| Basic Information | |
|---|---|
| Family ID | F007658 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 347 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MGYQALLFCPDEKTARVVTQVLSELEFRVEPCNEPFAAVKKLM |
| Number of Associated Samples | 289 |
| Number of Associated Scaffolds | 347 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 25.82 % |
| % of genes near scaffold ends (potentially truncated) | 60.52 % |
| % of genes from short scaffolds (< 2000 bps) | 53.60 % |
| Associated GOLD sequencing projects | 265 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.942 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.357 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.173 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.755 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.58% β-sheet: 0.00% Coil/Unstructured: 70.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 347 Family Scaffolds |
|---|---|---|
| PF03544 | TonB_C | 20.17 |
| PF00924 | MS_channel | 8.07 |
| PF07992 | Pyr_redox_2 | 2.02 |
| PF00198 | 2-oxoacid_dh | 0.58 |
| PF02245 | Pur_DNA_glyco | 0.58 |
| PF04185 | Phosphoesterase | 0.58 |
| PF04014 | MazE_antitoxin | 0.58 |
| PF00210 | Ferritin | 0.58 |
| PF14023 | DUF4239 | 0.58 |
| PF14748 | P5CR_dimer | 0.58 |
| PF02852 | Pyr_redox_dim | 0.58 |
| PF05494 | MlaC | 0.29 |
| PF08447 | PAS_3 | 0.29 |
| PF07690 | MFS_1 | 0.29 |
| PF13676 | TIR_2 | 0.29 |
| PF02817 | E3_binding | 0.29 |
| PF12704 | MacB_PCD | 0.29 |
| PF02074 | Peptidase_M32 | 0.29 |
| PF10387 | DUF2442 | 0.29 |
| PF13683 | rve_3 | 0.29 |
| PF02452 | PemK_toxin | 0.29 |
| PF09413 | DUF2007 | 0.29 |
| PF00578 | AhpC-TSA | 0.29 |
| PF00902 | TatC | 0.29 |
| PF01734 | Patatin | 0.29 |
| PF00072 | Response_reg | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 347 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 20.17 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 8.07 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 8.07 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.86 |
| COG2094 | 3-methyladenine DNA glycosylase Mpg | Replication, recombination and repair [L] | 0.58 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.29 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.29 |
| COG2317 | Zn-dependent carboxypeptidase, M32 family | Posttranslational modification, protein turnover, chaperones [O] | 0.29 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.29 |
| COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.29 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.94 % |
| Unclassified | root | N/A | 40.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908043|A2_c1_ConsensusfromContig59817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 2228664022|INPgaii200_c0531779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105717463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300000955|JGI1027J12803_100837783 | All Organisms → cellular organisms → Bacteria | 4211 | Open in IMG/M |
| 3300000955|JGI1027J12803_105170465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300001180|JGI12695J13573_1000688 | All Organisms → cellular organisms → Bacteria | 2821 | Open in IMG/M |
| 3300001546|JGI12659J15293_10094758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100447077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1170 | Open in IMG/M |
| 3300002917|JGI25616J43925_10303784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300004080|Ga0062385_10584456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300004082|Ga0062384_100361907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300004091|Ga0062387_100889209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300004156|Ga0062589_100004203 | All Organisms → cellular organisms → Bacteria | 5011 | Open in IMG/M |
| 3300004633|Ga0066395_10058980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1728 | Open in IMG/M |
| 3300004635|Ga0062388_101206017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 749 | Open in IMG/M |
| 3300005177|Ga0066690_10009041 | All Organisms → cellular organisms → Bacteria | 4990 | Open in IMG/M |
| 3300005177|Ga0066690_10101343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1849 | Open in IMG/M |
| 3300005178|Ga0066688_10885412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300005439|Ga0070711_100725609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300005454|Ga0066687_10568520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300005518|Ga0070699_100160697 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
| 3300005526|Ga0073909_10600486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300005533|Ga0070734_10018884 | All Organisms → cellular organisms → Bacteria | 4622 | Open in IMG/M |
| 3300005538|Ga0070731_10086554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2077 | Open in IMG/M |
| 3300005541|Ga0070733_10167988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1428 | Open in IMG/M |
| 3300005541|Ga0070733_10251930 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300005541|Ga0070733_11225284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300005542|Ga0070732_10272242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300005542|Ga0070732_10370933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300005542|Ga0070732_10500728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300005554|Ga0066661_10278705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1032 | Open in IMG/M |
| 3300005555|Ga0066692_10242873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1136 | Open in IMG/M |
| 3300005569|Ga0066705_10391325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300005602|Ga0070762_10233902 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300006028|Ga0070717_11723275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300006059|Ga0075017_101281119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300006173|Ga0070716_101853149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300006176|Ga0070765_101375127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300006755|Ga0079222_12130947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300006800|Ga0066660_11465117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300006804|Ga0079221_11630203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300006893|Ga0073928_10699791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300009012|Ga0066710_101370796 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300009093|Ga0105240_11265853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300009520|Ga0116214_1315276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300009521|Ga0116222_1016514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3387 | Open in IMG/M |
| 3300009522|Ga0116218_1374110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300009522|Ga0116218_1447754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300009523|Ga0116221_1543952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300009545|Ga0105237_11933031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300009623|Ga0116133_1120806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300009624|Ga0116105_1200909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300009645|Ga0116106_1306770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300009700|Ga0116217_10500175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300009700|Ga0116217_10874021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300009762|Ga0116130_1006131 | All Organisms → cellular organisms → Bacteria | 4753 | Open in IMG/M |
| 3300009792|Ga0126374_10126473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1505 | Open in IMG/M |
| 3300009824|Ga0116219_10581138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300010343|Ga0074044_10385836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300010343|Ga0074044_11008374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300010360|Ga0126372_10357092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1314 | Open in IMG/M |
| 3300010360|Ga0126372_12678586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300010360|Ga0126372_13211484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300010366|Ga0126379_10053019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3352 | Open in IMG/M |
| 3300010396|Ga0134126_10037579 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 6110 | Open in IMG/M |
| 3300010398|Ga0126383_13053059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300011269|Ga0137392_10444119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300012202|Ga0137363_10787682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300012203|Ga0137399_10342130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1241 | Open in IMG/M |
| 3300012212|Ga0150985_121000459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300012363|Ga0137390_11556289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300012918|Ga0137396_10709684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300012927|Ga0137416_10675308 | Not Available | 906 | Open in IMG/M |
| 3300012948|Ga0126375_10445299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300012958|Ga0164299_11417940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300012971|Ga0126369_11790881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300014161|Ga0181529_10612274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300014168|Ga0181534_10190288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300014654|Ga0181525_10111284 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300015078|Ga0167660_1018803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300015264|Ga0137403_10302035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1495 | Open in IMG/M |
| 3300015372|Ga0132256_100352152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1567 | Open in IMG/M |
| 3300016341|Ga0182035_10181092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1649 | Open in IMG/M |
| 3300016357|Ga0182032_10290668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1286 | Open in IMG/M |
| 3300016404|Ga0182037_10327910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300016422|Ga0182039_10595960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300017927|Ga0187824_10274018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300017933|Ga0187801_10353067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300017934|Ga0187803_10272117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300017935|Ga0187848_10068556 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300017936|Ga0187821_10150409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300017946|Ga0187879_10354269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300017955|Ga0187817_10931824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300017972|Ga0187781_10139456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1698 | Open in IMG/M |
| 3300017975|Ga0187782_10057839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2822 | Open in IMG/M |
| 3300017975|Ga0187782_10259236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1308 | Open in IMG/M |
| 3300017995|Ga0187816_10017642 | All Organisms → cellular organisms → Bacteria | 2760 | Open in IMG/M |
| 3300017995|Ga0187816_10179254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300017995|Ga0187816_10188692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300018006|Ga0187804_10225578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
| 3300018007|Ga0187805_10348078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300018018|Ga0187886_1134196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300018046|Ga0187851_10321673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300018085|Ga0187772_10555657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300018085|Ga0187772_10610836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300018088|Ga0187771_10997043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300018431|Ga0066655_10419656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| 3300019786|Ga0182025_1099667 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300019786|Ga0182025_1343721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2126 | Open in IMG/M |
| 3300019787|Ga0182031_1164002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300019789|Ga0137408_1464641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5539 | Open in IMG/M |
| 3300019879|Ga0193723_1104660 | Not Available | 796 | Open in IMG/M |
| 3300019887|Ga0193729_1255335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300020581|Ga0210399_10051081 | All Organisms → cellular organisms → Bacteria | 3322 | Open in IMG/M |
| 3300021088|Ga0210404_10377244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300021168|Ga0210406_10343985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1204 | Open in IMG/M |
| 3300021168|Ga0210406_10614288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300021180|Ga0210396_10201804 | All Organisms → cellular organisms → Bacteria | 1776 | Open in IMG/M |
| 3300021180|Ga0210396_11517058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300021401|Ga0210393_10131489 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300021401|Ga0210393_11332897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300021402|Ga0210385_11180250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300021403|Ga0210397_10893956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300021405|Ga0210387_10550408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
| 3300021407|Ga0210383_11413141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300021420|Ga0210394_10249671 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300021432|Ga0210384_10468860 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300021433|Ga0210391_10228917 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300021433|Ga0210391_10439103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
| 3300021478|Ga0210402_11596135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300021560|Ga0126371_11464140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300023012|Ga0228597_108755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300023019|Ga0224560_114019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300023259|Ga0224551_1047683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300024055|Ga0247794_10125963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300024295|Ga0224556_1133481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300025414|Ga0208935_1007868 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300025898|Ga0207692_10699228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300025914|Ga0207671_10273530 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300025928|Ga0207700_11331590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300025939|Ga0207665_11005892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300025945|Ga0207679_12029139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300026298|Ga0209236_1071506 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300026325|Ga0209152_10030106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1863 | Open in IMG/M |
| 3300026335|Ga0209804_1040710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2312 | Open in IMG/M |
| 3300026335|Ga0209804_1306020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300026557|Ga0179587_10393791 | Not Available | 902 | Open in IMG/M |
| 3300026557|Ga0179587_11177228 | Not Available | 504 | Open in IMG/M |
| 3300027096|Ga0208099_1066681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300027610|Ga0209528_1148299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300027641|Ga0208827_1027068 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300027660|Ga0209736_1005076 | All Organisms → cellular organisms → Bacteria | 4335 | Open in IMG/M |
| 3300027674|Ga0209118_1016769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2386 | Open in IMG/M |
| 3300027684|Ga0209626_1119896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300027737|Ga0209038_10173478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300027768|Ga0209772_10250063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300027812|Ga0209656_10119773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1357 | Open in IMG/M |
| 3300027862|Ga0209701_10166488 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300027889|Ga0209380_10543489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300027889|Ga0209380_10558485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300027895|Ga0209624_10851579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300027898|Ga0209067_10914198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300027908|Ga0209006_10415945 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300027911|Ga0209698_10758499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300028015|Ga0265353_1036263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300028746|Ga0302233_10258760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300028785|Ga0302201_10291637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300028799|Ga0307284_10333933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300028863|Ga0302218_10250431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300028906|Ga0308309_10290666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1379 | Open in IMG/M |
| 3300028906|Ga0308309_10958789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300029883|Ga0311327_10707595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300029911|Ga0311361_10334927 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300029939|Ga0311328_10832895 | Not Available | 613 | Open in IMG/M |
| 3300029943|Ga0311340_10570244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300030506|Ga0302194_10049845 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
| 3300030509|Ga0302183_10319209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300030580|Ga0311355_10014985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9851 | Open in IMG/M |
| 3300030813|Ga0265750_1089003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300030815|Ga0265746_1008520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300031018|Ga0265773_1041147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300031057|Ga0170834_109532898 | All Organisms → cellular organisms → Bacteria | 2042 | Open in IMG/M |
| 3300031708|Ga0310686_104941699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300031715|Ga0307476_10463189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300031740|Ga0307468_100187828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1381 | Open in IMG/M |
| 3300031753|Ga0307477_10018571 | All Organisms → cellular organisms → Bacteria | 4749 | Open in IMG/M |
| 3300031765|Ga0318554_10113666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1526 | Open in IMG/M |
| 3300031780|Ga0318508_1166695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300031823|Ga0307478_11592656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300031946|Ga0310910_10618970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300031954|Ga0306926_11858363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300031962|Ga0307479_11302444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300032041|Ga0318549_10097711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1277 | Open in IMG/M |
| 3300032174|Ga0307470_11614232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300032174|Ga0307470_11841008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300032180|Ga0307471_101667874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300032261|Ga0306920_100055071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5790 | Open in IMG/M |
| 3300032770|Ga0335085_10430612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1523 | Open in IMG/M |
| 3300032770|Ga0335085_10723401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300032828|Ga0335080_10919076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
| 3300032829|Ga0335070_10389820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1334 | Open in IMG/M |
| 3300032829|Ga0335070_11750178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300032892|Ga0335081_10152481 | All Organisms → cellular organisms → Bacteria | 3301 | Open in IMG/M |
| 3300032892|Ga0335081_11016890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
| 3300032892|Ga0335081_12305822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300032898|Ga0335072_10482340 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300032954|Ga0335083_10021862 | All Organisms → cellular organisms → Bacteria | 7353 | Open in IMG/M |
| 3300033158|Ga0335077_10326039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1672 | Open in IMG/M |
| 3300033158|Ga0335077_11729787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300033402|Ga0326728_10562056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300033547|Ga0316212_1051932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300033983|Ga0371488_0306864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300034065|Ga0334827_094607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.49% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.03% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.59% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.59% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.02% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.02% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.02% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.73% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.15% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.15% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.58% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.58% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.58% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.58% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.58% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.29% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.29% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.29% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.29% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.29% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.29% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.29% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.29% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.29% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.29% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.29% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001632 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015078 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023012 | Spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU4 | Environmental | Open in IMG/M |
| 3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027459 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028766 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2_c1_01064120 | 2124908043 | Soil | MGYQALLFCPDEKTARTVTQVLSELEFTVESCIEPFAAVKKLMGQHFD |
| INPgaii200_05317791 | 2228664022 | Soil | MGYQALLFCPDEKTARTVTQVLXXLDXXXEPCSEPFAAVK |
| INPhiseqgaiiFebDRAFT_1057174631 | 3300000364 | Soil | MGYQALLFCPDEKTARTVTQVLSELDFTIEPCSEPFA |
| JGI1027J12803_1008377834 | 3300000955 | Soil | MGYQALLFCPDDKTARTVTQVLSELEFTVEACIEPFAAVKKL |
| JGI1027J12803_1051704652 | 3300000955 | Soil | MGYQALLFCPDEKTARTVTQVLNDLDFAVGPCVEPFAAVKKLMAQH |
| JGI12695J13573_10006884 | 3300001180 | Forest Soil | MGYQALLFCPDEKTARPVTQVLSELDFSVTPCTEPFAAVKKLMAEHFDAVV |
| C688J14111_102679232 | 3300001305 | Soil | MSYRALLFCPDEAAARLVTQVLSELEFTVELSLEPFVTVQKLSAEAFDAVVVDCANEENAAL |
| JGI12659J15293_100947583 | 3300001546 | Forest Soil | MGYQALLFCPDEKTARTVTQVLNELEFAVESCIEPFAAVKKLMGQHFDA |
| JGI12635J15846_108741061 | 3300001593 | Forest Soil | MSYQALLFCPDEKTARVVSQVLHELEFSVEPCHEPFSAVKKLM |
| JGI20235J16296_10030191 | 3300001632 | Forest Soil | MGYQALLFCSDEKLAAIVTQIFSELEFAIEAVHEPFAA |
| JGIcombinedJ26739_1000905633 | 3300002245 | Forest Soil | MSYQALLFCPDERTARVVSQVLSELEFNVEPCHEPFAAVKKLMAQ |
| JGIcombinedJ26739_1004470771 | 3300002245 | Forest Soil | MGYQALLFCPDEXLARVVSQVFSELDFTVEPVHEPFAAVKKLM |
| JGI25616J43925_103037842 | 3300002917 | Grasslands Soil | MGYQALLFCPDEKTARTVTQVLSELEFNVESCTEPFAAVKRLMGE |
| rootL2_101597123 | 3300003322 | Sugarcane Root And Bulk Soil | MGYQALLFCADEKSAQLVTQVLTELEFSVEPANEPFAAVKRLTTQHFDAVV |
| Ga0062385_101090462 | 3300004080 | Bog Forest Soil | MKYNALLFCPDEKTARVVTQVLNDLEFRVEPCNEPFAAVKRL |
| Ga0062385_105844562 | 3300004080 | Bog Forest Soil | MGYQALLFCPDEKLARVVSQVFSELDFSIEPVHEPFAAVKKLM |
| Ga0062384_1003619072 | 3300004082 | Bog Forest Soil | MGYQALLFCPDEKTARTVTQVLGELEFSVEACLEPFAAVKKLMSQHFDAVVV |
| Ga0062387_1008892091 | 3300004091 | Bog Forest Soil | MGYEALLFCPDEKTARTVTQVLSELEFSVEACMEPFAAVKKLMGQHFDAVVVD |
| Ga0062387_1010020061 | 3300004091 | Bog Forest Soil | MGYQALLFCPDEKLASVVSQVFCDLDFSVEAVHEPFAAVK |
| Ga0062589_1000042031 | 3300004156 | Soil | MGYQALLFCPDDKLARVVTQVLSDLDFSVETATEPFAAVKKLM |
| Ga0062589_1001650341 | 3300004156 | Soil | MGYQALLFCPDEKLARVVTQVLSDLDFSVETATEPFAAVKKLM |
| Ga0062589_1022343011 | 3300004156 | Soil | MSYQALLFCPDEKTARVVNQVLSELEFAVEPCHEPFAAVKKLM |
| Ga0066395_100589802 | 3300004633 | Tropical Forest Soil | MGYQALLFCPDEKLARVVTQVFSDLEFSVEPVNEPFAAVKKLMAQRY |
| Ga0062388_1012060171 | 3300004635 | Bog Forest Soil | MSYKALLFCPDEKTARTVTQVLTELDFQVEACNEPFAAVKKLTTEHFDGVVVDCD |
| Ga0066680_104522181 | 3300005174 | Soil | MSYQALLFCPDERTAHVVTQVLSEVEFSVESCNEPFAAVKRLM |
| Ga0066690_100090411 | 3300005177 | Soil | MGYQALLFCPDDKTARTVTQVLSELEFTVEACIEPFAAVKKLMGQHFDAVV |
| Ga0066690_101013431 | 3300005177 | Soil | MGYQALLFCPDEKTARTVTQVLSELDFTVVPCTEPFAAVKKLM |
| Ga0066688_108854121 | 3300005178 | Soil | MGYQALLFCPDEKNARVVTQVLTELDFSVEPAAEPFAAVKKLMAQHFDAIVV |
| Ga0066684_109722322 | 3300005179 | Soil | MSYRALLFCPDEAAARLVTQVLSELEFTVELSFEPFVTVQKLATEAFDAVVVDCANEE |
| Ga0066671_100372893 | 3300005184 | Soil | MGYQALLFCPDEKNARVVTQVLTELDFSVEPVAEPFAAVKKLM |
| Ga0066675_102119163 | 3300005187 | Soil | MSYRALLFCPDEAAARLVTQVLSELEFTVELSFEPFVTVQKLTAEAFDAVVVDCANEENA |
| Ga0065704_106309812 | 3300005289 | Switchgrass Rhizosphere | MGYQALLFCPDEKLARVVTQVLSDLDFSVETATEPFAAVKKLMA |
| Ga0070683_1023615501 | 3300005329 | Corn Rhizosphere | MSYQALLFCPDEKTARVVTQVLTELEFSVEPCHEPFAEVKKLMVQHFDA |
| Ga0070677_107774521 | 3300005333 | Miscanthus Rhizosphere | MSYQALLFCPDEKTARVVNQVLSELEFAVEPCHEPFAAVKKLMVQHFDAIVVD |
| Ga0068869_1000011053 | 3300005334 | Miscanthus Rhizosphere | MGYQALLFCGDERTAQLVTQVLTELEFSVEPANEPFAAVKRLTTQHFDAVVVD* |
| Ga0070710_110943172 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYRALLFCPDEAAARLVTQVLSELEFTVELSFEPFVTVQKLTTEPFDAVVVDCTN |
| Ga0070711_1007256092 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYQALLFCPDDKTARTVTQVLSELDFTVEACIEPFAAVKKL |
| Ga0066687_105685202 | 3300005454 | Soil | MGYTALLFCPEEKTARTVTQVLSELEFTVEACTEPFAAVKKLMSQHFDA |
| Ga0070678_1004426731 | 3300005456 | Miscanthus Rhizosphere | MSYQALLFCPDEKTARVVNQVLSELEFAVEPCHEPFAAVKKLMVQHF |
| Ga0070699_1001606973 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYQSLLFCPDEKTARTVTQVLTELEFAVEPCSEPFAAVKKLMGEHFDAIVVD |
| Ga0073909_106004861 | 3300005526 | Surface Soil | MGYLALLFCPDDKTARTVTQVLSELEFNVEACTEPFAAVKKLM |
| Ga0070741_108721261 | 3300005529 | Surface Soil | MSYRALLFCPDETAARPVTQVLSELDFTVELSFEPLVTVKKLTDESFDAIVVDCGNEENA |
| Ga0070734_100188845 | 3300005533 | Surface Soil | MGYTALLFCPDEKTARTVTQVLGELEFAVEACTEPFTAVKKLMG |
| Ga0070731_100865545 | 3300005538 | Surface Soil | MKYNALLFCPDEKTARVVTQVLTDLEFRVEPCNEPFAAVKKLMAEHFDAIVVDC |
| Ga0070733_101679881 | 3300005541 | Surface Soil | MGYTALLFCPEEKTARTVTQVLSELEFTVEACIEPFAAVKKLMGQHFDAV |
| Ga0070733_102519301 | 3300005541 | Surface Soil | MGYQALLFCPDEKTARTVTQVLNELEFAVESCIEPF |
| Ga0070733_103919111 | 3300005541 | Surface Soil | MSYKSLLFCPDEKTARVVTQVLSELEFTIELSNEPFATVKKLTDEHF |
| Ga0070733_112252841 | 3300005541 | Surface Soil | MGYQALLFCPDEKTARTVTQVLSELDFEVVPCTEPFAA |
| Ga0070732_102722423 | 3300005542 | Surface Soil | MGYQALLFCPDDKTARTVTQVLSELEFTVEACIEPFAAVKKLMGEHFDA |
| Ga0070732_103709332 | 3300005542 | Surface Soil | MGYQALLFCPDEKIARTVTQVLSELEFTVDACVEPFAAVKKLMGQHFD |
| Ga0070732_105007281 | 3300005542 | Surface Soil | MFCMGYTALLFCPDDKTARTVTQVLSELEFTVEACIEPFAAVKKLMGQHFDA |
| Ga0066695_104247092 | 3300005553 | Soil | MSYKSLLFCPDEKSARLVTQVLSELEFTVELAGETYAAVKKLTDEH |
| Ga0066661_102787051 | 3300005554 | Soil | MGYQALLFCPDEKTARNVTHVLNDLDFTVEPCTEP |
| Ga0066692_102428732 | 3300005555 | Soil | MRYQALLFCPDEKIARVVTQVLSELDFSVEPVAEPFAAVKKLMAQHFDAIVVD |
| Ga0070664_1015534351 | 3300005564 | Corn Rhizosphere | MSYQALLFCPDEKTARVVNQVLSELEFAVEPCHEPFAAVKKLMVQ |
| Ga0066693_100661771 | 3300005566 | Soil | MAIMHYQALLFCPDDKTARVVTQVLSELEFQVERCNEPFATVKKLMAQH |
| Ga0066705_103913252 | 3300005569 | Soil | MGYTALLFCPDEKTARTVTQVLSELEFSVEACTEPFAAVKKLMGQHF |
| Ga0066705_105167221 | 3300005569 | Soil | MSYQALLFCPDERTAHVVTQVLSEVEFSVECCNEP |
| Ga0066694_104905402 | 3300005574 | Soil | MSYKSLLFCPDEKSARLVTQVLSELEFTVELAAETYAAVKKLTDEHFDA |
| Ga0066702_106180111 | 3300005575 | Soil | MSYRALLFCPDEAAARLVTQVLSELEFTVELSLEPFV |
| Ga0070761_100961682 | 3300005591 | Soil | MKYSALLFCPDEKTARVVTQVLNDLEFRVEPCNEPFAAVKRLMAEHFDAIV |
| Ga0070762_102339021 | 3300005602 | Soil | MGYQALLFCPDEKTARSVTQVLSELDFTVTPCTEPFGAVKKLMGEHFDA |
| Ga0066903_1032823641 | 3300005764 | Tropical Forest Soil | MSYQALLFCPDEKTARVVTQVLSELDFAVEPCNEPFAAVK |
| Ga0070717_117232751 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYQALLFCPDEKTARTVTQVLSELDFAVEPCTEPFVAVKKLMAQHFDAI |
| Ga0066652_1011492081 | 3300006046 | Soil | MSYQALLFCPDEKTARVVSQVLSELDFHVEPCNEPFAAVKKLMAQHFD |
| Ga0075026_1004287502 | 3300006057 | Watersheds | MGYQALLFCPDEKTARVVTQVLSELEFRVEPCNEPFAAVKKLM |
| Ga0075017_1012811192 | 3300006059 | Watersheds | MGYQALLFCPDEKTARTVTQVLSELEFNVEACTEPFAAVKKLMGQH |
| Ga0070716_1018531492 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYQALLFCPDEKTARNVTQVLNDLDFTVEPCSEPFAAVKKLMAQHFD |
| Ga0075014_1009525322 | 3300006174 | Watersheds | MSYQALLFCPDDKTARVVSQVLSELEFHVEPCNEPFAAVKRLMAQH |
| Ga0070765_1013751272 | 3300006176 | Soil | MGYQALLFCPDEKTARTVTQVLNELEFSVQACTEPFAAVK |
| Ga0075021_108297542 | 3300006354 | Watersheds | MSYKALLFCPDDKTARVVTQVLSELEFRVEPCNEPFAAVKKLMAEHFDA |
| Ga0079222_121309471 | 3300006755 | Agricultural Soil | MGYQALLFCPDEKTARAVTQVLSELDFSVEPCSEPFAAVKKLMA |
| Ga0066665_105287842 | 3300006796 | Soil | MSYKALLFCPDEKTIQVVTQVLSELDFTVQRSSEPFATVKKL |
| Ga0066660_114651171 | 3300006800 | Soil | MGYQALLFCPDEKTARTVTQVLNELEFSVEPCIEPFAAVKKLMGQH |
| Ga0079221_116302032 | 3300006804 | Agricultural Soil | MGYTALLFCPEEKTARTVTQVLSELEFTIEACSEPFAAVKKLMGQHFDAVVVD |
| Ga0075434_1011678542 | 3300006871 | Populus Rhizosphere | MSFRSLLFCPDETTARLVTQVLSELDFTVEVARESFAAVERL |
| Ga0073928_106997911 | 3300006893 | Iron-Sulfur Acid Spring | MGYQALLFCPDEKTARTVTQVLSELDFAVTPCTEPFA |
| Ga0075426_105746112 | 3300006903 | Populus Rhizosphere | MSYQALLFCPDEKTARVVSQVLSELEFAVEPCHEPFSAVKKLMVQ |
| Ga0075435_1006213002 | 3300007076 | Populus Rhizosphere | MGYSALLFCPDEKTARVLSRILAELEFSVDASPEPFAAV |
| Ga0066710_1013707963 | 3300009012 | Grasslands Soil | MRYQALLFCPDEKIARVVTQVLNELDFSVEPASEPFAAV |
| Ga0099830_106414481 | 3300009088 | Vadose Zone Soil | MSYKSLLFCPDEKTARLVTQVLTELEFTVELSNEPFAAVKKLTDEHF |
| Ga0105240_112658531 | 3300009093 | Corn Rhizosphere | MGYQALLFCPDDKLARVVTQVLSDLDFSVETATEPFAAVKKLMAQHFDA |
| Ga0075423_113534702 | 3300009162 | Populus Rhizosphere | MGYSALLFCPDEKTARVLSRILAELEFSVDASPEPFAAVK |
| Ga0116214_13152761 | 3300009520 | Peatlands Soil | MSYKALLFCPDDKTARVVTQVLSELEFQVERCNEPFASVKKLMAEHFDAIVVDC |
| Ga0116222_10165141 | 3300009521 | Peatlands Soil | MAYQALLFCPDEKTARTVTQVLSELDFAVVPCTEPFAAVKRL |
| Ga0116218_13741102 | 3300009522 | Peatlands Soil | MGYQALLFCPDEKTARTVTQVLSELDFAVIPCTEPFAAVKKL |
| Ga0116218_14477541 | 3300009522 | Peatlands Soil | MAYQALLFCPDEKTARTVTQVLSELDFAVVPCTEPFAAVKRLMAEHFDAVV |
| Ga0116221_15439521 | 3300009523 | Peatlands Soil | MKYNALLFCPDDKTARVVTQVLSDLEFRVEPCNEPFAAVKRLMAEHFDAIVVD |
| Ga0105237_119330311 | 3300009545 | Corn Rhizosphere | MSYQALLFCPDEKTARVVTQVLTELDFTVEPCNEPFAAVKRLMAQHFDAVVV |
| Ga0116111_11241481 | 3300009616 | Peatland | MGYQALLFCSDEKLARVVSQVFSELDFSVEAVNEPF |
| Ga0116133_11208062 | 3300009623 | Peatland | MGYQALLFCPDEKTARTVTQVLSELDFAVVSCTEP |
| Ga0116105_12009091 | 3300009624 | Peatland | MGYQALLFCPDEKTARTVTQVLSELDFAVVSCTEPFAAVKKLMGEHF |
| Ga0116106_13067701 | 3300009645 | Peatland | MGYQALLFCPDEKTARTVTQVLSELDFAVVSCTEPFA |
| Ga0116217_105001752 | 3300009700 | Peatlands Soil | MGYQALLFCPDEKTARAVTQVLSELEFSVEPCGETFAAVKKLMGGHFD |
| Ga0116217_108740212 | 3300009700 | Peatlands Soil | MGYQALLFCPDEKTARTVTQVLNELEFNVESCLEPFAAVKKLMGQ |
| Ga0116130_10061315 | 3300009762 | Peatland | MGYQALLFCPDEKTARTVTQVLSELDFAVVSCTEPFAAVKKLMGEHFDA |
| Ga0126374_101264731 | 3300009792 | Tropical Forest Soil | MGYLALLFCPDEKTARTVTNVLNDLEFSVEPCTEPFAAVKKLMAQHFDA |
| Ga0116219_105811382 | 3300009824 | Peatlands Soil | MGYQALLFCPDEKTARTVTQVLSELDFTVVPCTEPFAAVKKLMG |
| Ga0126373_100864373 | 3300010048 | Tropical Forest Soil | LLLLIGVPTMAHMHYQALLFCPDDKTARIVTQVLSELEFQVECSNEPFAAVKKLMAQHF |
| Ga0126373_105870083 | 3300010048 | Tropical Forest Soil | MGYKSLLFCPDERTARVVTQVLNGLEFSVEPANEPYAAVKKLNDEHFDA |
| Ga0074044_103858362 | 3300010343 | Bog Forest Soil | MGYQALLFCPDEKTARTVTQVLSELDFSVIPCTEPFAAV |
| Ga0074044_110083742 | 3300010343 | Bog Forest Soil | MAYQALLFCPDEKTARAVTQVLSELDFAVIPCTEPFGAVKKLMAEHF |
| Ga0126372_103570922 | 3300010360 | Tropical Forest Soil | MGYTALLFCPDEKTARTVTQVLSELEFNVEACTEPFAAVKKLMAQ |
| Ga0126372_126785862 | 3300010360 | Tropical Forest Soil | MGYQALLFCPDEKTARTVTQVLSDLDFTVEPCSEPFAAVKKLMA |
| Ga0126372_132114841 | 3300010360 | Tropical Forest Soil | MGYLALLFCPDEKTARTVTHVLNDLEFTVEPCTEPFAAV |
| Ga0126378_128792381 | 3300010361 | Tropical Forest Soil | MGYKSLLFCPDERTARVVTQVLNGLEFSVEPANEPYAAVKRLNDEHFDAL |
| Ga0126379_100530191 | 3300010366 | Tropical Forest Soil | MGYLALLFCPDDKTARTVTQVLSELEFNVEACIEPFAAVKKLMGQHF |
| Ga0126381_1028176891 | 3300010376 | Tropical Forest Soil | MSYQALLFCPDEKTARTVTQVLTELDFSVEAVAEPFAVVKKL |
| Ga0126381_1036280421 | 3300010376 | Tropical Forest Soil | MSYKALLFCPDEKTARVVTQVLSELEFVVEPCNEPFAAVKRLMAEHFDA |
| Ga0134126_100375797 | 3300010396 | Terrestrial Soil | MSYQALLFCPDEKTARLVTQVLSELDFSVEASNEPFTAVKR |
| Ga0126383_130530592 | 3300010398 | Tropical Forest Soil | MGYQALLFCPDEKTARTVTQVLSELEFSVEACIEPFAAVKK |
| Ga0134127_105708761 | 3300010399 | Terrestrial Soil | MSFRSLLFCPDENTARLVTQVLSELDFTVETEQESFPAVQRLTREHFHALVV |
| Ga0137392_104441191 | 3300011269 | Vadose Zone Soil | MRYQALLFCPDEKIARLVTQVLSELDFSVEPASEPFAAV |
| Ga0120139_10689322 | 3300012019 | Permafrost | MSYKSLLFCPDEKSARLVTQVLSELEFTVELSNEPFASVKKLTDEHF |
| Ga0137389_115582881 | 3300012096 | Vadose Zone Soil | MSYQALLFCPDEKTARVVSQVLSELEFAVEPCHEPFSAVKKLMV |
| Ga0137388_104089173 | 3300012189 | Vadose Zone Soil | MSYKSLLFCPNEKTARVVTQVLSELEFTVELSSEPF |
| Ga0137388_104546733 | 3300012189 | Vadose Zone Soil | MSYKSLLFCPDEKAARVVTQVLSELEFTVELSNEPFATVKKLT |
| Ga0137363_107876823 | 3300012202 | Vadose Zone Soil | MGYQALLFCPDEKTAHTVTRVLNDLDFSVEPCTEPFAAVKKLMA |
| Ga0137399_103421301 | 3300012203 | Vadose Zone Soil | MGYQALLFCPDEKTARTVTHVLRDLDFTVEPCSEPFAAVKKLMAQHFDAV |
| Ga0137376_107677502 | 3300012208 | Vadose Zone Soil | MGYQALLFCPDEKLARVVTQVFSELDFKVEPVNEPFA |
| Ga0137379_100126071 | 3300012209 | Vadose Zone Soil | MSYKALLFCPDGKTARVVTQVLGELEFTVESAGEPFATVKKLTDE |
| Ga0137379_113069002 | 3300012209 | Vadose Zone Soil | MSYKALLFCPDGKTARVVTQVLGELEFTVESAGEPFATVKKLTDEHFDALVVDCEN |
| Ga0150985_1210004591 | 3300012212 | Avena Fatua Rhizosphere | MGYQALLFCPDDKTARTVTQVLSELEFAVEACIEPFA |
| Ga0137387_112824612 | 3300012349 | Vadose Zone Soil | MSYQALLFCPDEKTARVVTQVLSELEFSVEPCNEPFAAVKKLMVQHFD |
| Ga0137386_110105812 | 3300012351 | Vadose Zone Soil | MSYKSLLFCPDEKTARVVTQVLSELEFTVELSSEPFATVKRLTDEHFDALVVDCQN |
| Ga0137390_115562891 | 3300012363 | Vadose Zone Soil | MGYQALLFCPDEKLARVVSQVFSELDFTVEPVHEPFAAVKKLMS |
| Ga0137395_102049801 | 3300012917 | Vadose Zone Soil | MSYKSLLFCPDEKTARTVTQVLTELEFAVERCGEPFAAVKKLM |
| Ga0137396_107096842 | 3300012918 | Vadose Zone Soil | MGYQALLFCPDEKTARTVTQVLSELDFAVEPCTEAFAAV |
| Ga0137419_114142142 | 3300012925 | Vadose Zone Soil | MGYQALLFCPDEKLARVVTQVFSELDFKVEPVNEPFAAV |
| Ga0137416_100496773 | 3300012927 | Vadose Zone Soil | MSYQALLFCPDEKTARVVSQVLSELEFSVEPCHEPFS |
| Ga0137416_106753081 | 3300012927 | Vadose Zone Soil | MSYLALLFCQDEKTARTITQVLNELEFQVEPSSEAFAAVKKLTTQAFDAVV |
| Ga0137407_100653441 | 3300012930 | Vadose Zone Soil | MGYQALLFCLDEKLARVVTQVFSELDFKVEPVNEPFAAVKKLMAQR |
| Ga0126375_104452991 | 3300012948 | Tropical Forest Soil | MGYQALLFCPDEKTARTVTQVLTELEFRVEASSEPFAAVKKLMGEHFDAV |
| Ga0164300_111329141 | 3300012951 | Soil | MSFKSLLFCPDEKTARVVKQVLSLLDFTVESEGQSFAAFDGLTEEQFEALVVG |
| Ga0164299_114179402 | 3300012958 | Soil | MGYQALLFCPDEKTARTVTQVLSELEFSVEACTEPF |
| Ga0126369_117908812 | 3300012971 | Tropical Forest Soil | MGYQALLFCPDEKTARTVTQVLAELDFTIETCSEPFAAVKKLTTQHFDA |
| Ga0164304_108543571 | 3300012986 | Soil | MSYQALLFCPDEKTARVVSQVLSELEFAVEPRHEPFAAVKKLM |
| Ga0164305_118173611 | 3300012989 | Soil | MSYKSLLFCPDERTARLVAQVLKELEFAVESANEPFA |
| Ga0157378_115654882 | 3300013297 | Miscanthus Rhizosphere | MSYQALLFCPDERTAQVVTQVLSEVEFSVETCSEPFAAVKRL |
| Ga0163162_106686571 | 3300013306 | Switchgrass Rhizosphere | MSYQALLFCPDEKTARVVSQVLSELEFTVEPCHEPFSAVKKLMVQHFDALV |
| Ga0181533_13373341 | 3300014152 | Bog | MGYQALLFCPDEKLARVAGQVFSELDFTVEPVHEPF |
| Ga0181524_104071011 | 3300014155 | Bog | MSYRALLFCPDEKTARVVTQVLSELEFRVEPCNEPFAAVKKLMAEHFD |
| Ga0181529_106122742 | 3300014161 | Bog | MGYQALLFCPDEKTARTVTQVLSELDFSVVPCTEPFA |
| Ga0181534_101902882 | 3300014168 | Bog | MGYEALLFCPDEKTARTVTQVLNELEFNVESCLEPFAAV |
| Ga0181531_105042111 | 3300014169 | Bog | MKYNALLFCPDEKTARVVTQVLNDLEFRVEPCNEPFAA |
| Ga0182015_109258342 | 3300014495 | Palsa | MSYQALLFCPDEKTARVVTQVLSDLEFNVEPCTEPFSAVKKLMAQHY |
| Ga0181525_101112841 | 3300014654 | Bog | MGYQALLFCPDEKTARAVTQVLSELDFTVIPCTEPFGAVKK |
| Ga0157379_112683791 | 3300014968 | Switchgrass Rhizosphere | MSYQALLFCPDEKTARVVNQVLSELEFAVEPCHEPFAAVKKLMVQHFD |
| Ga0167660_10188032 | 3300015078 | Glacier Forefield Soil | MSYQALLFCPDEKLARVVTQVFSDLEFTVELVNEPFAAVKKLMAQRYDALVV |
| Ga0137403_103020352 | 3300015264 | Vadose Zone Soil | MSYQALLFCQDEKTARTVTQVLNELEFQVDPCVETFAAVKK |
| Ga0134072_103585431 | 3300015357 | Grasslands Soil | MSYRALLFCPDEAAARLVTQVLSELEFTVELSLEPFVTVQKLSA |
| Ga0132256_1003521524 | 3300015372 | Arabidopsis Rhizosphere | MGYQALLFCPDDKTARTVTQVLSELDFTVEACIEP |
| Ga0182035_101810922 | 3300016341 | Soil | MGYQALLFCPDEKAARGVTQVLSELDFTVEPCTEPFAAVKKLMAQHFDAIV |
| Ga0182032_102906681 | 3300016357 | Soil | MGYQALLFCPDEKTARTVTQVLSDLDFTVEPCTEPFAAVKKLMAQHFD |
| Ga0182037_103279102 | 3300016404 | Soil | MGYQALLFCPDDKTARTVTQVLSELEFTVEACIEPFAAVKK |
| Ga0182039_105959601 | 3300016422 | Soil | MGYQALLFCPDEKTARTVTQVLGDLDFSVERSSEPFAAV |
| Ga0134069_10831503 | 3300017654 | Grasslands Soil | MRYQALLFCPDDKTARVVTQVLSELEFQVECCNEPF |
| Ga0187824_102740182 | 3300017927 | Freshwater Sediment | MGYQALLFCPDEKTARTVTQVLNDLDFTVERCNEPFAAVKKLMAQ |
| Ga0187825_103147612 | 3300017930 | Freshwater Sediment | MSYRALLFCPDEKTARTVTQVLAELDFSVETSNEPF |
| Ga0187801_103530672 | 3300017933 | Freshwater Sediment | MGYTALLFCPDEKTARTVTQVLSELEFAVEACIEPFAAV |
| Ga0187803_102721171 | 3300017934 | Freshwater Sediment | MGYQALLFCPDEKTARPVTQVLSELEFAVEPCIEPFAAVKKLMGTHFDALVVD |
| Ga0187848_100685563 | 3300017935 | Peatland | MGYQALLFCPDEKTARTVTQVLGELDFTVIPCTEPFAAVQ |
| Ga0187821_101504092 | 3300017936 | Freshwater Sediment | MGYQALLFCPDEKTARTVTQVLNDLDFTVERCNEPFAAV |
| Ga0187819_102947271 | 3300017943 | Freshwater Sediment | MGYQALLFCSDEKLARVVSQVFSELDFSVEPVNEPFAAVKKLM |
| Ga0187819_104988841 | 3300017943 | Freshwater Sediment | MSYKALLFCPDDKTARVVTQVLSELEFQVERCNEPFASVKKLMAEHFDAIVVD |
| Ga0187819_107935052 | 3300017943 | Freshwater Sediment | MSYKALLFCPDDKTARVVTQVLSELEFRVEPCNEPFAAVKKLMAEHFDAIVVD |
| Ga0187879_103542691 | 3300017946 | Peatland | MGYQALLFCPDEKTARSVTQVLSELDFTVVPCTEPFGAVKKLMAEHFDAV |
| Ga0187817_109318242 | 3300017955 | Freshwater Sediment | MGYQALLFCPDEKTARTVTQVLSELEFNVESCTEPFAAVKKLM |
| Ga0187781_101394563 | 3300017972 | Tropical Peatland | MGYTALLFCPDEKTERTLTQVLSELEFKVEACTEPFAAVK |
| Ga0187782_100578391 | 3300017975 | Tropical Peatland | MGFQALLFCPDEKTARAVTQVLSELEFNVESCNEPFAAVKKLMGAHFDAI |
| Ga0187782_102592362 | 3300017975 | Tropical Peatland | MGYTALLFCPDEKTARTLTQVLSELEFNVEACTEPFAAVKKLMGQHFEAVVV |
| Ga0187782_103084782 | 3300017975 | Tropical Peatland | MGYQALLFCSDERLARVVSQVFSELDFSVEPVNEPFAAVKKL |
| Ga0187816_100176421 | 3300017995 | Freshwater Sediment | MGYQALLFCSDEKLARVVSQVFSELDFAVEPVNEPFAAVKK |
| Ga0187816_101792541 | 3300017995 | Freshwater Sediment | MGYTALLFCPDEKTARTVTQVLSELEFAVEACIEPFAAVKK |
| Ga0187816_101886922 | 3300017995 | Freshwater Sediment | MKYTALLFCPDEKTARVVTQILTELEFHVEPCNEPFAAVKKLMAEHFDAIVV |
| Ga0187767_102701402 | 3300017999 | Tropical Peatland | MGYQAILFCPDEKLARVVSQVLTEVGFAVEVVAEPFSA |
| Ga0187804_102255781 | 3300018006 | Freshwater Sediment | MGYQALLFCPDEKLARVVSQVFGELEFAVEPVSEPFVVVKKMMAQHYDAI |
| Ga0187805_103480782 | 3300018007 | Freshwater Sediment | MGYQALLFCPDEKTARTVTQVLSELDFTVIPCTEPFSAVKKLM |
| Ga0187884_102850202 | 3300018009 | Peatland | MKYNALLFCPDEKTARVVTQVLNDLEFRVEPCNEPFAAVKRLM |
| Ga0187886_11341961 | 3300018018 | Peatland | MGYQALLFCPDEKTARTVTQVLSELDFSVVPCTEPFAAVKK |
| Ga0187851_103216732 | 3300018046 | Peatland | MGYQALLFCPDEKTARTVTQVLSELEFNVEACIEPFAAVKKLMGQHFDAV |
| Ga0187784_115786321 | 3300018062 | Tropical Peatland | MGYQALLFCSDERLARVVSQVFSELDFSVEPVNEPFAAVKKLM |
| Ga0187772_105556572 | 3300018085 | Tropical Peatland | MAYEALLFCPEEKTARTVTQVLAELEFSVEPCTEPFAAVKKLMSQ |
| Ga0187772_106108361 | 3300018085 | Tropical Peatland | MGYQALLFCPDEKTARSVTQVLGELEFNVEPCSET |
| Ga0187772_106380521 | 3300018085 | Tropical Peatland | MGYQALLFCSDERLARVVSQVFSELDFSVEPVNEPFAA |
| Ga0187771_109970431 | 3300018088 | Tropical Peatland | MGYQALLFCPDEKLARVVSQVFGEVEFTVDPVSEPFVAVKKMMAQ |
| Ga0066655_104196561 | 3300018431 | Grasslands Soil | MGYQALLFCPEEKTARTVTQVLSELEFSVDSCNEPFAAVKKLMAQH |
| Ga0182022_13070034 | 3300019785 | Fen | MGYQALLFCPDEKLARVVSQVFSELDFTVEPVHERSLRSRS |
| Ga0182025_10996673 | 3300019786 | Permafrost | MGYQALLFCPDEKTARTVTQVLSELDFEVVSCPEPFGAVKKLMGEHFDAVVVD |
| Ga0182025_13437211 | 3300019786 | Permafrost | MGFGMGYQALLFCPDEKTARTVTQVLSELEFNVEACAEPFAAVKKL |
| Ga0182031_11640022 | 3300019787 | Bog | MGYQALLFCSDEKLLKVVGQVFGDLDFTVEPVHEPFAAVKKLMA |
| Ga0137408_14646416 | 3300019789 | Vadose Zone Soil | MSYQALLFCPDEKTARVVSQVLTELEFTVEPATSLLPR |
| Ga0193723_11046601 | 3300019879 | Soil | MSYQALLFCPDERTAHVVTQVLSEVEFSVESCSEPFAAVKRLMAKHFD |
| Ga0193729_12553351 | 3300019887 | Soil | MSYQALLFCPDEKTARVVSQVLSELEFSVEPCNEPFAAVKKLMAQHFDAIVV |
| Ga0210399_100510811 | 3300020581 | Soil | MGYQALLFCPDDKTARTVTQVLSELEFTVEACIEPF |
| Ga0215015_105405552 | 3300021046 | Soil | MSYQSLLFCPDEKTARTVTQVLTELEFAVEPCSEPFAAVK |
| Ga0210404_103772441 | 3300021088 | Soil | MGYQALLFCPDEKTARTVTHVLNDLDFTVEPCSEPFAAVKKLMARHFDAV |
| Ga0210406_103439853 | 3300021168 | Soil | MGYLALLFCPDEKTARTVTHVLNDLAFQVEPCTEPFAAVKKLMA |
| Ga0210406_106142881 | 3300021168 | Soil | MAYQALLFCPDEKTARTVTQVLSELDFEVCPCTEPF |
| Ga0210396_102018043 | 3300021180 | Soil | MGYQALLFCPDDKTARTVTQVLSELEFTVEACIEPFAAVKKLM |
| Ga0210396_115170582 | 3300021180 | Soil | MGYQALLFCPDEKTARTVTQVLSELDFSVIPCTEPFAAVKKLMGEHFDA |
| Ga0210388_105076602 | 3300021181 | Soil | MKYSALLFCPDEKTARVVTQVLNDLEFRVEPCNEPFAAVKRLMAEHFD |
| Ga0213875_104925281 | 3300021388 | Plant Roots | MRNMSYKSLLFCPDEKTARTVTQVLSELEFSVETASDPNAAVNKLSDQHYDAL |
| Ga0210393_101314891 | 3300021401 | Soil | MGYRALLFCPDEKIARTVTQVLSELEFAVEACVEPFAAVKKLMAEHFDAVVV |
| Ga0210393_109891482 | 3300021401 | Soil | MSYKALLFCPDERTAKTVTQVLSELEFQVEACNEPF |
| Ga0210393_113328972 | 3300021401 | Soil | MGYQALLFCPDEKTARTVTQVLSELDFSVIPCTEPFAAVKKLMAEHFDALV |
| Ga0210385_111802501 | 3300021402 | Soil | MGYLALLFCPDEKTARTVTQVLGELEFNVESCTEPF |
| Ga0210397_108939562 | 3300021403 | Soil | MRRMSYQALLFCPDDKTARVVTQVLSELEFTVEPCSEPFAAVK |
| Ga0210389_100638371 | 3300021404 | Soil | MKYNALLFCPDEKTARVVTQVLTDLEFRVEPCNEPFAAVKKLMAEH |
| Ga0210387_105504081 | 3300021405 | Soil | MNLIMGYQALLFCPDEKLARVVSQVFTELDFSIETVREPFAAVKKL |
| Ga0210383_106913141 | 3300021407 | Soil | MSYKALLFCPDERTAKVVTQVLSELEFQVEACNEPFAAVKKLMAGHFDAVVV |
| Ga0210383_114131412 | 3300021407 | Soil | MGYQALLFCPDEKTARAVTQVLSELDFNVIPCTEPFG |
| Ga0210394_102496711 | 3300021420 | Soil | MGYQALLFCPDEKTARAVTQVLSELDFTVVPCTEPFG |
| Ga0210384_104688603 | 3300021432 | Soil | MGYQALLFCPDEKTARTVTQVLSELDFAVVPCTEP |
| Ga0210391_102289173 | 3300021433 | Soil | MGYRALLFCPDEKIARTVTQVLSELEFAVEACVEPFAAVKKLMAEHFDAV |
| Ga0210391_104391032 | 3300021433 | Soil | MKYNALLFCPDEKTARVVTQVLNDLEFRVEPCNEPFAAVKRLMAEHFDAIVVDC |
| Ga0210392_113356641 | 3300021475 | Soil | MSYKALLFCPDEKTARVVTQVLSDLEFRVEPCNEPFAAVKRL |
| Ga0210402_115961351 | 3300021478 | Soil | MGYQALLFCPDEKTARTVTQVLSELEFNVESCMEPF |
| Ga0210410_101593533 | 3300021479 | Soil | MSYQALLFCPDEKTARVVSQVLSELEFSVEPCHEPFAAVKKLMVQHFD |
| Ga0210409_100859163 | 3300021559 | Soil | MSYKALLFCPDEKTARVVTQVLSELEFRVEPCNEPFAAVKKLMADHFDAIVVD |
| Ga0126371_114641402 | 3300021560 | Tropical Forest Soil | MGYQALLFCPDEKTARTVTQVLNELEFSVEACIEPFAAVKKLMG |
| Ga0228597_1087551 | 3300023012 | Plant Litter | MGYQALLFCPDEKTARTVTQVLGELEFTVIPCTEPFAAVKKLMGEHFDAV |
| Ga0224560_1140191 | 3300023019 | Soil | MGYQALLFCPDEKTARTVTLVLSELDFEVVPCTEPFAAVKKLM |
| Ga0224551_10476831 | 3300023259 | Soil | MGYQALLFCPDEKTARSVTKVLSELDFEVVSCNEPFDAVKRMMAAPFDAIVVD |
| Ga0247794_101259632 | 3300024055 | Soil | MGYQALLFCPDDKLARVVTQVLSDLDFSVETATEPFAAV |
| Ga0224556_11334812 | 3300024295 | Soil | MGYRALLFCPDEKIARTVTQVLSELEFAVEACVEPFAAVKKL |
| Ga0208935_10078681 | 3300025414 | Peatland | MGYQALLFCPDEKTARTVTQVLGELDFTVIPCTEPFAAVKKLMGEHFDAVVV |
| Ga0208691_11540592 | 3300025612 | Peatland | MNYAALLFCPDEKISRVLSQVLTDLEFSVELSTEPFAAVKRLM |
| Ga0207692_106992282 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYQALLFCPDEKTARTVTQVLSELEFSVEPCTEPFAAVKKLMGQHFDAII |
| Ga0207692_110086371 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYRALLFCPDEAAARLVTQVLSELEFTVELSFEPFVTVQ |
| Ga0207671_102735301 | 3300025914 | Corn Rhizosphere | MGYSALLFCPEEKTARTVTQVLSELEFTVEACSEPF |
| Ga0207671_105124581 | 3300025914 | Corn Rhizosphere | MSYRALLFCPDEAAARLVTQVLSELEFTVELSFEPFVTVQKLTAEPFDAVVVDCA |
| Ga0207700_113315902 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYQALLFCPDDRTARTVTQVLSELEFTVEACIEPFAAV |
| Ga0207706_114522591 | 3300025933 | Corn Rhizosphere | MGYQALLFCGDERTAQLVTQVLTELEFSVEPANEPFAAVKRLTTQHFDA |
| Ga0207665_110058921 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYQALLFCPDEKTARNVTQVLNDLDFTVEPCSEPFAAVKKLMAQHFDAVVV |
| Ga0207711_111319432 | 3300025941 | Switchgrass Rhizosphere | MSYQALLFCPDEKTARVVTQVLTELEFSVEPCNEPFAAV |
| Ga0207689_1000043027 | 3300025942 | Miscanthus Rhizosphere | MGYQALLFCGDERTAQLVTQVLTELEFSVEPANEPFAAVKRLTTQHFDAVVVD |
| Ga0207689_103681861 | 3300025942 | Miscanthus Rhizosphere | MSFRSLLFCPDETTARLVTQVLSELDFTVEVARESWTPVGRLDRHHLASEYL |
| Ga0207679_120291392 | 3300025945 | Corn Rhizosphere | MGYSALLFCPEEKTARTVTQVLSELEFTVEACTEPFAAVKKLMGQHFDAV |
| Ga0207708_102856041 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYQALLFCPDEKTARVVNQVLSELEFAVEPCHEPFAAVK |
| Ga0209849_10095565 | 3300026215 | Soil | MSYKSLLFCPDEKTARVVTQVLSELEFTVELSGEPFATVKKLTDEHFDALVV |
| Ga0209863_100839972 | 3300026281 | Prmafrost Soil | MSYQALLFCPDEKTARVVSQVLTELEFSVEPCHEPFAAVKKLMVQHFDAIVV |
| Ga0209236_10715061 | 3300026298 | Grasslands Soil | MRYQALLFCPDEKIARVVTQVLSELDFSVEPASEPFAAVKKLMA |
| Ga0209152_100301062 | 3300026325 | Soil | MGYQALLFCPDEKTARIVTQVLNDLDFTVEPCTEPFAAVKK |
| Ga0209804_10407102 | 3300026335 | Soil | MGYQALLFCPDEKTARIVTQVLNDLDFTVESCTEPFAAVKK |
| Ga0209804_13060202 | 3300026335 | Soil | MGYQALLFCPDDKTARTVTQVLSELEFTVEACIEP |
| Ga0179587_103937912 | 3300026557 | Vadose Zone Soil | MSYLALLFCQDEKTARTITQVLNELEFQVEPSSEAFAA |
| Ga0179587_111772281 | 3300026557 | Vadose Zone Soil | MSYLALLFCQDEKTARTITQVLNELEFQVERSSEAFAAVKKLTTQ |
| Ga0208099_10666812 | 3300027096 | Forest Soil | MGYQALLFCPDEKTARAVTQVLGELDFTVIPCTEPFGAVKKLMGEHFDAVV |
| Ga0207777_10987061 | 3300027330 | Tropical Forest Soil | MGYQALLFCPDEKLARVVTQVFTELDFSVEPVNEPFGAVKKLMA |
| Ga0209010_10634651 | 3300027370 | Forest Soil | MKYSALLFCPDEKTARVVTQVLNDLEFRVEPCNEPFAAVKRLMAEH |
| Ga0207505_1127191 | 3300027459 | Soil | MSYQALLFCPDEKTARVVSQVLSELEFTVEPCHEPFSAVKKLMVQHFD |
| Ga0209528_11482991 | 3300027610 | Forest Soil | MGYQALLFCPDEKTARTVTQVLSELDFEVVSCSEPFAAVKKLMGEHFDAV |
| Ga0208827_10270683 | 3300027641 | Peatlands Soil | MGYQALLFCPDEKTARTVTQVLSELDFSVIPCTEPFAAVKKLM |
| Ga0209736_10050764 | 3300027660 | Forest Soil | MGYQALLFCPDEKLARVVSQVFSELDFTVEPVHEPFAAVKKLMSQ |
| Ga0209118_10167693 | 3300027674 | Forest Soil | MGYQALLFCPDEKLARVVSQVFSELDFTVVPVHEPFAAVKKL |
| Ga0209626_11198962 | 3300027684 | Forest Soil | MGYQALLFCPDEKTARTVTQVLSELEFNVESCTEPFAAVKKLMGQHFDAV |
| Ga0209038_101734782 | 3300027737 | Bog Forest Soil | MGYQALLFCPDEKTARAVTQVLSELDFAVIPCTEPFAAVKKLMGE |
| Ga0209772_102500631 | 3300027768 | Bog Forest Soil | MGYQALLFCPDEKLARVVSQVFTELDFTIEPVHEPFAAVKKLM |
| Ga0209656_101197731 | 3300027812 | Bog Forest Soil | MGYQALLFCPDEKTARTVTQVLSELDFAVTACTEPFAAVKKLMGEPYD |
| Ga0209693_100661171 | 3300027855 | Soil | MKYSALLFCPDEKTARVVTQVLNDLEFRVEPCNEPFAAVKRLMAEHFDAI |
| Ga0209693_103445651 | 3300027855 | Soil | MGYQALLFCPDERTARTVTQVLRELDFSVITCTEPFDAVKKL |
| Ga0209701_101664881 | 3300027862 | Vadose Zone Soil | MSYQALLFCPEEKIARVVTQVLSELEFSIETATEP |
| Ga0209167_104014282 | 3300027867 | Surface Soil | MSYKSLLFCPDEKTARVVTQVLSELEFTIELSNEPFATVKKLTDEHFD |
| Ga0209167_104786091 | 3300027867 | Surface Soil | MSYKALLFCPDDKTARVVTQVLSELEFRVEPCNEPFAAVKKLMAEHFDAIV |
| Ga0209380_105434892 | 3300027889 | Soil | MGYQALLFCPDEKTARAVTQVLSELDFTVVPCTEPFGAVK |
| Ga0209380_105584852 | 3300027889 | Soil | MGYQALLFCPDEKTARTVTQVLSELDFTVAPCTEPFA |
| Ga0209068_107312722 | 3300027894 | Watersheds | MNYKALLFCPDEKTARVVTQVLSDLEFRVEPCNEPFAAVKKLM |
| Ga0209624_108515791 | 3300027895 | Forest Soil | MGYRALLFCPDEKTAQTVTLILNDLEFSVEACVEPFAAVKKLVGEHFDGVV |
| Ga0209067_109141982 | 3300027898 | Watersheds | MGYQALLFCPDEKTARTVTHVLNDLDFAVEPCKEPFAAVKRLMAQHF |
| Ga0209006_104159451 | 3300027908 | Forest Soil | MGYQALLFCPDEKTAHTVTQVLSELDFAVTPCTEPFAAVKKLMG |
| Ga0209583_107701261 | 3300027910 | Watersheds | MSFQALLFCQDEKTARTVTQVLTELDFLVDACSETFAAVKKLTS |
| Ga0209698_107584992 | 3300027911 | Watersheds | MGYQALLFCPDDKTARTVTQVLSELEFSVEACIEPFAAVKK |
| Ga0265353_10362631 | 3300028015 | Soil | MGYQALLFCPDEKTARTVTQVLSELEFNVENCTEPFAAVKK |
| Ga0137415_103456131 | 3300028536 | Vadose Zone Soil | MSYLALLFCQDEKTARTITQVLNELEFQVEPSSEAFAAVKKLTTQAFDAVVVD |
| Ga0302233_102587602 | 3300028746 | Palsa | MGYQALLFCPDEKTARTVTQVLSELDFSVIPCTEPFAAVKKLMGEH |
| Ga0302269_11062261 | 3300028766 | Bog | MGYQALLFCPDEKLARVVTQVFGDLEFVVDPVHEP |
| Ga0302266_100403541 | 3300028779 | Bog | MGYQALLFCPDEKLARVVTQVFGDLEFVVDPVHEPFAAV |
| Ga0302201_102916371 | 3300028785 | Bog | MGYQALLFCPDEKTARTVTQVLSELDFTVIPCTEPFGAVKKLMAER |
| Ga0307284_103339331 | 3300028799 | Soil | MSYQALLFCPDEKTARTVTQVLSDLEFSVEPCSEPFAAV |
| Ga0307312_107182431 | 3300028828 | Soil | MSYQALLFCPDEKTARVVTQVLSELEFAVEPCNEP |
| Ga0302218_102504311 | 3300028863 | Palsa | MGYQALLFCPDEKTARTVTQVLSELDFAVIACTEPFA |
| Ga0308309_102906663 | 3300028906 | Soil | MKYNALLFCPDDKTARVVTQVLSDLEFRVEPCNEPFAAVKRLMAEHFDAIVVDC |
| Ga0308309_109587892 | 3300028906 | Soil | MGYQALLFCPDEKTARTVTQVLNELEFSVQACTEPFAAVKKLMAE |
| Ga0308309_116280431 | 3300028906 | Soil | MPPMSYQALLFCPDDKTARVVTQVLSELEFTVERCSEPFAAVKK |
| Ga0311327_107075951 | 3300029883 | Bog | MGYQALLFCPDEKTARTVTQVLGELDFTVVPCTEPFAAVKKLMGE |
| Ga0311361_103349273 | 3300029911 | Bog | MGYQALLFCPDEKTARTVTQVLSELDFAVTPCTEPFATVKKM |
| Ga0311328_108328951 | 3300029939 | Bog | MGYQALLFCPDEKTARTVTQVLSELDFSVIPCTEPFGAV |
| Ga0311340_105702443 | 3300029943 | Palsa | MGYQALLFCPDEKTARTVTQVLSELDFTVVPCSEPFAAVKKLV |
| Ga0311336_113402892 | 3300029990 | Fen | MGYQALLFCPDEKLARVVSQVFSELDFTVEPVHEPFAA |
| Ga0311338_106953951 | 3300030007 | Palsa | MGYQALLFCPDERTARTVTQVLRELDFSVITCTEPFDAVKK |
| Ga0302181_103065042 | 3300030056 | Palsa | MGYQALLFCSDEKLAAIVTQTFSELEFAVEAVHEPFAA |
| Ga0302194_100498451 | 3300030506 | Bog | MGYQALLFCPDEKTARTVTQVLSELDFTVIPCTEPFGAVKKLMAERFDAV |
| Ga0302183_103192091 | 3300030509 | Palsa | MGYRALLFCPDEKIARTVTQVLSELEFAVEACVEPFAAVKKLMAEHFDA |
| Ga0311355_100149851 | 3300030580 | Palsa | MGYQSLLFCPDEKTARTVTQVLSELDFTVVPCTEP |
| Ga0265750_10890031 | 3300030813 | Soil | MGYQALLFCPDEKTARAVTQVLSELDFTVVPCTEPFGAVKKLMGEHFDAVV |
| Ga0265746_10085203 | 3300030815 | Soil | MGYRALLFCPDEKTAQTVTLILNDLEFSVEACVEPFAAVKKLVGEHF |
| Ga0265773_10411471 | 3300031018 | Soil | MGYQALLFCPDEKTARTVTQVLSELDFVVTPCTEP |
| Ga0170834_1095328981 | 3300031057 | Forest Soil | MGYQALLFCPDEKTARTVTQVLSELDFEVTACTEPFAAVKKLIAEHFDAV |
| Ga0265760_100037481 | 3300031090 | Soil | MKYNALLFCPDEKTARVVTQVLSDLEFRVEPCNEPFAAVKRLMAEH |
| Ga0170823_119826661 | 3300031128 | Forest Soil | MGYQALLFCPDEKLTRVVNQVFSELDFMVELVHEPFAA |
| Ga0311364_116940781 | 3300031521 | Fen | MSYQALLFCLDEKLARVVTQVFSDLDFTVEAVNEPFAAVKK |
| Ga0310686_1049416991 | 3300031708 | Soil | MGYQALLFCPDDKTARTVTQVLSELEFNVEACIEPFAAVKKLMGQHFD |
| Ga0307476_104631893 | 3300031715 | Hardwood Forest Soil | MGYQALLFCPDEKTARTVTQVLSELDFEVVPCTEP |
| Ga0310813_118452011 | 3300031716 | Soil | MSFRSLLFCPDETAARLVTQVLTELDFTVETAQQSFAAVQRLTEEHFHA |
| Ga0307469_107436471 | 3300031720 | Hardwood Forest Soil | MGYQALLFCPDEKLARVVSQVFSELDFTVEPVHEP |
| Ga0307468_1001878282 | 3300031740 | Hardwood Forest Soil | MSYQALLFCPDEKTARVVSLVLSELEFTVEPCHEPFAAVK |
| Ga0307477_100185711 | 3300031753 | Hardwood Forest Soil | MGYQALLFCPDDKTARTVTQVLSELEFNVEACIEPFAAVKKL |
| Ga0318554_101136661 | 3300031765 | Soil | MGYQALLFCPDEKTARTVTQVLSDLDFTVEPCTEPFAA |
| Ga0318508_11666951 | 3300031780 | Soil | MGYQALLFCPDEKTARTVTQVLSDLDFTVEPCTEPFAAVKKLMAQH |
| Ga0307473_112563561 | 3300031820 | Hardwood Forest Soil | MYTMGYQALLFCPDEKNARVVTQVLTELDFSVDAAAEPFG |
| Ga0307478_115926561 | 3300031823 | Hardwood Forest Soil | MGYQALLFCPDEKTARTVTQVLSELDFEVVSCSEPFAAVK |
| Ga0310910_106189702 | 3300031946 | Soil | MGYQALLFCPDEKTARTVTQVLSDLDFTVEPCTEP |
| Ga0310910_109027492 | 3300031946 | Soil | MSYRSLLFCPDEKTARTVTQVLSELDFKVEPYNEAFVAVKKLTDERYDALVVD |
| Ga0306926_118583631 | 3300031954 | Soil | MGYQALLFCPDEKTAFTVTQVLGDLDFSVERSSEPFAAVKKLMVQHFD |
| Ga0307479_113024441 | 3300031962 | Hardwood Forest Soil | MGYQALLFCPDQKTARTVTQVLTELDFTVDACTEPFAA |
| Ga0308176_105470112 | 3300031996 | Soil | MSYQALLFCPDEKTARVVTQVLTELDFTVEPCNEPFAAVKKLMAQHFDA |
| Ga0306922_105338771 | 3300032001 | Soil | MSYKALLFCPEQKTLRTVTQILSELDFEIEACHEPFAAVKRLTTEHFDAIVV |
| Ga0318549_100977112 | 3300032041 | Soil | MGYQALLFCPDEKTARTVTQVLSDLDFTVEPCTEPFAAVKKLMA |
| Ga0306924_115498641 | 3300032076 | Soil | MSYRSLLFCPDEKTARTVTQVLSELDFKVEPYNEAFVAVKKLTDERYDALVV |
| Ga0307470_116142322 | 3300032174 | Hardwood Forest Soil | MGYQALLFCPDEKTARTVTQVLSELDFAVTPCTEPFAAVKK |
| Ga0307470_118410082 | 3300032174 | Hardwood Forest Soil | MGYQALLFCPDEKTARTVTQVLSELDFAVTPCTEPFAAV |
| Ga0307471_1004720062 | 3300032180 | Hardwood Forest Soil | MGYQALLFCLDERLARVVTQVFSELDFKVEPVNEPFAAV |
| Ga0307471_1016678741 | 3300032180 | Hardwood Forest Soil | MSYRALLFCPDETAARLVTQVLSELDFTVELSLEPFVTV |
| Ga0307472_1009834232 | 3300032205 | Hardwood Forest Soil | MSYKSLLFCPDERTARLVTQVLKELEFAVESANEPFAAVKKLEVERFDALIVDC |
| Ga0307472_1012120802 | 3300032205 | Hardwood Forest Soil | MSYQALLFCPDERTARVVSQVLNELEFDVEPCHEPFAAVKKL |
| Ga0307472_1019461081 | 3300032205 | Hardwood Forest Soil | MKYNALLFCPDEKTARVVTQVLTDLEFRVEPCNEPFA |
| Ga0306920_1000550711 | 3300032261 | Soil | MRSMSYRSLLFCPDEKTARTVTQVLSELDFKVEPYNE |
| Ga0335085_104306123 | 3300032770 | Soil | MSYRALLFCPDEKAARTVTQILGELEFTVEPCLEPFAAVKKLMGEHFDA |
| Ga0335085_107234011 | 3300032770 | Soil | MGYQALLFCPDEKTARTVTQVLGELEFSVEACNEPFAAVKKLM |
| Ga0335082_100674861 | 3300032782 | Soil | MGYQALLFCPDEKLARVVTQVFSDLDFTVEPVNEPFSAVK |
| Ga0335080_109190761 | 3300032828 | Soil | MGYQALLFCPDEKLARVVSQVLDELEFSIDPVSEPFAAVKKMMAQRYDA |
| Ga0335070_103898203 | 3300032829 | Soil | MGYRALLFCPDEKTARAVTQVLTDLEFAVEPAAEPFAAVK |
| Ga0335070_117501782 | 3300032829 | Soil | MSYRALLFCPDERLARVVTQVFSDLDFAVELVNEPFGAVKKLMAQRYDA |
| Ga0335081_101524811 | 3300032892 | Soil | MGYQALLFCSDEKTARLVTQVLSELEFSVESSNEP |
| Ga0335081_110168901 | 3300032892 | Soil | MAYQALLFYRDEKTARVLMQVLDELDFSVEPESEPFAAVKTLMVQRFD |
| Ga0335081_123058221 | 3300032892 | Soil | MGFQALLFCPDEKTARSVTQVLSELEFTVEPCNEP |
| Ga0335074_114993402 | 3300032895 | Soil | MSYRALLFCPDEKTARTVTQVLTELDFSVETSAEPFAAVKKLTSEH |
| Ga0335072_104823401 | 3300032898 | Soil | MSYQALLFCPDEKTARTVTQVLNDLEFTVEACSEP |
| Ga0335083_100218621 | 3300032954 | Soil | MGYTALLFCPEEKTARTVTQVLSELEFTVEACIEP |
| Ga0335084_101271601 | 3300033004 | Soil | MGYQALLFCPDEKLARVVTQVFSDLDFTVEPVNEPFSAVKKLMA |
| Ga0335077_103260394 | 3300033158 | Soil | MGYTALLFCPDDKNARLVTQVLSELEFSVEACAEPFAAVKKLMSQHFDA |
| Ga0335077_117297871 | 3300033158 | Soil | MGYTALLFCPDDKNARLVTQVLSELEFTLEACAEPFVAVKKLMSQ |
| Ga0326728_105620561 | 3300033402 | Peat Soil | MGYEALLFCPDEKTARTVTQVLSELEFNVEACLEP |
| Ga0316212_10519322 | 3300033547 | Roots | MSYRALLFCPDEKIARTVTQVLSELEFAVESCVEPFAAV |
| Ga0371488_0306864_2_130 | 3300033983 | Peat Soil | MGYLALLFCPDEKLVRVISQVFADLDFTVEPVHEPFAAVKKLM |
| Ga0334827_094607_3_137 | 3300034065 | Soil | MGYEALLFCPDEKTARTVTQVLNELEFNVEACLEPFAAVKKLMGQ |
| ⦗Top⦘ |