rhizosphere | VKRRSSMLQQIFDTFVMLIPVFILLTMIFGAGFYIGRVSKRD |
| Ga0207641_125487201 | 3300026088 | Switchgrass Rhizosphere | MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS |
| Ga0207648_100947514 | 3300026089 | Miscanthus Rhizosphere | MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDTEAAD |
| Ga0207648_102129852 | 3300026089 | Miscanthus Rhizosphere | MLQQLWDSFIMLIPVFFLLTMIFGAGFYIDRVSKKES |
| Ga0207648_109875692 | 3300026089 | Miscanthus Rhizosphere | MLQQVWDSFTMLIPVFFLLIMIFGAGFYIGRVSKKE |
| Ga0207648_117321151 | 3300026089 | Miscanthus Rhizosphere | EMVSELWNTFVMLIPVFVLLTLIFGAGFYIGRVSKREQ |
| Ga0207676_109916442 | 3300026095 | Switchgrass Rhizosphere | SSMLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE |
| Ga0207674_105682322 | 3300026116 | Corn Rhizosphere | MLQQLWDNFIMLIPVFFLLTMIFGAGFYIGRVSKKDS |
| Ga0207674_106037942 | 3300026116 | Corn Rhizosphere | MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKE |
| Ga0207675_1001807761 | 3300026118 | Switchgrass Rhizosphere | MLQQLWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE |
| Ga0209153_10315982 | 3300026312 | Soil | MLQQIWDTFVMMIPVFFLLTIIFGAGFYIGRVTKRE |
| Ga0257171_10327511 | 3300026377 | Soil | MLSELWGTFVLLIPVFFLLTIIFAAGFVIGRMSKREQ |
| Ga0256867_100055227 | 3300026535 | Soil | MLEQLWDSFVMLIPVFFLLIMIFGAGFYIGRVSKKDS |
| Ga0209056_101295563 | 3300026538 | Soil | MLERLWGTFVLLIPVFVLLTMIFGAGFVIGRVSKKQ |
| Ga0209215_10001279 | 3300027266 | Forest Soil | MLQQIWDTFVMMIPVFFLLTLIFAAGFYIGRVSKRDT |
| Ga0209216_100001258 | 3300027530 | Forest Soil | MDQIWGTFVTLIPVFFLLTIVFGAGIYIGRVSKRE |
| Ga0209818_10010115 | 3300027637 | Agricultural Soil | MSIIQQIWDSFILLIPVFFLLTMIFGAGFYVGRVSKKER |
| Ga0209818_10239462 | 3300027637 | Agricultural Soil | MSIIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER |
| Ga0209818_11462961 | 3300027637 | Agricultural Soil | MVQQLWDSFVLLIPVFFLLTMIFGAGFYIGRVSKRE |
| Ga0209387_12513912 | 3300027639 | Agricultural Soil | MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKER |
| Ga0209485_10458701 | 3300027691 | Agricultural Soil | QMLQQVWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE |
| Ga0209177_104521152 | 3300027775 | Agricultural Soil | MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKKD |
| Ga0209814_102903502 | 3300027873 | Populus Rhizosphere | MSIIQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER |
| Ga0209481_100455892 | 3300027880 | Populus Rhizosphere | MLQQLWDTFVIMIPVFFLLTMIFGAGFYIGRVSKREQ |
| Ga0209486_101512412 | 3300027886 | Agricultural Soil | MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKRER |
| Ga0207428_100103267 | 3300027907 | Populus Rhizosphere | MMQQIWDTFVMMIPVFFLLTMIFGAGFYIGRVSKRDS |
| Ga0207428_100602932 | 3300027907 | Populus Rhizosphere | MFQQIWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKER |
| Ga0209382_114327432 | 3300027909 | Populus Rhizosphere | LWPKEVIVVLQQLFDSFVLLIPVFFLLLMIFGAGFYIGRVSKKDC |
| Ga0268266_113996191 | 3300028379 | Switchgrass Rhizosphere | MLQQVWDSFLMLIPVFFLLTMIFGAGFYIGRVSKK |
| Ga0268265_104204282 | 3300028380 | Switchgrass Rhizosphere | MLQTVWDSFVMLIPVFFLLTMLFGAGFYIGRVTKKQE |
| Ga0268265_121357742 | 3300028380 | Switchgrass Rhizosphere | MFDELWRSFVVMIPIFFLLTMIFGAGFYIGRVTKKE |
| Ga0268264_107074802 | 3300028381 | Switchgrass Rhizosphere | MIQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER |
| Ga0268243_11231231 | 3300030510 | Soil | GGLQMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS |
| Ga0268241_100545192 | 3300030511 | Soil | MLERLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKRE |
| Ga0310888_100009852 | 3300031538 | Soil | MLTQVWDTFMMLIPVFILLTMIFGAGFYIGRVSKKEQ |
| Ga0310888_108705881 | 3300031538 | Soil | LHILGGPMLQQVWDSFLMLIPVFFLLTMIFGAGFYIGRVSKKE |
| Ga0307408_1002098732 | 3300031548 | Rhizosphere | MLQQIFDTFVMLIPVFFLLTMIFGAGFYIGRVSKKDS |
| Ga0307408_1002107122 | 3300031548 | Rhizosphere | MLQQVWDSFVLLIPVFFLLIMIFGAGFYIGRVSKKDS |
| Ga0307408_1002827362 | 3300031548 | Rhizosphere | MLQQLWDNFILLIPVFVLLTMIFGAGFYIGRVSKKDS |
| Ga0307405_100974892 | 3300031731 | Rhizosphere | MLQQLWDSIVLLIPVFFLLTMIFGAGFYIGRVTKKE |
| Ga0307405_106954092 | 3300031731 | Rhizosphere | MLQQVWDTFVMLIPVFLLLTMIFGAGFYIGRVSKR |
| Ga0307468_1002636881 | 3300031740 | Hardwood Forest Soil | MLEQIWGTFVMMIPVFFLLTMIFGAGFYIGRVTKKE |
| Ga0310904_106963642 | 3300031854 | Soil | SSTQRRPQMLQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER |
| Ga0310892_110019881 | 3300031858 | Soil | MLQTVWDSFVMLIPVFFLLTMIFGAGFYLGRVTKKEE |
| Ga0307406_104617772 | 3300031901 | Rhizosphere | MLQQIVDTFVMLIPVFFLLTMIFGAGFYIGRVSKKDS |
| Ga0307407_103556942 | 3300031903 | Rhizosphere | MCAMLQQLWDSIVLLIPVFFLLTMIFGAGFYIGRVTKKE |
| Ga0308175_1024622192 | 3300031938 | Soil | GELMLQQLWDSFVVLIPVFFLLTMIFGAGFYIGRVSKRE |
| Ga0307409_1018853552 | 3300031995 | Rhizosphere | MVRELWETFVMLIPVFFLLTMIFGAGFYIGRVSKREQ |
| Ga0307416_1026783052 | 3300032002 | Rhizosphere | RCAMLQQLWDSIVLLIPVFFLLTMIFGAGFYIGRVTKKE |
| Ga0315912_101753242 | 3300032157 | Soil | MLQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE |
| ⦗Top⦘ |