| Basic Information | |
|---|---|
| Family ID | F007495 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 350 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LKRLARDAYELDAFKPNLTRAEADIRIAMLTAKLKLLDGPPHTL |
| Number of Associated Samples | 223 |
| Number of Associated Scaffolds | 350 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 16.91 % |
| % of genes near scaffold ends (potentially truncated) | 78.86 % |
| % of genes from short scaffolds (< 2000 bps) | 89.43 % |
| Associated GOLD sequencing projects | 203 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.143 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 350 Family Scaffolds |
|---|---|---|
| PF08734 | GYD | 1.71 |
| PF04392 | ABC_sub_bind | 1.43 |
| PF13545 | HTH_Crp_2 | 1.14 |
| PF13602 | ADH_zinc_N_2 | 0.86 |
| PF06823 | DUF1236 | 0.86 |
| PF03734 | YkuD | 0.86 |
| PF09851 | SHOCT | 0.57 |
| PF01370 | Epimerase | 0.57 |
| PF01068 | DNA_ligase_A_M | 0.57 |
| PF12697 | Abhydrolase_6 | 0.57 |
| PF04519 | Bactofilin | 0.57 |
| PF13751 | DDE_Tnp_1_6 | 0.57 |
| PF02780 | Transketolase_C | 0.57 |
| PF00005 | ABC_tran | 0.57 |
| PF00378 | ECH_1 | 0.57 |
| PF00027 | cNMP_binding | 0.57 |
| PF06411 | HdeA | 0.57 |
| PF00583 | Acetyltransf_1 | 0.57 |
| PF14337 | Abi_alpha | 0.29 |
| PF13546 | DDE_5 | 0.29 |
| PF04964 | Flp_Fap | 0.29 |
| PF13460 | NAD_binding_10 | 0.29 |
| PF02563 | Poly_export | 0.29 |
| PF04008 | Adenosine_kin | 0.29 |
| PF07536 | HWE_HK | 0.29 |
| PF01471 | PG_binding_1 | 0.29 |
| PF08308 | PEGA | 0.29 |
| PF00926 | DHBP_synthase | 0.29 |
| PF02586 | SRAP | 0.29 |
| PF07589 | PEP-CTERM | 0.29 |
| PF04828 | GFA | 0.29 |
| PF11272 | DUF3072 | 0.29 |
| PF01548 | DEDD_Tnp_IS110 | 0.29 |
| PF07883 | Cupin_2 | 0.29 |
| PF13505 | OMP_b-brl | 0.29 |
| PF01266 | DAO | 0.29 |
| PF13442 | Cytochrome_CBB3 | 0.29 |
| PF13202 | EF-hand_5 | 0.29 |
| PF03641 | Lysine_decarbox | 0.29 |
| PF13817 | DDE_Tnp_IS66_C | 0.29 |
| PF13630 | SdpI | 0.29 |
| PF13408 | Zn_ribbon_recom | 0.29 |
| PF00072 | Response_reg | 0.29 |
| PF02627 | CMD | 0.29 |
| PF13564 | DoxX_2 | 0.29 |
| PF05532 | CsbD | 0.29 |
| PF00456 | Transketolase_N | 0.29 |
| PF02852 | Pyr_redox_dim | 0.29 |
| PF06186 | DUF992 | 0.29 |
| PF01979 | Amidohydro_1 | 0.29 |
| PF13336 | AcetylCoA_hyd_C | 0.29 |
| PF07045 | DUF1330 | 0.29 |
| PF11578 | DUF3237 | 0.29 |
| PF06147 | DUF968 | 0.29 |
| PF01042 | Ribonuc_L-PSP | 0.29 |
| PF01522 | Polysacc_deac_1 | 0.29 |
| PF00805 | Pentapeptide | 0.29 |
| PF04226 | Transgly_assoc | 0.29 |
| PF01322 | Cytochrom_C_2 | 0.29 |
| PF00561 | Abhydrolase_1 | 0.29 |
| PF03170 | BcsB | 0.29 |
| PF07238 | PilZ | 0.29 |
| COG ID | Name | Functional Category | % Frequency in 350 Family Scaffolds |
|---|---|---|---|
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.71 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.43 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.57 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.57 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.57 |
| COG3909 | Cytochrome c556 | Energy production and conversion [C] | 0.29 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.29 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.29 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.29 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.29 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.29 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.29 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.29 |
| COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 0.29 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.29 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.29 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.29 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.29 |
| COG1839 | Adenosine/AMP kinase | Nucleotide transport and metabolism [F] | 0.29 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.29 |
| COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.29 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.29 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.29 |
| COG0108 | 3,4-dihydroxy-2-butanone 4-phosphate synthase | Coenzyme transport and metabolism [H] | 0.29 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.14 % |
| All Organisms | root | All Organisms | 34.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02HDIJX | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300000567|JGI12270J11330_10197427 | Not Available | 691 | Open in IMG/M |
| 3300000664|JGI12418J11929_10778 | Not Available | 534 | Open in IMG/M |
| 3300000682|JGI12334J11920_101671 | Not Available | 564 | Open in IMG/M |
| 3300000689|JGI12538J11921_102721 | Not Available | 508 | Open in IMG/M |
| 3300001285|JGI12541J14228_101873 | Not Available | 500 | Open in IMG/M |
| 3300001356|JGI12269J14319_10141468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1054 | Open in IMG/M |
| 3300001402|JGI20195J14853_1016121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1528 | Open in IMG/M |
| 3300002549|JGI24130J36418_10139407 | Not Available | 526 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10209522 | Not Available | 791 | Open in IMG/M |
| 3300004091|Ga0062387_100172004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1275 | Open in IMG/M |
| 3300004157|Ga0062590_100260561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1315 | Open in IMG/M |
| 3300005168|Ga0066809_10074225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. dw_53 | 797 | Open in IMG/M |
| 3300005185|Ga0066811_1020781 | Not Available | 560 | Open in IMG/M |
| 3300005289|Ga0065704_10233800 | Not Available | 1035 | Open in IMG/M |
| 3300005295|Ga0065707_10483063 | Not Available | 763 | Open in IMG/M |
| 3300005332|Ga0066388_100165241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 2807 | Open in IMG/M |
| 3300005332|Ga0066388_100194170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 65-9 | 2647 | Open in IMG/M |
| 3300005332|Ga0066388_100471165 | Not Available | 1895 | Open in IMG/M |
| 3300005332|Ga0066388_102989755 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005332|Ga0066388_102993892 | Not Available | 863 | Open in IMG/M |
| 3300005332|Ga0066388_103377246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 815 | Open in IMG/M |
| 3300005332|Ga0066388_103905483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 760 | Open in IMG/M |
| 3300005332|Ga0066388_104611623 | Not Available | 701 | Open in IMG/M |
| 3300005332|Ga0066388_105182406 | Not Available | 662 | Open in IMG/M |
| 3300005332|Ga0066388_108062413 | Not Available | 526 | Open in IMG/M |
| 3300005434|Ga0070709_10870809 | Not Available | 711 | Open in IMG/M |
| 3300005434|Ga0070709_11526346 | Not Available | 543 | Open in IMG/M |
| 3300005435|Ga0070714_101497562 | Not Available | 659 | Open in IMG/M |
| 3300005439|Ga0070711_100370126 | Not Available | 1156 | Open in IMG/M |
| 3300005455|Ga0070663_100060288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2729 | Open in IMG/M |
| 3300005455|Ga0070663_100277289 | Not Available | 1335 | Open in IMG/M |
| 3300005535|Ga0070684_100879940 | Not Available | 839 | Open in IMG/M |
| 3300005542|Ga0070732_10727876 | Not Available | 604 | Open in IMG/M |
| 3300005548|Ga0070665_102530874 | Not Available | 515 | Open in IMG/M |
| 3300005617|Ga0068859_102106858 | Not Available | 623 | Open in IMG/M |
| 3300005764|Ga0066903_100356941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2368 | Open in IMG/M |
| 3300005764|Ga0066903_101682642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1207 | Open in IMG/M |
| 3300005764|Ga0066903_101768417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1179 | Open in IMG/M |
| 3300005764|Ga0066903_102136727 | Not Available | 1078 | Open in IMG/M |
| 3300005764|Ga0066903_102165327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1072 | Open in IMG/M |
| 3300005764|Ga0066903_107278383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
| 3300005764|Ga0066903_108917050 | Not Available | 508 | Open in IMG/M |
| 3300005764|Ga0066903_108971637 | Not Available | 506 | Open in IMG/M |
| 3300005764|Ga0066903_109095281 | Not Available | 502 | Open in IMG/M |
| 3300005843|Ga0068860_100734035 | Not Available | 999 | Open in IMG/M |
| 3300005938|Ga0066795_10018259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1975 | Open in IMG/M |
| 3300005938|Ga0066795_10133748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 739 | Open in IMG/M |
| 3300005980|Ga0066798_10030097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1802 | Open in IMG/M |
| 3300005994|Ga0066789_10179375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 895 | Open in IMG/M |
| 3300005995|Ga0066790_10104293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1218 | Open in IMG/M |
| 3300006050|Ga0075028_100980481 | Not Available | 525 | Open in IMG/M |
| 3300006050|Ga0075028_101005629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300006055|Ga0097691_1003866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9048 | Open in IMG/M |
| 3300006059|Ga0075017_100583600 | Not Available | 853 | Open in IMG/M |
| 3300006086|Ga0075019_10397615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis | 842 | Open in IMG/M |
| 3300006086|Ga0075019_10562425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
| 3300006102|Ga0075015_100397106 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300006102|Ga0075015_100769356 | Not Available | 576 | Open in IMG/M |
| 3300006162|Ga0075030_100890994 | Not Available | 702 | Open in IMG/M |
| 3300006172|Ga0075018_10449136 | Not Available | 664 | Open in IMG/M |
| 3300006174|Ga0075014_100177741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1059 | Open in IMG/M |
| 3300006175|Ga0070712_101298680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 634 | Open in IMG/M |
| 3300006358|Ga0068871_101935529 | Not Available | 561 | Open in IMG/M |
| 3300006574|Ga0074056_11144638 | Not Available | 617 | Open in IMG/M |
| 3300006854|Ga0075425_102132302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 625 | Open in IMG/M |
| 3300006903|Ga0075426_10712206 | Not Available | 753 | Open in IMG/M |
| 3300006903|Ga0075426_11491824 | Not Available | 514 | Open in IMG/M |
| 3300007788|Ga0099795_10511489 | Not Available | 561 | Open in IMG/M |
| 3300009029|Ga0066793_10510976 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300009101|Ga0105247_10547456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 850 | Open in IMG/M |
| 3300009148|Ga0105243_10510645 | Not Available | 1141 | Open in IMG/M |
| 3300009156|Ga0111538_10868626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1142 | Open in IMG/M |
| 3300009523|Ga0116221_1294023 | Not Available | 703 | Open in IMG/M |
| 3300009552|Ga0116138_1237613 | Not Available | 504 | Open in IMG/M |
| 3300009630|Ga0116114_1097586 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300009631|Ga0116115_1175723 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300009634|Ga0116124_1043987 | Not Available | 1334 | Open in IMG/M |
| 3300009640|Ga0116126_1269568 | Not Available | 529 | Open in IMG/M |
| 3300009643|Ga0116110_1235290 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300009662|Ga0105856_1203092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 626 | Open in IMG/M |
| 3300009839|Ga0116223_10205692 | Not Available | 1202 | Open in IMG/M |
| 3300009839|Ga0116223_10895348 | Not Available | 506 | Open in IMG/M |
| 3300010047|Ga0126382_12471290 | Not Available | 506 | Open in IMG/M |
| 3300010048|Ga0126373_10420651 | Not Available | 1365 | Open in IMG/M |
| 3300010048|Ga0126373_10972470 | Not Available | 914 | Open in IMG/M |
| 3300010048|Ga0126373_11399841 | Not Available | 765 | Open in IMG/M |
| 3300010048|Ga0126373_11796002 | Not Available | 677 | Open in IMG/M |
| 3300010048|Ga0126373_12762839 | Not Available | 548 | Open in IMG/M |
| 3300010048|Ga0126373_12865797 | Not Available | 538 | Open in IMG/M |
| 3300010358|Ga0126370_11939622 | Not Available | 574 | Open in IMG/M |
| 3300010360|Ga0126372_11712365 | Not Available | 670 | Open in IMG/M |
| 3300010361|Ga0126378_11379467 | Not Available | 798 | Open in IMG/M |
| 3300010361|Ga0126378_11565568 | Not Available | 748 | Open in IMG/M |
| 3300010361|Ga0126378_11856445 | Not Available | 686 | Open in IMG/M |
| 3300010361|Ga0126378_12329304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 611 | Open in IMG/M |
| 3300010361|Ga0126378_12549432 | Not Available | 584 | Open in IMG/M |
| 3300010362|Ga0126377_10321142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1534 | Open in IMG/M |
| 3300010371|Ga0134125_10205146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2194 | Open in IMG/M |
| 3300010373|Ga0134128_12121087 | Not Available | 619 | Open in IMG/M |
| 3300010376|Ga0126381_100773475 | Not Available | 1377 | Open in IMG/M |
| 3300010376|Ga0126381_101028599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1189 | Open in IMG/M |
| 3300010376|Ga0126381_101360814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1026 | Open in IMG/M |
| 3300010376|Ga0126381_102931749 | Not Available | 679 | Open in IMG/M |
| 3300010376|Ga0126381_102999206 | Not Available | 671 | Open in IMG/M |
| 3300010376|Ga0126381_103125556 | Not Available | 656 | Open in IMG/M |
| 3300010376|Ga0126381_104127434 | Not Available | 564 | Open in IMG/M |
| 3300010376|Ga0126381_104649149 | Not Available | 529 | Open in IMG/M |
| 3300010379|Ga0136449_100102105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5878 | Open in IMG/M |
| 3300010396|Ga0134126_11046440 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300010397|Ga0134124_10802078 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300010398|Ga0126383_12429381 | Not Available | 609 | Open in IMG/M |
| 3300010398|Ga0126383_13585141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300012004|Ga0120134_1085117 | Not Available | 580 | Open in IMG/M |
| 3300012285|Ga0137370_11050829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300012914|Ga0157297_10080052 | Not Available | 934 | Open in IMG/M |
| 3300012961|Ga0164302_10557033 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300012971|Ga0126369_10556989 | Not Available | 1212 | Open in IMG/M |
| 3300012985|Ga0164308_10807814 | Not Available | 818 | Open in IMG/M |
| 3300012987|Ga0164307_10449330 | Not Available | 962 | Open in IMG/M |
| 3300012988|Ga0164306_10138535 | Not Available | 1643 | Open in IMG/M |
| 3300013296|Ga0157374_11203746 | Not Available | 779 | Open in IMG/M |
| 3300013308|Ga0157375_12614330 | Not Available | 603 | Open in IMG/M |
| 3300014156|Ga0181518_10068723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2050 | Open in IMG/M |
| 3300014162|Ga0181538_10433594 | Not Available | 697 | Open in IMG/M |
| 3300014495|Ga0182015_10043126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3353 | Open in IMG/M |
| 3300014495|Ga0182015_10533060 | Not Available | 748 | Open in IMG/M |
| 3300014969|Ga0157376_12143676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 597 | Open in IMG/M |
| 3300015371|Ga0132258_10745177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. dw_53 | 2467 | Open in IMG/M |
| 3300015371|Ga0132258_13375593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 1097 | Open in IMG/M |
| 3300015373|Ga0132257_100850674 | Not Available | 1141 | Open in IMG/M |
| 3300015373|Ga0132257_103199136 | Not Available | 596 | Open in IMG/M |
| 3300016270|Ga0182036_10001086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12564 | Open in IMG/M |
| 3300016270|Ga0182036_10059175 | Not Available | 2447 | Open in IMG/M |
| 3300016270|Ga0182036_10107067 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
| 3300016294|Ga0182041_11447448 | Not Available | 631 | Open in IMG/M |
| 3300016319|Ga0182033_11204464 | Not Available | 678 | Open in IMG/M |
| 3300016319|Ga0182033_11406377 | Not Available | 628 | Open in IMG/M |
| 3300016319|Ga0182033_11899706 | Not Available | 541 | Open in IMG/M |
| 3300016341|Ga0182035_10262880 | Not Available | 1398 | Open in IMG/M |
| 3300016341|Ga0182035_10476576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1062 | Open in IMG/M |
| 3300016341|Ga0182035_10684780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 892 | Open in IMG/M |
| 3300016341|Ga0182035_11411500 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300016341|Ga0182035_11728696 | Not Available | 565 | Open in IMG/M |
| 3300016341|Ga0182035_11799702 | Not Available | 554 | Open in IMG/M |
| 3300016357|Ga0182032_10155575 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300016357|Ga0182032_10565116 | Not Available | 943 | Open in IMG/M |
| 3300016357|Ga0182032_10935711 | Not Available | 738 | Open in IMG/M |
| 3300016371|Ga0182034_10160646 | Not Available | 1699 | Open in IMG/M |
| 3300016371|Ga0182034_10400933 | Not Available | 1125 | Open in IMG/M |
| 3300016371|Ga0182034_10445271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1071 | Open in IMG/M |
| 3300016371|Ga0182034_10793479 | Not Available | 810 | Open in IMG/M |
| 3300016371|Ga0182034_11125243 | Not Available | 681 | Open in IMG/M |
| 3300016387|Ga0182040_11024760 | Not Available | 689 | Open in IMG/M |
| 3300016387|Ga0182040_11467036 | Not Available | 579 | Open in IMG/M |
| 3300016387|Ga0182040_11712915 | Not Available | 537 | Open in IMG/M |
| 3300016404|Ga0182037_10068001 | Not Available | 2453 | Open in IMG/M |
| 3300016404|Ga0182037_11034780 | Not Available | 716 | Open in IMG/M |
| 3300016445|Ga0182038_10018957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4095 | Open in IMG/M |
| 3300016445|Ga0182038_10694046 | Not Available | 886 | Open in IMG/M |
| 3300017792|Ga0163161_10195300 | Not Available | 1557 | Open in IMG/M |
| 3300017822|Ga0187802_10006169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3680 | Open in IMG/M |
| 3300017822|Ga0187802_10190794 | Not Available | 787 | Open in IMG/M |
| 3300017822|Ga0187802_10305357 | Not Available | 621 | Open in IMG/M |
| 3300017931|Ga0187877_1074258 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300017931|Ga0187877_1331954 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300017932|Ga0187814_10178862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis rosea | 794 | Open in IMG/M |
| 3300017936|Ga0187821_10104644 | Not Available | 1046 | Open in IMG/M |
| 3300017946|Ga0187879_10394784 | Not Available | 766 | Open in IMG/M |
| 3300017946|Ga0187879_10708967 | Not Available | 560 | Open in IMG/M |
| 3300017946|Ga0187879_10745120 | Not Available | 546 | Open in IMG/M |
| 3300017966|Ga0187776_11555147 | Not Available | 510 | Open in IMG/M |
| 3300017970|Ga0187783_11065590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300018001|Ga0187815_10527744 | Not Available | 507 | Open in IMG/M |
| 3300018003|Ga0187876_1201645 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300018005|Ga0187878_1257824 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300018007|Ga0187805_10064368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 1649 | Open in IMG/M |
| 3300018024|Ga0187881_10208786 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300018044|Ga0187890_10588886 | Not Available | 627 | Open in IMG/M |
| 3300018044|Ga0187890_10677224 | Not Available | 582 | Open in IMG/M |
| 3300018047|Ga0187859_10186233 | Not Available | 1106 | Open in IMG/M |
| 3300018060|Ga0187765_10603407 | Not Available | 709 | Open in IMG/M |
| 3300018062|Ga0187784_10525603 | Not Available | 952 | Open in IMG/M |
| 3300018081|Ga0184625_10664112 | Not Available | 503 | Open in IMG/M |
| 3300018468|Ga0066662_12355771 | Not Available | 560 | Open in IMG/M |
| 3300019877|Ga0193722_1134938 | Not Available | 554 | Open in IMG/M |
| 3300019879|Ga0193723_1088103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 885 | Open in IMG/M |
| 3300019999|Ga0193718_1112510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300020583|Ga0210401_10224228 | Not Available | 1738 | Open in IMG/M |
| 3300020583|Ga0210401_10318052 | Not Available | 1418 | Open in IMG/M |
| 3300021171|Ga0210405_10063648 | Not Available | 2909 | Open in IMG/M |
| 3300021178|Ga0210408_10711590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300021181|Ga0210388_11695936 | Not Available | 523 | Open in IMG/M |
| 3300021403|Ga0210397_10107170 | Not Available | 1896 | Open in IMG/M |
| 3300021403|Ga0210397_10434967 | Not Available | 985 | Open in IMG/M |
| 3300021405|Ga0210387_11165983 | Not Available | 670 | Open in IMG/M |
| 3300021420|Ga0210394_10599118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 968 | Open in IMG/M |
| 3300021560|Ga0126371_10189681 | Not Available | 2145 | Open in IMG/M |
| 3300021560|Ga0126371_10787715 | Not Available | 1097 | Open in IMG/M |
| 3300021560|Ga0126371_10811343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1082 | Open in IMG/M |
| 3300021560|Ga0126371_11131316 | Not Available | 921 | Open in IMG/M |
| 3300021560|Ga0126371_11495084 | Not Available | 804 | Open in IMG/M |
| 3300021560|Ga0126371_11591394 | Not Available | 780 | Open in IMG/M |
| 3300021560|Ga0126371_11827899 | Not Available | 728 | Open in IMG/M |
| 3300021560|Ga0126371_13125823 | Not Available | 560 | Open in IMG/M |
| 3300022756|Ga0222622_10490856 | Not Available | 876 | Open in IMG/M |
| 3300025457|Ga0208850_1008139 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
| 3300025477|Ga0208192_1018313 | Not Available | 1750 | Open in IMG/M |
| 3300025481|Ga0208079_1001341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12915 | Open in IMG/M |
| 3300025507|Ga0208188_1128674 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300025509|Ga0208848_1006126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14 | 2438 | Open in IMG/M |
| 3300025579|Ga0207927_1058869 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300025604|Ga0207930_1057747 | Not Available | 953 | Open in IMG/M |
| 3300025633|Ga0208480_1131757 | Not Available | 576 | Open in IMG/M |
| 3300025664|Ga0208849_1025740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1919 | Open in IMG/M |
| 3300025854|Ga0209176_10037382 | Not Available | 1050 | Open in IMG/M |
| 3300025906|Ga0207699_11177012 | Not Available | 568 | Open in IMG/M |
| 3300025915|Ga0207693_10341960 | Not Available | 1171 | Open in IMG/M |
| 3300025916|Ga0207663_10075717 | All Organisms → cellular organisms → Bacteria | 2185 | Open in IMG/M |
| 3300025928|Ga0207700_10489007 | Not Available | 1088 | Open in IMG/M |
| 3300025930|Ga0207701_10152366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas rhenobacensis | 2049 | Open in IMG/M |
| 3300025933|Ga0207706_10447265 | Not Available | 1118 | Open in IMG/M |
| 3300025939|Ga0207665_11647097 | Not Available | 508 | Open in IMG/M |
| 3300026095|Ga0207676_11060807 | Not Available | 800 | Open in IMG/M |
| 3300026222|Ga0209862_1078056 | Not Available | 560 | Open in IMG/M |
| 3300026274|Ga0209888_1021272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1289 | Open in IMG/M |
| 3300026319|Ga0209647_1180818 | Not Available | 799 | Open in IMG/M |
| 3300026489|Ga0257160_1066077 | Not Available | 636 | Open in IMG/M |
| 3300026908|Ga0207787_1002504 | Not Available | 2191 | Open in IMG/M |
| 3300027109|Ga0208603_1068231 | Not Available | 530 | Open in IMG/M |
| 3300027384|Ga0209854_1081540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 573 | Open in IMG/M |
| 3300027394|Ga0209904_1019497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300027401|Ga0208637_1022263 | Not Available | 700 | Open in IMG/M |
| 3300027560|Ga0207981_1068943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. dw_53 | 649 | Open in IMG/M |
| 3300027645|Ga0209117_1047628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1280 | Open in IMG/M |
| 3300027680|Ga0207826_1031858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1465 | Open in IMG/M |
| 3300027703|Ga0207862_1259580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 508 | Open in IMG/M |
| 3300027854|Ga0209517_10574045 | Not Available | 602 | Open in IMG/M |
| 3300027874|Ga0209465_10492072 | Not Available | 612 | Open in IMG/M |
| 3300027894|Ga0209068_10544447 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300027898|Ga0209067_10460556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300027911|Ga0209698_10243428 | Not Available | 1439 | Open in IMG/M |
| 3300027915|Ga0209069_10311465 | Not Available | 839 | Open in IMG/M |
| 3300028015|Ga0265353_1034230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300028711|Ga0307293_10277014 | Not Available | 532 | Open in IMG/M |
| 3300028793|Ga0307299_10306955 | Not Available | 596 | Open in IMG/M |
| 3300028814|Ga0307302_10087059 | Not Available | 1484 | Open in IMG/M |
| 3300029943|Ga0311340_10942070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300031090|Ga0265760_10183747 | Not Available | 699 | Open in IMG/M |
| 3300031231|Ga0170824_103940713 | Not Available | 6812 | Open in IMG/M |
| 3300031274|Ga0307442_1034551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1685 | Open in IMG/M |
| 3300031446|Ga0170820_16151236 | Not Available | 512 | Open in IMG/M |
| 3300031474|Ga0170818_105288894 | Not Available | 524 | Open in IMG/M |
| 3300031546|Ga0318538_10576450 | Not Available | 610 | Open in IMG/M |
| 3300031561|Ga0318528_10001537 | All Organisms → cellular organisms → Bacteria | 8829 | Open in IMG/M |
| 3300031564|Ga0318573_10318272 | Not Available | 834 | Open in IMG/M |
| 3300031573|Ga0310915_10115746 | Not Available | 1826 | Open in IMG/M |
| 3300031573|Ga0310915_10136717 | Not Available | 1686 | Open in IMG/M |
| 3300031573|Ga0310915_10296979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. | 1141 | Open in IMG/M |
| 3300031573|Ga0310915_10405485 | Not Available | 968 | Open in IMG/M |
| 3300031573|Ga0310915_10699980 | Not Available | 715 | Open in IMG/M |
| 3300031668|Ga0318542_10295653 | Not Available | 828 | Open in IMG/M |
| 3300031668|Ga0318542_10353751 | Not Available | 756 | Open in IMG/M |
| 3300031680|Ga0318574_10209192 | Not Available | 1122 | Open in IMG/M |
| 3300031681|Ga0318572_10286700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 972 | Open in IMG/M |
| 3300031682|Ga0318560_10025651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 2743 | Open in IMG/M |
| 3300031682|Ga0318560_10362212 | Not Available | 784 | Open in IMG/M |
| 3300031699|Ga0315535_1023535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2669 | Open in IMG/M |
| 3300031708|Ga0310686_107144943 | Not Available | 609 | Open in IMG/M |
| 3300031708|Ga0310686_108645914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 573 | Open in IMG/M |
| 3300031719|Ga0306917_10466167 | Not Available | 990 | Open in IMG/M |
| 3300031719|Ga0306917_10562477 | Not Available | 896 | Open in IMG/M |
| 3300031719|Ga0306917_11047229 | Not Available | 636 | Open in IMG/M |
| 3300031719|Ga0306917_11325357 | Not Available | 556 | Open in IMG/M |
| 3300031744|Ga0306918_10238257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1384 | Open in IMG/M |
| 3300031744|Ga0306918_10359741 | Not Available | 1130 | Open in IMG/M |
| 3300031744|Ga0306918_10617580 | Not Available | 849 | Open in IMG/M |
| 3300031744|Ga0306918_11438745 | Not Available | 528 | Open in IMG/M |
| 3300031771|Ga0318546_10110041 | Not Available | 1818 | Open in IMG/M |
| 3300031771|Ga0318546_10892837 | Not Available | 626 | Open in IMG/M |
| 3300031777|Ga0318543_10475897 | Not Available | 560 | Open in IMG/M |
| 3300031782|Ga0318552_10026781 | Not Available | 2610 | Open in IMG/M |
| 3300031792|Ga0318529_10172149 | Not Available | 1001 | Open in IMG/M |
| 3300031819|Ga0318568_10544091 | Not Available | 724 | Open in IMG/M |
| 3300031833|Ga0310917_10053595 | Not Available | 2483 | Open in IMG/M |
| 3300031845|Ga0318511_10279809 | Not Available | 752 | Open in IMG/M |
| 3300031846|Ga0318512_10710696 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031879|Ga0306919_10096362 | Not Available | 2072 | Open in IMG/M |
| 3300031879|Ga0306919_10388363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1069 | Open in IMG/M |
| 3300031880|Ga0318544_10077251 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300031890|Ga0306925_11069673 | Not Available | 817 | Open in IMG/M |
| 3300031890|Ga0306925_11498393 | Not Available | 661 | Open in IMG/M |
| 3300031890|Ga0306925_11611364 | Not Available | 631 | Open in IMG/M |
| 3300031897|Ga0318520_10706180 | Not Available | 630 | Open in IMG/M |
| 3300031910|Ga0306923_10296299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1848 | Open in IMG/M |
| 3300031910|Ga0306923_11155320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 830 | Open in IMG/M |
| 3300031910|Ga0306923_11253962 | Not Available | 789 | Open in IMG/M |
| 3300031910|Ga0306923_11809359 | Not Available | 627 | Open in IMG/M |
| 3300031910|Ga0306923_11840631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Brevibacillus → Brevibacillus panacihumi | 620 | Open in IMG/M |
| 3300031912|Ga0306921_10190933 | Not Available | 2401 | Open in IMG/M |
| 3300031912|Ga0306921_10304152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1867 | Open in IMG/M |
| 3300031912|Ga0306921_10614371 | Not Available | 1256 | Open in IMG/M |
| 3300031912|Ga0306921_11712704 | Not Available | 679 | Open in IMG/M |
| 3300031912|Ga0306921_11809808 | Not Available | 656 | Open in IMG/M |
| 3300031912|Ga0306921_12051457 | Not Available | 607 | Open in IMG/M |
| 3300031912|Ga0306921_12266979 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031912|Ga0306921_12365351 | Not Available | 555 | Open in IMG/M |
| 3300031941|Ga0310912_10123549 | Not Available | 1930 | Open in IMG/M |
| 3300031941|Ga0310912_10545278 | Not Available | 903 | Open in IMG/M |
| 3300031941|Ga0310912_11044831 | Not Available | 625 | Open in IMG/M |
| 3300031941|Ga0310912_11296598 | Not Available | 552 | Open in IMG/M |
| 3300031942|Ga0310916_10223405 | Not Available | 1581 | Open in IMG/M |
| 3300031942|Ga0310916_10256649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1474 | Open in IMG/M |
| 3300031942|Ga0310916_10732858 | Not Available | 835 | Open in IMG/M |
| 3300031945|Ga0310913_11067377 | Not Available | 565 | Open in IMG/M |
| 3300031946|Ga0310910_10061281 | All Organisms → cellular organisms → Bacteria | 2686 | Open in IMG/M |
| 3300031946|Ga0310910_10305827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1251 | Open in IMG/M |
| 3300031946|Ga0310910_10840844 | Not Available | 722 | Open in IMG/M |
| 3300031946|Ga0310910_11121410 | Not Available | 612 | Open in IMG/M |
| 3300031946|Ga0310910_11468494 | Not Available | 523 | Open in IMG/M |
| 3300031947|Ga0310909_11078335 | Not Available | 653 | Open in IMG/M |
| 3300031947|Ga0310909_11624918 | Not Available | 512 | Open in IMG/M |
| 3300031954|Ga0306926_10374137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1760 | Open in IMG/M |
| 3300031954|Ga0306926_12810319 | Not Available | 526 | Open in IMG/M |
| 3300031959|Ga0318530_10091648 | Not Available | 1200 | Open in IMG/M |
| 3300031962|Ga0307479_11676465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis rosea | 590 | Open in IMG/M |
| 3300031981|Ga0318531_10540105 | Not Available | 528 | Open in IMG/M |
| 3300032001|Ga0306922_10351450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1581 | Open in IMG/M |
| 3300032001|Ga0306922_11218311 | Not Available | 765 | Open in IMG/M |
| 3300032009|Ga0318563_10734375 | Not Available | 530 | Open in IMG/M |
| 3300032013|Ga0310906_10246010 | Not Available | 1114 | Open in IMG/M |
| 3300032025|Ga0318507_10311595 | Not Available | 685 | Open in IMG/M |
| 3300032035|Ga0310911_10564975 | Not Available | 660 | Open in IMG/M |
| 3300032059|Ga0318533_10001624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 11347 | Open in IMG/M |
| 3300032059|Ga0318533_10065619 | Not Available | 2449 | Open in IMG/M |
| 3300032059|Ga0318533_11426327 | Not Available | 506 | Open in IMG/M |
| 3300032064|Ga0318510_10095389 | Not Available | 1125 | Open in IMG/M |
| 3300032067|Ga0318524_10310846 | Not Available | 816 | Open in IMG/M |
| 3300032076|Ga0306924_10788211 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300032076|Ga0306924_11410172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 743 | Open in IMG/M |
| 3300032076|Ga0306924_11884396 | Not Available | 620 | Open in IMG/M |
| 3300032261|Ga0306920_100384103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2088 | Open in IMG/M |
| 3300032261|Ga0306920_101705547 | Not Available | 892 | Open in IMG/M |
| 3300032261|Ga0306920_101723965 | Not Available | 887 | Open in IMG/M |
| 3300032261|Ga0306920_104011254 | Not Available | 534 | Open in IMG/M |
| 3300033289|Ga0310914_10100955 | Not Available | 2482 | Open in IMG/M |
| 3300033289|Ga0310914_11872183 | Not Available | 505 | Open in IMG/M |
| 3300033486|Ga0316624_10323998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1259 | Open in IMG/M |
| 3300034125|Ga0370484_0098389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 761 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.29% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.14% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.57% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.43% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.14% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.14% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.14% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.57% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.57% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.29% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.29% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.29% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.29% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.29% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.29% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.29% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.29% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.29% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.29% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.29% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.29% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.29% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.29% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.29% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.29% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000664 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 62 | Environmental | Open in IMG/M |
| 3300000682 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 | Environmental | Open in IMG/M |
| 3300000689 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 76 | Environmental | Open in IMG/M |
| 3300001285 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001402 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 | Environmental | Open in IMG/M |
| 3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005185 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPB | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026222 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 (SPAdes) | Environmental | Open in IMG/M |
| 3300026274 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031274 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031699 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_02397720 | 2170459013 | Grass Soil | MTPEQAAMFKELAKAAYELDAFKPNLRRAEAELRIAMLTAKLKLLDGPPHTL |
| JGI12270J11330_101974271 | 3300000567 | Peatlands Soil | AKDAYELDAYKSNLTRAEADKRIAMPTAKLKLLDGPPHAL* |
| JGI12418J11929_107781 | 3300000664 | Tropical Forest Soil | TYELDAFKSNLTRTEADKRIAMLTAKLKLLDEPPHTI* |
| JGI12334J11920_1016711 | 3300000682 | Tropical Forest Soil | KKLAEATYELDAFKSNLTRTEADKRIAMLTAKLKLLDEPPHTI* |
| JGI12538J11921_1027211 | 3300000689 | Tropical Forest Soil | QATTLKKLAEATYELDAFKSNLTRTEADKRIAMLTAKLKLLDEPPHTI* |
| JGI12541J14228_1018731 | 3300001285 | Tropical Forest Soil | AQATTLKKLAEATYELDAFKSNLTRTEADKRIAMLTAKLKLLDEPPHTI* |
| JGI12269J14319_101414681 | 3300001356 | Peatlands Soil | QAATLKRLAKDAYELDAYKSNLTRAEADKRIAMPTAKLKLLDGPPHAL* |
| JGI20195J14853_10161211 | 3300001402 | Arctic Peat Soil | ATLKRLAQAAYELDAFKPNLTPAEADIRIAMLTAKLKLLDEPPHTL* |
| JGI24130J36418_101394071 | 3300002549 | Arctic Peat Soil | MTVEQTALLRQLALEAYELDAFGCHLTQAEANIRIATLAAKLKLLDEPPHTL* |
| JGIcombinedJ51221_102095222 | 3300003505 | Forest Soil | LAKAAYELDAFKPNLRRAEADIRIAMLKAKLKLLDGPPHTL* |
| Ga0062387_1001720042 | 3300004091 | Bog Forest Soil | MWTPMTHTQLMTADQAATPKRLAEEAYELDAFKPNLTRTEADQRIATLTAKLVLLDGPPHTL* |
| Ga0062590_1002605611 | 3300004157 | Soil | MTADGLMTTAQAATLKRLALVTYELDASKPNLTPTEADIRIAMLTAKL |
| Ga0066809_100742251 | 3300005168 | Soil | QAATLKRLAQAAYELDAFKPNLTRTEADIRVAMLTAKLKLLDEPPHTL* |
| Ga0066811_10207811 | 3300005185 | Soil | MTPEQAATLKELAKAAYELDAFKPNLRRAEAELRIAMLTAKLKLLDGPPHTL* |
| Ga0065704_102338003 | 3300005289 | Switchgrass Rhizosphere | RLAQDTYELDAFKPNLTRTEAEKRIITLTAKLKLLGEPPHTL* |
| Ga0065707_104830633 | 3300005295 | Switchgrass Rhizosphere | LAQDTYELDAFKPNLTRAEAEKRIITLTAKLKLLGEPPHTL* |
| Ga0066388_1001652415 | 3300005332 | Tropical Forest Soil | MLKGLAEAAYELDAFKPKLTRADADQRISMLTAKFKLPPHTL* |
| Ga0066388_1001941703 | 3300005332 | Tropical Forest Soil | MTAEQAATLKRLAKAAYELDAFSMGAKANLRIAALAAKLKLLGEPPHTL* |
| Ga0066388_1004711652 | 3300005332 | Tropical Forest Soil | LAEAAYELEAFQRNLTRGEADLRIAMLTAKLKLLDGPPHTL* |
| Ga0066388_1029897552 | 3300005332 | Tropical Forest Soil | MTGEQAETLKRLAQAAYELDAYKPNLTRGEADLRIATLAAKLKLLDGPPHTL* |
| Ga0066388_1029938921 | 3300005332 | Tropical Forest Soil | TLKRLAQAAYELEAFQPNLTPPEVDLRIAMLTAKLKLLDGPPHTL* |
| Ga0066388_1033772461 | 3300005332 | Tropical Forest Soil | MTAGQSAALKRLANDAYELDAFKPNPTRTEADRRIAALAAKLKLLNGPPLTL* |
| Ga0066388_1039054832 | 3300005332 | Tropical Forest Soil | MTVVQAATLKRVAEAAYELDAFKPNLTRDEADVRIAMLTAKLKLLGEPPHTL* |
| Ga0066388_1046116232 | 3300005332 | Tropical Forest Soil | MTVVQAATLMRVAEAAYELDAFKPNLTRAEADVRIAMLTAKLKLLGEPPHTL* |
| Ga0066388_1051824061 | 3300005332 | Tropical Forest Soil | MTPEQAATLKRLAIAAYELDAFKTNLTRSEADLRIAALTAKLKLLDGPPHTL* |
| Ga0066388_1080624131 | 3300005332 | Tropical Forest Soil | LAEAAYELEAFQPNLTRAEADLRIAMLTAKLKLLDGPPHTL* |
| Ga0070709_108708092 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAVQAATLKRLAHDAYELDAFKLNLTRTEADIRIAMLTAKLKLLGEPPHTL* |
| Ga0070709_115263462 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LKRLAQDAYELDAFKLNLTRTEADIRIAMLTAKLKLIDEPPHTL* |
| Ga0070714_1014975622 | 3300005435 | Agricultural Soil | MTPEQAETLKRLARDAYELDAFKPNLKRTEADLRIAMLTAKLKLLDGPPHTL* |
| Ga0070711_1003701261 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ETLKRLARDAYELDAFKPNLKRTEADLRIAMLTAKLKLLDGPPHTL* |
| Ga0070663_1000602881 | 3300005455 | Corn Rhizosphere | MLKRLAQDAYELDAFKLNLTRTEADIRIAMLTAKLKLIDEPPHTL* |
| Ga0070663_1002772892 | 3300005455 | Corn Rhizosphere | MTAVQAATLKRLTHDAYELDAFKLNLTRAEADIRIAMLTAKLKLLGGPPHTL* |
| Ga0070684_1008799402 | 3300005535 | Corn Rhizosphere | AVQAATLKRIAHDAYELDAFKLNLTRAEADIRISILTAKLKLLGEPPHTL* |
| Ga0070732_107278762 | 3300005542 | Surface Soil | QAAMLKRLATAAYELDAYKPNLTSAEADLRIAALAAKLKLIGEPPHTL* |
| Ga0070665_1025308742 | 3300005548 | Switchgrass Rhizosphere | LDAFKPNLTRPEANKRIAMLTAKLKLLDGPPHTL* |
| Ga0068859_1021068582 | 3300005617 | Switchgrass Rhizosphere | SSGTDTYELDAFKSNLTPTEADIRIAMLTAKLKLLDEPPHTL* |
| Ga0066903_1003569416 | 3300005764 | Tropical Forest Soil | MTVVQAATLKRLAEAAYERDAFKPNLTREEADLRIAMLIAKLKLLDEPPHTL* |
| Ga0066903_1016826423 | 3300005764 | Tropical Forest Soil | MTVVQAATLMPVAEAAYELDAFKPNLTRAEADVRIAMLTAKLKLLGEPPHTL* |
| Ga0066903_1017684173 | 3300005764 | Tropical Forest Soil | LKRLAEAAYELEAFQPNLTRAEADLRISMLTDKLKLLDGPPHTL* |
| Ga0066903_1021367271 | 3300005764 | Tropical Forest Soil | EQAATLKRLAEAAYDHAAFKPNLTSDEADQRIATLTAKLKLLGEPPHTL* |
| Ga0066903_1021653273 | 3300005764 | Tropical Forest Soil | LQDLAESAYELEAFQPNLTCAEADLRTALLTAKFKLLDGPPHTL* |
| Ga0066903_1072783832 | 3300005764 | Tropical Forest Soil | AEAAYELEAFKPNLTRAEADVRIAMLTAKLKLLDGPPHTL* |
| Ga0066903_1089170501 | 3300005764 | Tropical Forest Soil | MTPEQAATLKRLAIAAYELDAFKMNLTRSEADLRIAALTAKLKLLDGPPHTL* |
| Ga0066903_1089716372 | 3300005764 | Tropical Forest Soil | AATLKRLAEAAYELEAFKPNLTRAEADVRIATLTAKLKLLDGPPHTL* |
| Ga0066903_1090952812 | 3300005764 | Tropical Forest Soil | AAYEREAFKPNLTRAEADVRIATLTAKLKLLGEPPHTL* |
| Ga0068860_1007340354 | 3300005843 | Switchgrass Rhizosphere | AATLKQLAQDAYELDAFKPNLTRPEADKRIAMLTAKLKLLDGPPHTL* |
| Ga0066795_100182592 | 3300005938 | Soil | QAATLKRLAQAAYELDAFKPNLTRTEADIRIAMLTAKLKLLDGPPHTL* |
| Ga0066795_101337481 | 3300005938 | Soil | AAQAATLKELAEAAYELDAFKPNLTRTEAEISIAMLAAKLKRLDGPPHTL* |
| Ga0066798_100300971 | 3300005980 | Soil | AYELDAFKPNLTRTEADIRIAMLTAKLKLLDGPPHTL* |
| Ga0066789_101793752 | 3300005994 | Soil | MTVEQTALLRQLALEANELDAFGCHLTQAEANIRIATLAAKLKLLDEPPHTL* |
| Ga0066790_101042932 | 3300005995 | Soil | MTVEQTALLRRLALEAYELDAFGCHLTQAEANIRIAALTAKLKLLDEPPHTL* |
| Ga0075028_1009804813 | 3300006050 | Watersheds | LAQDAYELDAFKPNLTRPEADKRIAMLTAKLKLLDGPPHTL* |
| Ga0075028_1010056292 | 3300006050 | Watersheds | TAAQAATLKRLAHDAYELDAFKLNLTRTEADIRIAMLTAKLKLLGEPPHTL* |
| Ga0097691_10038666 | 3300006055 | Arctic Peat Soil | MTVEQTALLKQLALEAYELDAFGCHLTQAEANIRIATLAAKLKLLDEPPHTL* |
| Ga0075017_1005836002 | 3300006059 | Watersheds | MTDTLLMTADPAATLKRLAEKAYELDAFKPNLTRTEADKRIATLTAKLALLDGPPHTL* |
| Ga0075019_103976153 | 3300006086 | Watersheds | LAEAAYERDAFKPNLTRGEADLRIAILAAKLKLLDGPPHTL* |
| Ga0075019_105624251 | 3300006086 | Watersheds | LDAFKRNLTRTEANRRIAMLTAKLKLLDEPPHTL* |
| Ga0075015_1003971062 | 3300006102 | Watersheds | PSANDTEQAEMLKRLAKAADELNLTRTEADIAALAAKLKLLGEPPHTL* |
| Ga0075015_1007693563 | 3300006102 | Watersheds | PEQAATLKELAKAAYELDAFKPNLRRAEAEVRIAMLTAKLKLLDGPPHTP* |
| Ga0075030_1008909941 | 3300006162 | Watersheds | EQAATLKRLAKAAYELDAFKPNLTRAEADLRIAALSAKLKLLDERAADR* |
| Ga0075018_104491361 | 3300006172 | Watersheds | LEAFQPNLTRAEADLRIAMLTAKLKLLDGPPHTL* |
| Ga0075014_1001777412 | 3300006174 | Watersheds | MFALARDCRQADTATQAATLKDLAFRPNLTCTEADIRIAMLTAKLKRLDGPPHTL* |
| Ga0070712_1012986801 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDTRPMTPEQAETLKRLARDAYELDAFMPNLKRTEADLRIAMLTAKLKLLDGPPHT |
| Ga0068871_1019355292 | 3300006358 | Miscanthus Rhizosphere | AQDAYELDAFKSNLTRTEADIRIAMLTAKLKLLGEPPHTL* |
| Ga0074056_111446382 | 3300006574 | Soil | SAPSLATAPLKELAKAACELDAFKPNLRRAEAEVRIAMLTAKLKLLDGPPHTL* |
| Ga0075425_1021323021 | 3300006854 | Populus Rhizosphere | MSDTRPMTPEQAETLKRLARDAYELDAFKPNLKRTEADLRIAMLTAKLKLLDGPPHTL* |
| Ga0075426_107122061 | 3300006903 | Populus Rhizosphere | YELDAFKPNLTRPEADKRIAMLTAKLKLLDGPPHTL* |
| Ga0075426_114918242 | 3300006903 | Populus Rhizosphere | ATLKRLAEAAYELDAFKPKLTRAEADLRIAMLTKLKLLAEPPHTL* |
| Ga0099795_105114891 | 3300007788 | Vadose Zone Soil | YELDAFKPNLTRTEADERIAMLTAKFKRLDGPPHTL* |
| Ga0066793_105109762 | 3300009029 | Prmafrost Soil | AAYELDAFKPNLTRTEADIRIAMLTAKLKLLDGPPHTL* |
| Ga0105247_105474562 | 3300009101 | Switchgrass Rhizosphere | DAYELDAFKPNLTRPEANKRIAMLTAKLKLLEGPPHTL* |
| Ga0105243_105106451 | 3300009148 | Miscanthus Rhizosphere | SSGTDTYELDAFKSNLTPTEADIRIAMLTAKLRLLDEPPHTL* |
| Ga0111538_108686262 | 3300009156 | Populus Rhizosphere | VQAAYELDAFKPNLTRPEADKRIAMLTAKLKLLDGPPHTL* |
| Ga0116221_12940232 | 3300009523 | Peatlands Soil | LDAFKPNLTRAEADLRIATLTAKLKLLDGPPHTL* |
| Ga0105238_104280381 | 3300009551 | Corn Rhizosphere | VAAYEHDAFSRRLTRADAARRIDMLKAKLTLLDEPPHTL* |
| Ga0116138_12376131 | 3300009552 | Peatland | ATLKNLAQDAFDLDAFKPNLTHAEADKRIAMLTAKLKLLDGPPHTL* |
| Ga0116114_10975862 | 3300009630 | Peatland | AYELDACGPRLTQAEAKRRIATLAAKLKLLDGPPHTL* |
| Ga0116115_11757231 | 3300009631 | Peatland | MTAEQAALLRQLALDAYELDACGPRLTQAEAKRRIATLAAKLKLLDGPPHTL* |
| Ga0116124_10439873 | 3300009634 | Peatland | TLKRLAKDAYELDAYKPNLTRAEADIRIAMLTAKLKLLDGPPHTL* |
| Ga0116126_12695681 | 3300009640 | Peatland | RLAKEAYELDAYKPNLTCAEADRRIATLTAKLRLLDGPPHTL* |
| Ga0116110_12352902 | 3300009643 | Peatland | AATLKRLAKDAYELDAFKPNLTRAEADKRIAMLTAKLKLLDGPPHTL* |
| Ga0105856_12030922 | 3300009662 | Permafrost Soil | MTADELMPAAKAATLKRLAQAAYELDAFKPNLTRTEADIRIAMLTAKLKLLDGPPHTL* |
| Ga0116223_102056921 | 3300009839 | Peatlands Soil | RLAKDAYELDAYKPNLTRAEADKRIAMLTAKLKLLDGPPHTL* |
| Ga0116223_108953482 | 3300009839 | Peatlands Soil | ATLKRLAKEAYELDAFKPNLTRAEAHIRIAMLTAKLKLLDGPPHTL* |
| Ga0126382_124712901 | 3300010047 | Tropical Forest Soil | RLGIAAYERDAFKPNLTPAEADLRIAALAAKLKLLGEPPHTL* |
| Ga0126373_104206514 | 3300010048 | Tropical Forest Soil | VQAATLMRVAEAAYELDAFKPNLTRAEAEVRIAMLTAKLKLLGEPPHTL* |
| Ga0126373_109724701 | 3300010048 | Tropical Forest Soil | MTVEQAAMPKGLAEAAYELDAFKPKLTRADADQRISMLTAKFKLPPHTL* |
| Ga0126373_113998412 | 3300010048 | Tropical Forest Soil | AEAAYEREAFKPNLTRAEADVRIATLTAKLKLLGEPPHTL* |
| Ga0126373_117960023 | 3300010048 | Tropical Forest Soil | MTVVQAATLMRVAEAAYELDAFKPNLTRAEAEVRIAMLTAKLKLLGEPPHTL* |
| Ga0126373_127628391 | 3300010048 | Tropical Forest Soil | PKGQRPFKPNLTHAEADVRIATLTAKLKLLGEPPHTL* |
| Ga0126373_128657971 | 3300010048 | Tropical Forest Soil | MTAGQSAALKRLANDAYELDAFKPNPTRTEADRRIAALAAKLKLLNGPPHTL* |
| Ga0126370_119396222 | 3300010358 | Tropical Forest Soil | QAAKLKRLAEDAYELDAFKSNLTSGEADLRIAMLTAKLKLLDEPPHTL* |
| Ga0126372_117123652 | 3300010360 | Tropical Forest Soil | MTVEQAATLKRLAEAAYELEAFQRNLTRGEADLRIAMLTAKLKLLDGPPH |
| Ga0126378_113794671 | 3300010361 | Tropical Forest Soil | AYELDAFKPNLTRAEADVRIAMLTAKLKLLGEPPHTL* |
| Ga0126378_115655683 | 3300010361 | Tropical Forest Soil | LRRRPRRSGAEAAYELEAFKPNLRRAEADLRIAALTAKLKLLDGPPHTL* |
| Ga0126378_118564451 | 3300010361 | Tropical Forest Soil | YELDAFKPNLTRAEADVRIAMLTAKLKLLDEPPHTL* |
| Ga0126378_123293042 | 3300010361 | Tropical Forest Soil | LEAFQPNLTRAEADLRIAMLTTKLKLLDGPPHTL* |
| Ga0126378_125494323 | 3300010361 | Tropical Forest Soil | ATLKRLAEAAYELEAFQPTLTRAEADLRIAMLTAKLKLLDGPPHTL* |
| Ga0126377_103211421 | 3300010362 | Tropical Forest Soil | ATLKRLAQDAYEPDAFKPNLTSAEADIRIAMLTAKLKLLGEPPHTL* |
| Ga0134125_102051464 | 3300010371 | Terrestrial Soil | TCLKALSIEAYEPDAFSEALTRAEAEQRIVTLSAKLPLLDGPPHTL* |
| Ga0134128_121210871 | 3300010373 | Terrestrial Soil | AAQAGTLKRLAQDTYELDAFKPNLTRAEAEKQIITLTAKLKLLGEPPHTL* |
| Ga0126381_1007734753 | 3300010376 | Tropical Forest Soil | MTAEQAATLKRLAQAAYELEAFQPNLTPPEADLRIAMLTAKLKLLGEPPHTL* |
| Ga0126381_1010285991 | 3300010376 | Tropical Forest Soil | MTAEQAVTLKRLAEAAYELDAFKPNLTRDEADLRIAMLTAKLKLLDGPPHTL* |
| Ga0126381_1013608141 | 3300010376 | Tropical Forest Soil | QAATLKRLAEAAYEREAFKPNLTCAEADVRIAMLTAKLKLLDEPPHTL* |
| Ga0126381_1029317491 | 3300010376 | Tropical Forest Soil | ATLKRLAQDAYEPDAFKPNLTRAEADIRIAMLTAKLKLLGEPPHTL* |
| Ga0126381_1029992061 | 3300010376 | Tropical Forest Soil | AVTLKRLAEAAYELDAFKPNLTRAEADVRIAMLTAKLKLLDGPPHTL* |
| Ga0126381_1031255561 | 3300010376 | Tropical Forest Soil | YELDAFKPNLARAEADLRIATLAAKLKLLDGPPHTL* |
| Ga0126381_1041274341 | 3300010376 | Tropical Forest Soil | AEQAVTLKRLAEAAYELDAFKPNLTRAEADVRIAMLTAKLKLLDEPPHTL* |
| Ga0126381_1046491491 | 3300010376 | Tropical Forest Soil | TLKRLAEAAYDHAAFKPNLTSDEADQRIPTLTAKLKLLGEPPHTL* |
| Ga0136449_10010210513 | 3300010379 | Peatlands Soil | AYELDAFKPNLRCAEADIRIAMLKAKLKLLDGPPHTL* |
| Ga0134126_110464401 | 3300010396 | Terrestrial Soil | ATLKRLAQDAYELDAFKSNLTRTEADIRIAMLTAKLKLLGEPPHTL* |
| Ga0134124_108020782 | 3300010397 | Terrestrial Soil | HDAYELDAFKLNLTRAEADIRISILTAKLKLLGEPPHTL* |
| Ga0126383_124293811 | 3300010398 | Tropical Forest Soil | AEQAATLKRLAEAAYELDAFKPNLTHDEADLRIAMLTAKLKLLGGPPHTL* |
| Ga0126383_135851411 | 3300010398 | Tropical Forest Soil | MTAEQAATLKRLAEAAYELDAFKPNLTHDEADLRIAMSTANLKLLDEPPHTL* |
| Ga0120134_10851171 | 3300012004 | Permafrost | TLKKLAEAAYELDAFKPKLTRTEAEIRIAMLTAKLKLLDEPPHTL* |
| Ga0137370_110508291 | 3300012285 | Vadose Zone Soil | ELDAFKPNLTRAEADTRIAMLTAKLKLLDGPPHTL* |
| Ga0157297_100800521 | 3300012914 | Soil | MTADGLMTTAQAATLKRLTLVTYELDAFKSNLTPTEADIRIAMLTAKLRLLDEPPHTL* |
| Ga0164302_105570331 | 3300012961 | Soil | LDAFKPNLTRTEADIRIAMLTAKLKLLGEPPHTL* |
| Ga0126369_105569892 | 3300012971 | Tropical Forest Soil | MTVVQAATLMRVAEAAYELVAFKPNLTRAEAEVRIAMLSAKLKLLGEPPHTL* |
| Ga0164308_108078141 | 3300012985 | Soil | LKTLAKDAYELDAFKPNLTRPEADKRIAMLTAKLKLLDGPPHTL* |
| Ga0164307_104493301 | 3300012987 | Soil | LDAFKSNLTRTEADIRIAMLTAKLKLLGEPPHTL* |
| Ga0164306_101385351 | 3300012988 | Soil | ATLKRLAQDAYELDAFNPNLTRTEADIRIAMLTAKLKLIDEPPHTL* |
| Ga0157374_112037461 | 3300013296 | Miscanthus Rhizosphere | LKRLAQDTYELDAFKPNLTRAEAEKRIITLTAKLKLLGEPPHTL* |
| Ga0157375_126143302 | 3300013308 | Miscanthus Rhizosphere | LKRLAQDAYELDAFKPNLRRTEADIRIAMLTAKLKLLGEPPHTL* |
| Ga0181518_100687231 | 3300014156 | Bog | ATLKRLAKDAYELDAYKPNLTRAEADKRIAMLTAKLKLLDGPPHTL* |
| Ga0181538_104335941 | 3300014162 | Bog | YELDAFKPNLTRAEADRRIAMLTAKLKLLDGPPHTL* |
| Ga0182015_100431261 | 3300014495 | Palsa | EQAATLKRLAKEAYELEAFKPNLTRTEADQRIAMLTAKLKLLDGPPHTL* |
| Ga0182015_105330603 | 3300014495 | Palsa | AATLRRLAEAAYELDAFKPKLSRAEADRRIATLSAKLKLLDGPPHTL* |
| Ga0157376_121436761 | 3300014969 | Miscanthus Rhizosphere | ATLKQLAQDAYELDAFKPNLTRPEANKRIAMLTAKLKLLEGPPHTL* |
| Ga0132258_107451772 | 3300015371 | Arabidopsis Rhizosphere | MTAEQVVALKRLTQAAYELDAFKPNLTGIEAGIRIAMLTAKLKLLDEPPHTL* |
| Ga0132258_133755931 | 3300015371 | Arabidopsis Rhizosphere | TLKRLARDAYELDAFKPNLKRTEADIRIAMLTAKLKLLDGPPHTL* |
| Ga0132257_1008506743 | 3300015373 | Arabidopsis Rhizosphere | KQLAQDAYELDAFKPNLTRPEADKRIAMLTAKLKLLDGPPHTL* |
| Ga0132257_1031991361 | 3300015373 | Arabidopsis Rhizosphere | MTAEQAATLKRLARDAYELDAFKPNLKRTEADIRIAMLTAKLKLLDGPPHTL* |
| Ga0182036_100010861 | 3300016270 | Soil | MPRRFQPEQAATLKRLAEAAYELEAFQRNLTRGEADLRIAMLTAKLKLLDGPPH |
| Ga0182036_100591755 | 3300016270 | Soil | RLAEAAYELEAFQRNLTRGEADLRIAMLTAKLKLLDGPPHTL |
| Ga0182036_101070671 | 3300016270 | Soil | RRLAEAAYELEAFKPNLTRADADLRIAALTAKLKLLDGPPHTL |
| Ga0182041_114474481 | 3300016294 | Soil | LKRLAEAAYELEAFKPNLTCAEADLRIAALTAKLKLLDGPPHTL |
| Ga0182033_112044641 | 3300016319 | Soil | TLKRLAEAAYEREAFKPNLTRAEADVRIATLTAKLKLLGEPPHTL |
| Ga0182033_114063771 | 3300016319 | Soil | MTPEQAATLKLLAQAAYELDAFKTNLKRSEADLRIAALTAKLKLLDGPPHTL |
| Ga0182033_118997061 | 3300016319 | Soil | EQAAKLKRLAEAAYELEAFQPNLTRAEADLRISMLTAKLKLLDGPPHTL |
| Ga0182035_102628801 | 3300016341 | Soil | LKRLAQDTYELDAFKPNLTRAEAEKRIITLTAKLKLLGEPPHTL |
| Ga0182035_104765762 | 3300016341 | Soil | MTPEQAATLKRLAQAAYELDAFKTNLKRSEADLRIAALTAKLKLLDGPPHTL |
| Ga0182035_106847803 | 3300016341 | Soil | EQAAILKRLAEAAYELETFQPNLTRAEADLRIAMLTAKLKLLDGPPHTL |
| Ga0182035_114115001 | 3300016341 | Soil | MLKGLAKAAYELDAFKPKLTRAGADQRIAMLTAKLKLPPHTL |
| Ga0182035_117286961 | 3300016341 | Soil | MTAEQAATLKRLAEAGYELDALKPNLTREEADLRIAMLSAKLKLLG |
| Ga0182035_117997022 | 3300016341 | Soil | YELEAFQPNLTRAEADLRISMLTAKLKLLDGPPHTL |
| Ga0182032_101555751 | 3300016357 | Soil | KSLRRLAEAAYELEAFKPNLRRAEADLRIAALTAKLKLLDGPPHTL |
| Ga0182032_105651161 | 3300016357 | Soil | TLMRVAEAAYELDAFKPNLTRAEADVRIAMLTAKLKLLGEPPHTL |
| Ga0182032_109357111 | 3300016357 | Soil | AAYELDAFKPNLTRAEADLRIATLAAKLKLLDGPPHTL |
| Ga0182034_101606464 | 3300016371 | Soil | LAEAAYELEAFQPNLTRAEADLRIAMLTAKLRLLDGPPHTL |
| Ga0182034_104009333 | 3300016371 | Soil | RLAEAAYELEAFKPNLTRADADLRIAALTAKLKLLDGPPHTL |
| Ga0182034_104452711 | 3300016371 | Soil | QLATAAYEHDAFKSNLTQAEADRRIAALSAKVKLLDGPPHTL |
| Ga0182034_107934791 | 3300016371 | Soil | TLKRLAEAAYELEAFKPNLTRADADLRIAALTAKLKLLDGPPHTL |
| Ga0182034_111252432 | 3300016371 | Soil | ATLKRLAEAAYELDAFKPNLTRAEANLRIAMLTAKLKLLDGPPHTL |
| Ga0182040_110247601 | 3300016387 | Soil | EAAYELEAFQPNLTRAEADLRILMLTAKLKLLDGPPHTL |
| Ga0182040_114670361 | 3300016387 | Soil | LAEAAYELDAFKPNLTRAEADMRIAMLTAKLKLLG |
| Ga0182040_117129151 | 3300016387 | Soil | VSPQAAILTAEQVATLKRLAKAAYELDAFKPNLTRAEADLRIAALAAKLKLLGEPPHTL |
| Ga0182037_100680015 | 3300016404 | Soil | AEAAYELEAFQRNLTRGEADLRIAMLTAKLKLLDGPPHTL |
| Ga0182037_110347801 | 3300016404 | Soil | AATLKRLAQAAYELDAFKPNLRRSEADLRIATLSAKPRLLDGPPHTL |
| Ga0182038_100189576 | 3300016445 | Soil | VPPPINKRSHSIAKMTVEPAAMLKGLAEAAYELDAFKPKLTRAGADQRIAMLTAKLKLPPHTL |
| Ga0182038_106940461 | 3300016445 | Soil | AAYELDAFKPNLTRAEAQLRITALTAKLKLLDEPPHTL |
| Ga0163161_101953003 | 3300017792 | Switchgrass Rhizosphere | AQAATLKRLAQDAYELDAFKLNLTRTEADIRIAMLTAKLKLIDEPPHTL |
| Ga0187802_100061697 | 3300017822 | Freshwater Sediment | RLAEAAYERDAFKPNLTRGEADLRIAILAAKLKLLDGPPHTL |
| Ga0187802_101907942 | 3300017822 | Freshwater Sediment | RLAEAAYERDAFKPNLTRGEADLRIAILAAKLKLLDGPPHMIAPAATAIR |
| Ga0187802_103053571 | 3300017822 | Freshwater Sediment | MTVVQAATLKRLAEAAYELDAIRPNLTRDEADARIAMLTAKLKLLDDPPHTL |
| Ga0187877_10742583 | 3300017931 | Peatland | AKDAYELDAYKPNLTRAEADKRIAMLTAKLKLLDGPPHTL |
| Ga0187877_13319542 | 3300017931 | Peatland | AYELDACGPRLTQAEAKRRIATLAAKLKLLDGPPHTL |
| Ga0187814_101788621 | 3300017932 | Freshwater Sediment | LAEAAYERDAFKPNLTRGEADLRIAILAAKLKLLDGPPHTL |
| Ga0187821_101046444 | 3300017936 | Freshwater Sediment | PMTDNRPMLAEQVETLKKLAEAAYELDAFSPNLTRTEANIRIAMLTAKLKLLDGPPHTL |
| Ga0187879_103947842 | 3300017946 | Peatland | LKRLAKEAYELDAFKPNLTRAEAHIRIAILTAKLKLDGPPHTL |
| Ga0187879_107089671 | 3300017946 | Peatland | ATLKRLAKDAYELDAYKPNLTRAEADKRIAMLTAKLKLLDGPPHTL |
| Ga0187879_107451202 | 3300017946 | Peatland | RLAKDAYELDAYKPNLTRAEADKRIAMLTAKLKLLDGPPHTL |
| Ga0187776_115551472 | 3300017966 | Tropical Peatland | LKRLARDAYELDAFKPNLTRAEADIRIAMLTAKLKLLDGPPHTL |
| Ga0187783_110655902 | 3300017970 | Tropical Peatland | AAYELDAFKPNLTRAEADLRIATLTAKLKLLDGHTL |
| Ga0187815_105277442 | 3300018001 | Freshwater Sediment | ATLTEGADAYELDAFKPNLTRAEADIRIATLTAKLRLLDAPPHTL |
| Ga0187876_12016451 | 3300018003 | Peatland | LKRLAKEAYELDAFKPNLTRAEARIRIAMLTAKLKLLDGPPHTL |
| Ga0187878_12578241 | 3300018005 | Peatland | LLRQLALDAYELDACGPRLTQAEAKRRIATLAAKLKLLDGPPHTL |
| Ga0187805_100643681 | 3300018007 | Freshwater Sediment | LAEAAYELDAFKPNLTRAEADLRIATLTAKLKLLDGPPHTL |
| Ga0187881_102087862 | 3300018024 | Peatland | MLKRLAKEAYELDAFKPNLTRAEAHIRIAILTAKLKLDGPPHTL |
| Ga0187890_105888861 | 3300018044 | Peatland | ALLRQLALDAYELDACGPRLTQAEAKRRIATLAAKLKLLDGPPHTL |
| Ga0187890_106772241 | 3300018044 | Peatland | KRLAKDAYELDAYKPNLTRAEADKRIAMLTAKLKLLDGPPHTL |
| Ga0187859_101862334 | 3300018047 | Peatland | YELDAYKPNLTRAEADKRIAMLTAKLKLLDGPPHTL |
| Ga0187765_106034072 | 3300018060 | Tropical Peatland | LPAQQAVTLNQLAKAADELEAFKPNLTRAEADLRIGALTAKLKLLDGPPHTL |
| Ga0187784_105256034 | 3300018062 | Tropical Peatland | AATLRRLAEAAYELEAFKPNLPRAEADLRIAALTAKLKLLDGPPHTL |
| Ga0184625_106641122 | 3300018081 | Groundwater Sediment | DAYELDAFKPNLTRPEADKRIAMLTAKLKLLDGPPHTL |
| Ga0066662_123557711 | 3300018468 | Grasslands Soil | SSKPGTLKVLAEAAHEIDRLQTKLTRAEADQRIAMLTAKIKLRDEPPHTL |
| Ga0193722_11349382 | 3300019877 | Soil | DLRTTPTELDAFKLNLTRTEADIRIAMLTAELKLLGEPPHTL |
| Ga0193723_10881031 | 3300019879 | Soil | RLAHDAYELDAFKLNLTRTEADIRIAMLTAKLKLLGEPPHTL |
| Ga0193718_11125101 | 3300019999 | Soil | KRLAHDAYELDAFKLNLTRTEADIRIAMLTAKLKLLGEPPHTL |
| Ga0210401_102242281 | 3300020583 | Soil | TPEQAATLKQLAKVAYELDAFKPNLRCAEADIRIAMLKAKLKLLDGPPHTL |
| Ga0210401_103180523 | 3300020583 | Soil | LAKAAYELDAFKPNLTRAEADIRIAMLKAKLKLLDGPPHTL |
| Ga0210405_100636481 | 3300021171 | Soil | MEVVLDAFKPNLRCAEADIRIAMLKAKLKLLDGPPHTL |
| Ga0210408_107115901 | 3300021178 | Soil | ELDAFKPTLTRAEADIRIAMLKAKLKLLDGPQGPNC |
| Ga0210388_116959362 | 3300021181 | Soil | LAQATYELDAFKPNLTRAEEDLRIAALAAKLKLLGGPPNTL |
| Ga0210397_101071706 | 3300021403 | Soil | ENAGLDAFKPNLRCAEADIRIAMLKAKLKLLDGPPHTL |
| Ga0210397_104349673 | 3300021403 | Soil | AAYELDAFKPNLRRAEADIRIAMLKAKLKLLDGPPHTL |
| Ga0210387_111659831 | 3300021405 | Soil | AEAAYELDAFKPNLTRGEADLRIAILAAKLKLLDGPPHTL |
| Ga0210394_105991181 | 3300021420 | Soil | YELDAFKPNLRCAEVDIRIAMLKAKLKLLDGPPHTL |
| Ga0126371_101896812 | 3300021560 | Tropical Forest Soil | MTVVQAATLKRLAEAAYERDAFKPNLTREEADLRIAMLIAKLKLLDEPPHTL |
| Ga0126371_107877151 | 3300021560 | Tropical Forest Soil | TLKRLAQDAYEPDAFKPNLTSAEADIRIAMLTAKLKLLGEPPHTL |
| Ga0126371_108113432 | 3300021560 | Tropical Forest Soil | MTVVQAATLKRVAEAAYELDAFKPNLTRDEADVRIAMLTAKLKLLGEPPHTL |
| Ga0126371_111313163 | 3300021560 | Tropical Forest Soil | MTAEQAATLKRLAEAAYELDAFQRNLTRAEADVRTAILTAKLKLLGEPPHTL |
| Ga0126371_114950841 | 3300021560 | Tropical Forest Soil | TLKRLAEAAYDHAAFKPNLTSDEADQRIATLTAKLKLLGEPPHTL |
| Ga0126371_115913941 | 3300021560 | Tropical Forest Soil | MRVAEAAYELDAFKPNLTRAEAEVRIAMLTAKLKLLGEPPHTL |
| Ga0126371_118278991 | 3300021560 | Tropical Forest Soil | MTPEQAATLKRLAIAAYELDAFKMNLTRCEADLRIAALTAKLKLLDGPPHTL |
| Ga0126371_131258232 | 3300021560 | Tropical Forest Soil | ELDAFKPNLTRAEADLRIAALAAKLKLLGEPPHTL |
| Ga0222622_104908561 | 3300022756 | Groundwater Sediment | MTVAQAATLKKVAQAAYALDAFKPNLTRPEADKRIAMLTAKLKQLDGPPHTL |
| Ga0208850_10081394 | 3300025457 | Arctic Peat Soil | MTVEQTALLRQLALEAYELDAFGCHLTQAEANIRIATLAAKLKLLDEPPHTL |
| Ga0208192_10183131 | 3300025477 | Peatland | LAKDAYELDAYKPNLTRAEADIRIAMLTAKLKLLDGPPHTL |
| Ga0208079_10013415 | 3300025481 | Arctic Peat Soil | MTVEQTALLKQLALEAYELDAFGCHLTQAEANIRIATLAAKLKLLDEPPHTL |
| Ga0208188_11286741 | 3300025507 | Peatland | EAYELDAFKPNLTRAEADKRIAMLTAKLKLLDGPPHTL |
| Ga0208848_10061261 | 3300025509 | Arctic Peat Soil | VAAYELDAFKPNLTRTEADIRIAMLTAKLKLLDGPPHTL |
| Ga0207927_10588691 | 3300025579 | Arctic Peat Soil | VAYELDAFKPNLTRTDADIRIAMLTAKLKLLDGPPHTL |
| Ga0207930_10577471 | 3300025604 | Arctic Peat Soil | MTVEQTVLLRQLALEAYELDAFGCHLTQAEVNIRIATLAAKLKLLDEPPHTL |
| Ga0208480_11317571 | 3300025633 | Arctic Peat Soil | KTLASRAYELDAFKPGITRAEAQRRIATLSAKIRLLDAPPHTL |
| Ga0208849_10257401 | 3300025664 | Arctic Peat Soil | DAYEPDAFKEALSQAEAERRIAMLTAKLRLLDSPPHTL |
| Ga0209176_100373822 | 3300025854 | Arctic Peat Soil | MTAEQTTQLRQLALDAYELDAFGAHLTQAEARRRIATLAAKLKLLDEPPHTL |
| Ga0207699_111770121 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | QDTYELDAFKPNLTRAEAEKRIITLTAKLKLLGEPPHTL |
| Ga0207693_103419603 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDTRPMTPEQAETLKRLARDAYELDAFMPNLKRTEADLRIAMLTAKLKLLDGPPHTL |
| Ga0207663_100757173 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKRLAQDAYELDAFKLNLTRTEADIRIAMLTAKLKLIDEPPHTL |
| Ga0207700_104890071 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AQAAMLKRLAQDAYELDAFKLNLTRTEADIRIAMLTAKLKLIDEPPHTL |
| Ga0207701_101523663 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MTADGLMTTAQAATLKRLALVTYELDASKPNLTPTEADIRIAMLTAKLKLLDEPPHTL |
| Ga0207706_104472651 | 3300025933 | Corn Rhizosphere | AYELDAFKPNLTRPEADKRIAMLTAKLKLLDGPPHTL |
| Ga0207665_116470971 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQDAYELDAFKPNLTRTEADIRIAMLTAKLKLLGEPPHTL |
| Ga0207676_110608071 | 3300026095 | Switchgrass Rhizosphere | DTYELDAFKPNLTRAEAEKRIITLTAKLKLLGEPPHTL |
| Ga0209862_10780561 | 3300026222 | Permafrost Soil | MTVEQTALLRRLALEAYELDAFGCHLTQAEANIRIAALTAKLKLLDEPPHTL |
| Ga0209888_10212723 | 3300026274 | Permafrost Soil | ELDAFKPNLTRTEADIRIAMLTAKLKLLDGPPHTL |
| Ga0209647_11808182 | 3300026319 | Grasslands Soil | LAQAAYELEAFKPNLTRTEADKRIAMLTAKLKLLDGPPHTL |
| Ga0257160_10660771 | 3300026489 | Soil | AQAAYELEAFKPNLTRTEADKRIAVLTAKLKLLDGPPHTL |
| Ga0207787_10025043 | 3300026908 | Tropical Forest Soil | AEAAYELDAFKPNLTRTEAEIQIATLTAKLKLLDEPPYTL |
| Ga0208603_10682311 | 3300027109 | Forest Soil | LAEAAYELDAFKPNLTRGEADLRIAILAAKLKLLDGPPHTL |
| Ga0209854_10815402 | 3300027384 | Groundwater Sand | ALSEQAYEPDAFHPKLTRAEADLRIETLSAKLRLQDGPPHTL |
| Ga0209904_10194972 | 3300027394 | Thawing Permafrost | MPAAQAATLKRLAQAAYELDAFKPNLTRTEADIRIAMLTAKLKLLDGPPHTL |
| Ga0208637_10222631 | 3300027401 | Soil | MTAEQVVALKRLTQAAYELDAFKPNLTGIEAGIRIAMLTAKLKLLDEPPHTL |
| Ga0207981_10689431 | 3300027560 | Soil | ELDAFKPNLTGIEAGIRIAMLTAKLKLLDEPPHTL |
| Ga0209117_10476281 | 3300027645 | Forest Soil | ELDAFKPNLTRAEADTRIAMLTAKLKLLDGPPHTL |
| Ga0207826_10318581 | 3300027680 | Tropical Forest Soil | ATLKRLAQAAYQLEAFQPNLTRAEADLRISMLTAKLKLLDGPPHTL |
| Ga0207862_12595801 | 3300027703 | Tropical Forest Soil | ELDAFKPNLTQDEADLRIAMLTAKLKLLDEPPHTL |
| Ga0209517_105740452 | 3300027854 | Peatlands Soil | AQEAYELDAFKPNLTRAEADKRIAMLTAKLKLLDGPPHTL |
| Ga0209465_104920721 | 3300027874 | Tropical Forest Soil | EREAFKPNLTHAEADQRIATLTAKLKLLGDPPHTL |
| Ga0209068_105444472 | 3300027894 | Watersheds | EQAEMLKRLAKAAYELDAFKPNLTRAEADRRIAALAAKLKLLGEPPHTL |
| Ga0209067_104605561 | 3300027898 | Watersheds | YELDAFKRNLTRTEANRRIAMLTAKLKLLDEPPHTL |
| Ga0209698_102434283 | 3300027911 | Watersheds | MTAEQAATLKRSAQAAYELDAFKPNLTRAEADLRIAMLTAKLKLLDEPPH |
| Ga0209069_103114651 | 3300027915 | Watersheds | KRLAKEAYELDAYKPNLTRAEADMRIAMLTAKLKLLDGPPHTL |
| Ga0265353_10342302 | 3300028015 | Soil | TLKRLAKEAYELDAYKPNLTCAEADRRIATLTAKLRLLDGPPHTL |
| Ga0307293_102770142 | 3300028711 | Soil | MTVAQAATLKKVAQAAYALDAFKPNLTRPEADKRIAMLTAKLKLLDGPPHTL |
| Ga0307299_103069551 | 3300028793 | Soil | ELDAFKPNLTRPEADKRIAMLTAKLKLLDGPPHTL |
| Ga0307302_100870591 | 3300028814 | Soil | LKKVAQAAYELDAFKPNLTRPEADKRIAMLTAKLKLLDGPPHTL |
| Ga0311340_109420701 | 3300029943 | Palsa | LAYELEAFKPGLTSAEADRRIAALTAKLKQLDGPPHTQ |
| Ga0265760_101837471 | 3300031090 | Soil | MQRAPDDVQLMSAEQAATLKRLATAAYELDAYKPNLTRAEADLRIAALAAKLKLLGGPPHTL |
| Ga0170824_10394071310 | 3300031231 | Forest Soil | AEQAATLKRLAEAAYELEAFQPSLTRAEADLRISILAAKLKLLDGPPHTL |
| Ga0307442_10345513 | 3300031274 | Salt Marsh | LAEAAFELDAFKPNLTRPEAEIRIATLRAKLKLLDGPPHTL |
| Ga0170820_161512361 | 3300031446 | Forest Soil | LKRLAQDAYELDAFKLNLTGTEADIRIAMLTAKLKLLGEPPHTL |
| Ga0170818_1052888941 | 3300031474 | Forest Soil | QAATLKRLAQDAYELDAFKPNLSRTEADIRIAMLTAKLKLLGEPPHTL |
| Ga0318538_105764501 | 3300031546 | Soil | AATLKRLAQDAYEPDAFKPNLTSAEADIRIAMLTAKLKLLGEPPHTL |
| Ga0318528_100015372 | 3300031561 | Soil | MLKGLAEAAYELDAFKPKLTRAGADQRIAMLTAKLKLPPHTL |
| Ga0318573_103182721 | 3300031564 | Soil | AEQAATLKRLAEAAYELDAYKPNLTSAEADLRIAMLTAKLKLLDAPPHTL |
| Ga0310915_101157461 | 3300031573 | Soil | QAETLKRLAEAAYEREAFKPNLTRAEADVRIAMLTAKLKLLGEPPHTL |
| Ga0310915_101367171 | 3300031573 | Soil | AAYELDAFKPNLTHDEADLRIAMLTAKLKLLDEPPHTL |
| Ga0310915_102969793 | 3300031573 | Soil | RLAQTAYEQEAFRPNLTHAEVDLRIAMLTAKLKLLGEPPHTL |
| Ga0310915_104054851 | 3300031573 | Soil | AYEREAFKPNVTCAEADVRIAMLTAKLKLLGEPPHTL |
| Ga0310915_106999801 | 3300031573 | Soil | MTADQAATPKRLAEAAYEREAFKPNLTRAEADVRTATLTAKLKLLGGPPHTL |
| Ga0318542_102956532 | 3300031668 | Soil | MIDAFKPNLTREEADLRIAMLSAKLKLLGEPPHTL |
| Ga0318542_103537511 | 3300031668 | Soil | MPRRFQPEQAATLKRLAEAAYELEAFQRNLTRGEADLRIAMLTAKLKLL |
| Ga0318574_102091922 | 3300031680 | Soil | LAEAAYEREAFKPNLTRAEADVRIAMLTAKLKLLGEPPHTL |
| Ga0318572_102867001 | 3300031681 | Soil | QAETLKRLAEAAYEREAFKPNFTRAEADVPIAMLTAKLKLLGEPPHTL |
| Ga0318560_100256513 | 3300031682 | Soil | MLKGLAEAAYELDAFKPKLTRADADQRISMLTAKFKLPPHTL |
| Ga0318560_103622124 | 3300031682 | Soil | QAATPKRLAEAAYEREAFKPNLTRAEADVRTATLTAKLKLLGGPPHTL |
| Ga0315535_10235351 | 3300031699 | Salt Marsh Sediment | ATLKELAEAAFELDAFKPNLTRPEAEIRIATLMAKLKLLDGPPHTL |
| Ga0310686_1071449432 | 3300031708 | Soil | TAEQAATLKRLATAAYELDAYKPNLTRAEADLRIAALAAKLKLLGEPPHTL |
| Ga0310686_1086459142 | 3300031708 | Soil | YELDAFKPNLTRAEADLRIAVLTAKLKLLDGPPHTL |
| Ga0306917_104661671 | 3300031719 | Soil | AEQAETLKRLAEAAYEREAFKPNVTCAEADVRIAMLTAKLKLLGEPPHTL |
| Ga0306917_105624771 | 3300031719 | Soil | GTLKRLAQDTYELDAFKPNLTRAEAEKRIITLTAKLKLLGEPPHTL |
| Ga0306917_110472291 | 3300031719 | Soil | AEAAYELETFQPNLTRAEADLRIAMLTAKLKLLDGPPHTL |
| Ga0306917_113253571 | 3300031719 | Soil | MLKRLAEAAYELEAFQPNLTRAEADLRIAMLTAKLKLLDGPPHTL |
| Ga0306918_102382573 | 3300031744 | Soil | AETLKRLAEAAYEREAFKPNLTRAEADVRITMLTAKLKLLGEPPHTL |
| Ga0306918_103597413 | 3300031744 | Soil | EQAATLKRLAEAAYEREAFKPNVTCAEADVRIAMLTAKLKLLGEPPHTL |
| Ga0306918_106175802 | 3300031744 | Soil | AEAAYELDAFKPNLTHDEADLRIAMLTAKLKLLDEPPHTL |
| Ga0306918_114387451 | 3300031744 | Soil | ADQAATLKRLAEAAYERETFKPNLTRGEADVRIATLTAKLKLLAEPPHTL |
| Ga0318546_101100412 | 3300031771 | Soil | AAYELEAFQPNLTRAEADLRIAMLTAKLKLLDGPPHTL |
| Ga0318546_108928372 | 3300031771 | Soil | SRLETLKRLAEAAYEREAFKPNLTRAEADVRIAMLTAKLKLLGEPPHTL |
| Ga0318543_104758972 | 3300031777 | Soil | QAETLKRLAEAAYEREAFKPNLTRAEADVRIATLTAKLKLLGEPPHTL |
| Ga0318552_100267812 | 3300031782 | Soil | MPRRFQPEQAATLKRLAEAAYELEAFQRNLTRGEADLRIAMLTAKLKLLDGPPHTL |
| Ga0318529_101721491 | 3300031792 | Soil | MTVEQAATLKRLAEAAYELEAFQRNLTRGEADLRIAMLTAKLKLLDGPPHTL |
| Ga0318568_105440912 | 3300031819 | Soil | AYEQEAFRPNLTHAEVDLRIAMLTAKLKLLGEPPHTL |
| Ga0310917_100535951 | 3300031833 | Soil | EQAATLKRLAEAAYELEAFQRNLTRGEADLRIAMLTAKLKLLDGPPHTL |
| Ga0318511_102798093 | 3300031845 | Soil | YELDAFKPNLTRAEADVRITMLTAKLKLLDEPPHTL |
| Ga0318512_107106961 | 3300031846 | Soil | GLAEAAYELDAFKPKLTRAGADQRIAMLTAKLKLPPHTL |
| Ga0306919_100963623 | 3300031879 | Soil | ATYELDAFKSNLTRTEADKRIAMLTAKLKLLDEPPHTI |
| Ga0306919_103883631 | 3300031879 | Soil | AAYEREAFKPNFTRAEADVPIAMLTAKLKLLGEPPHTL |
| Ga0318544_100772514 | 3300031880 | Soil | LAEAAYEREAFKPNLTRAEADVRIATLTAKLKLLGEPPHTL |
| Ga0306925_110696732 | 3300031890 | Soil | MTIVQAATLMRVAEAAYELDAFKPNLTRAEADVRIAMLTAKLKLLGEPPHTL |
| Ga0306925_114983931 | 3300031890 | Soil | RLAQAAYELDAFKTNLKRSEADLRIAALTAKLKLLDGPPHTL |
| Ga0306925_116113641 | 3300031890 | Soil | AATLKRLAQAAYELDAFKPNLRRSEADLRIATLSAKLRLLDGPPHTL |
| Ga0318520_107061802 | 3300031897 | Soil | ATLKRLAEAAYELDAFKPNLTRAEADVRITMLTAKLKLLDEPPHTL |
| Ga0306923_102962991 | 3300031910 | Soil | TLKRLAEAAYEREAFKPNLTRAEADVRIAMLTAKLKLLGEPPHTL |
| Ga0306923_111553201 | 3300031910 | Soil | AETLKRLAEAAYEREAFKPNLTRAEADQRIATLTAKLKLLGEPPHTL |
| Ga0306923_112539622 | 3300031910 | Soil | AEQTATLKRLAEAAYELDAFKPKLTRAEANLRIAMLTAKLKLLDGPPHTL |
| Ga0306923_118093591 | 3300031910 | Soil | EAFKPNLTRAEADVRITMLTAKLKLLGEPPHTTENS |
| Ga0306923_118406312 | 3300031910 | Soil | YELDAFKPNLTRAEANLRIAALAAKLKLLGEPPHTL |
| Ga0306921_101909331 | 3300031912 | Soil | ELEAFQRNLTRGEADLRIAMLTAKLKLLDGPPHTL |
| Ga0306921_103041521 | 3300031912 | Soil | RVFGSDTFQPNLTRAEADLRIAMLTAKLRLLDEPPHTL |
| Ga0306921_106143714 | 3300031912 | Soil | AYEHDAFKPNLTRAEANLRIAMLTAKLKLLDEPPHTL |
| Ga0306921_117127041 | 3300031912 | Soil | AAYERDAFKPNLTRAEADVRIATLTAKLKLLGEPPHTL |
| Ga0306921_118098081 | 3300031912 | Soil | LKRLAEAAYEREAFKPNLTRTEADVRIATLTAKLKLLGEPPHTL |
| Ga0306921_120514571 | 3300031912 | Soil | KRLAEAAYELEAFQPNLTRAEADLRIAMLTAKLRLLDEPPHTL |
| Ga0306921_122669793 | 3300031912 | Soil | YELDAFKPNLTRAEADVRIAMLTAKLKLLAEPPHTL |
| Ga0306921_123653512 | 3300031912 | Soil | AYELDAFKPNLTRAEADVRIAMLTAKLKLLGEPPHTL |
| Ga0310912_101235492 | 3300031941 | Soil | AEQAARLKRLAEAAYDHAAFKPNLTSDEADQRIATLEPPHTL |
| Ga0310912_105452782 | 3300031941 | Soil | RLAEAAYELETFQPNLTRAEADLRIAMLTAKLKLLDGPPHTL |
| Ga0310912_110448312 | 3300031941 | Soil | AAYELEAFQPNLTRAEADLRIAMLTAKLRLLDEPPHTL |
| Ga0310912_112965983 | 3300031941 | Soil | ATLKRLAEAAYEREAFKPNLTRVEADVRTATLTAKLKLLGGPPHTL |
| Ga0310916_102234051 | 3300031942 | Soil | MRLAKAAYELDAFKPHLTRAEADVRIAMLTAKLKRLDEPPHTL |
| Ga0310916_102566494 | 3300031942 | Soil | YELETFQPNLTRAEADLRIAMLTAKLKLLDGPPHTL |
| Ga0310916_107328583 | 3300031942 | Soil | EAAYELDAFKPNLTHDEADLRIAMLTAKLKLLDEPPHTL |
| Ga0310913_110673771 | 3300031945 | Soil | RLAEAAYELDAFKPNLTSAEADVRIAMLTAKLKLLGEPPHTL |
| Ga0310910_100612816 | 3300031946 | Soil | TYELDAFKPNLTRAEAEKRIITLTAKLKLLGEPPHTL |
| Ga0310910_103058273 | 3300031946 | Soil | EAAYELDAFKPNLTRAEANLRIAMLTAKLKLLDGPPHTL |
| Ga0310910_108408442 | 3300031946 | Soil | AATLKELAKAAYELDAFKPNLTRAEADIRIAMLKAKLKLLDGPPHTL |
| Ga0310910_111214102 | 3300031946 | Soil | RLQRLSEAFKPNLTRAEADVRIAMLTAKLKLLDEPPHTL |
| Ga0310910_114684942 | 3300031946 | Soil | TLKRLAEAAYEREAFKPNLTRAEADQRIATLTAKLKLLGEPPHTL |
| Ga0310909_110783352 | 3300031947 | Soil | ELEAFQPNLTRAEADLRISMLTAKLKLLDGPPHTL |
| Ga0310909_116249182 | 3300031947 | Soil | TLKRLAEAAYEREAFQPNLTRAEADVRIAMLTAKLKLLGEPPHTL |
| Ga0306926_103741371 | 3300031954 | Soil | LAEAAYEREAFKPNLTRAEADVRIAMLTAKLNLLG |
| Ga0306926_128103192 | 3300031954 | Soil | AYELDAFKPNLTRAEADLRIATLAAKLKLLDGPPHTL |
| Ga0318530_100916481 | 3300031959 | Soil | EAAYELDAFKPNLTRAEADVRIAMLTAKLKLLDEPPHTL |
| Ga0307479_116764651 | 3300031962 | Hardwood Forest Soil | YERDAFKPNLTRGEADLRIAILAAKLKLLDGPPHTL |
| Ga0318531_105401051 | 3300031981 | Soil | LKRLAEAAYELETFQPNLTRAEADLRIAMLTAKLKLLDGPPHAL |
| Ga0306922_103514504 | 3300032001 | Soil | EAAYELEAFQPTLTRAEADLRIAMLTAKLKLLDGPPHTL |
| Ga0306922_112183111 | 3300032001 | Soil | ELDAFQPNLTRAEADVRIAMLTAKLKLLDGPPHTL |
| Ga0318563_107343751 | 3300032009 | Soil | AEQAKTLKRLAEAAYELEAFKSNLTRAEADLRIAALTAKLKLLDGPPHTL |
| Ga0310906_102460102 | 3300032013 | Soil | VALKRLTQAAYELDAFKPNLTGIEAGIRIAMLTAKLKLLDEPPHTL |
| Ga0318507_103115951 | 3300032025 | Soil | AYELEAFQPNLTRAEADLRIAMLTAKLKLLGEPPHTL |
| Ga0310911_105649751 | 3300032035 | Soil | AEAAYEREAFKPNLTRAEADVRIATLTAKLKLLGEPPHTL |
| Ga0318533_1000162413 | 3300032059 | Soil | MPRRFQPEQAATLKRLAEAAYELEAFQRNLTRGEADLRIAMLAAKLKLLDGPP |
| Ga0318533_100656195 | 3300032059 | Soil | AYELEAFQRNLTRGEADLRIAMLTAKLKLLDGPPHTL |
| Ga0318533_114263272 | 3300032059 | Soil | QAATLKQLAKAAYELDAFKPNLTRTEADIRIAALKAKLKLLNGPPHTL |
| Ga0318510_100953891 | 3300032064 | Soil | YELEAFQRNLTRGEADLRIAMLTAKLKLLDGPPHTL |
| Ga0318524_103108463 | 3300032067 | Soil | RLAQDAYEPDAFKPNLTSAEADIRIAMLTAKLKLLGEPPHTL |
| Ga0306924_107882111 | 3300032076 | Soil | AAYELEALQPNLTRAEADLRIAMLTAKLKLLGEPPHTL |
| Ga0306924_114101721 | 3300032076 | Soil | GWANVAYELDAFKPNLTRAEADLRIAALTAKLKLLDGPPHTL |
| Ga0306924_118843961 | 3300032076 | Soil | ETLKRLAQAAYELDAFKPNLTRAEADLRIATLAAKLKLLDGPPHTL |
| Ga0306920_1003841035 | 3300032261 | Soil | MTVVQAATLKRLAEAAYELDAFKPNLTRDEADARIAMLTAKLKLLGEPPHTL |
| Ga0306920_1017055472 | 3300032261 | Soil | RLAEAAYEREAFKPNLTRAEADVRIAMLTAKLKLLGEPPHTL |
| Ga0306920_1017239653 | 3300032261 | Soil | RPANDCRELKRLTEAAYELDAFKPNLTRAEADVRIAMLTAKLKLLDEPPHTL |
| Ga0306920_1040112542 | 3300032261 | Soil | ETLKRLAEAAYEREAFKPNLTRAEADVRIATLTAKLKLLSGPPHTL |
| Ga0310914_101009556 | 3300033289 | Soil | KRLAEAAYELEAFQRNLTRGEADLRIAMLTAKLKLLDGPPHTL |
| Ga0310914_118721831 | 3300033289 | Soil | MTAEQAATLKRLEAAYELDAFKTNLKRSEADLRIAALTAKLKLLDGPPHTL |
| Ga0316624_103239983 | 3300033486 | Soil | LAIDAYEPDAFKLNLTQAEAQKRIVMLSAKLPLLDEPPPML |
| Ga0370484_0098389_651_761 | 3300034125 | Untreated Peat Soil | YELDAFKPNLTRTEADIRIAMLTAKLKLLDGPPHTL |
| ⦗Top⦘ |