| Basic Information | |
|---|---|
| Family ID | F005923 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 386 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VDTERSTEFVALGHAGSEHYAGLETFPNPGVSHVEMTSDELTAVCP |
| Number of Associated Samples | 307 |
| Number of Associated Scaffolds | 386 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 52.07 % |
| % of genes near scaffold ends (potentially truncated) | 97.41 % |
| % of genes from short scaffolds (< 2000 bps) | 94.30 % |
| Associated GOLD sequencing projects | 287 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.632 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.435 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.383 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.041 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 13.51% Coil/Unstructured: 86.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 386 Family Scaffolds |
|---|---|---|
| PF05014 | Nuc_deoxyrib_tr | 44.82 |
| PF02592 | Vut_1 | 3.11 |
| PF00155 | Aminotran_1_2 | 1.04 |
| PF00266 | Aminotran_5 | 1.04 |
| PF01266 | DAO | 1.04 |
| PF07883 | Cupin_2 | 0.78 |
| PF01872 | RibD_C | 0.52 |
| PF02738 | MoCoBD_1 | 0.52 |
| PF13520 | AA_permease_2 | 0.52 |
| PF00067 | p450 | 0.52 |
| PF00563 | EAL | 0.52 |
| PF00355 | Rieske | 0.52 |
| PF05235 | CHAD | 0.52 |
| PF03449 | GreA_GreB_N | 0.52 |
| PF07452 | CHRD | 0.52 |
| PF00248 | Aldo_ket_red | 0.26 |
| PF03734 | YkuD | 0.26 |
| PF03631 | Virul_fac_BrkB | 0.26 |
| PF03575 | Peptidase_S51 | 0.26 |
| PF01066 | CDP-OH_P_transf | 0.26 |
| PF07676 | PD40 | 0.26 |
| PF02133 | Transp_cyt_pur | 0.26 |
| PF13424 | TPR_12 | 0.26 |
| PF13683 | rve_3 | 0.26 |
| PF01344 | Kelch_1 | 0.26 |
| PF12697 | Abhydrolase_6 | 0.26 |
| PF07690 | MFS_1 | 0.26 |
| PF00254 | FKBP_C | 0.26 |
| PF12245 | Big_3_2 | 0.26 |
| PF03465 | eRF1_3 | 0.26 |
| PF00920 | ILVD_EDD | 0.26 |
| PF00326 | Peptidase_S9 | 0.26 |
| PF00015 | MCPsignal | 0.26 |
| PF00494 | SQS_PSY | 0.26 |
| PF03807 | F420_oxidored | 0.26 |
| PF07920 | DUF1684 | 0.26 |
| PF04237 | YjbR | 0.26 |
| PF10417 | 1-cysPrx_C | 0.26 |
| PF00582 | Usp | 0.26 |
| PF06210 | DUF1003 | 0.26 |
| PF13418 | Kelch_4 | 0.26 |
| PF13847 | Methyltransf_31 | 0.26 |
| PF00149 | Metallophos | 0.26 |
| PF01734 | Patatin | 0.26 |
| PF00127 | Copper-bind | 0.26 |
| PF00571 | CBS | 0.26 |
| PF05977 | MFS_3 | 0.26 |
| PF03167 | UDG | 0.26 |
| PF00903 | Glyoxalase | 0.26 |
| PF05988 | DUF899 | 0.26 |
| PF03853 | YjeF_N | 0.26 |
| PF00908 | dTDP_sugar_isom | 0.26 |
| PF03640 | Lipoprotein_15 | 0.26 |
| PF04337 | DUF480 | 0.26 |
| PF03992 | ABM | 0.26 |
| PF00005 | ABC_tran | 0.26 |
| PF05974 | DUF892 | 0.26 |
| PF01590 | GAF | 0.26 |
| PF00664 | ABC_membrane | 0.26 |
| PF13692 | Glyco_trans_1_4 | 0.26 |
| COG ID | Name | Functional Category | % Frequency in 386 Family Scaffolds |
|---|---|---|---|
| COG3613 | Nucleoside 2-deoxyribosyltransferase | Nucleotide transport and metabolism [F] | 44.82 |
| COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 3.11 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 0.52 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.52 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.52 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.52 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.52 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.52 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.52 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.52 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.52 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.52 |
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 0.52 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.52 |
| COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 0.26 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.26 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.26 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.26 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.26 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.26 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.26 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.26 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.26 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.26 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.26 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.26 |
| COG3358 | Uncharacterized conserved protein, DUF1684 family | Function unknown [S] | 0.26 |
| COG3132 | Uncharacterized conserved protein YceH, UPF0502 family | Function unknown [S] | 0.26 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.26 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.26 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.26 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.26 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.26 |
| COG1562 | Phytoene/squalene synthetase | Lipid transport and metabolism [I] | 0.26 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.63 % |
| Unclassified | root | N/A | 3.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309009|GPKNP_GG3DY5402GD3UW | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 2170459003|FZ032L002GWXLN | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
| 2170459014|G1P06HT01CU4VD | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
| 2189573003|GZIR7W401DVMPL | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0823569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 2054 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104982799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
| 3300000956|JGI10216J12902_105993608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300000956|JGI10216J12902_115022072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 650 | Open in IMG/M |
| 3300001532|A20PFW1_1223922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3991 | Open in IMG/M |
| 3300001535|A3PFW1_10076071 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300001537|A2065W1_10329979 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300002028|A17_1014975 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300002568|C688J35102_119612743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 731 | Open in IMG/M |
| 3300003324|soilH2_10095922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2170 | Open in IMG/M |
| 3300003324|soilH2_10344862 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300004114|Ga0062593_102686371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 567 | Open in IMG/M |
| 3300004114|Ga0062593_103377615 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300004156|Ga0062589_100997011 | Not Available | 782 | Open in IMG/M |
| 3300004157|Ga0062590_101254107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 727 | Open in IMG/M |
| 3300004157|Ga0062590_102919830 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300004479|Ga0062595_100431910 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300004643|Ga0062591_100355300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1187 | Open in IMG/M |
| 3300004643|Ga0062591_101424096 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300004643|Ga0062591_102449193 | Not Available | 548 | Open in IMG/M |
| 3300005093|Ga0062594_101459598 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300005171|Ga0066677_10258181 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300005178|Ga0066688_10165170 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300005184|Ga0066671_10267862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1059 | Open in IMG/M |
| 3300005184|Ga0066671_10642100 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300005186|Ga0066676_10342831 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300005187|Ga0066675_10592535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 833 | Open in IMG/M |
| 3300005327|Ga0070658_10784464 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300005329|Ga0070683_100824382 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300005332|Ga0066388_106181517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 604 | Open in IMG/M |
| 3300005339|Ga0070660_100479469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
| 3300005339|Ga0070660_101286122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 621 | Open in IMG/M |
| 3300005340|Ga0070689_102186504 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005347|Ga0070668_101440226 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005355|Ga0070671_100912730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 767 | Open in IMG/M |
| 3300005356|Ga0070674_101582346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300005367|Ga0070667_102247715 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005435|Ga0070714_100208719 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300005435|Ga0070714_100561514 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300005439|Ga0070711_100209045 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300005439|Ga0070711_101962032 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005444|Ga0070694_101463115 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005445|Ga0070708_100337741 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300005456|Ga0070678_101608356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 610 | Open in IMG/M |
| 3300005458|Ga0070681_10434387 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300005466|Ga0070685_11143132 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005467|Ga0070706_101185205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 702 | Open in IMG/M |
| 3300005468|Ga0070707_101155819 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005468|Ga0070707_101512915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300005526|Ga0073909_10594544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 546 | Open in IMG/M |
| 3300005529|Ga0070741_10326062 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300005535|Ga0070684_100818926 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300005535|Ga0070684_101647782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 605 | Open in IMG/M |
| 3300005539|Ga0068853_102036587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300005544|Ga0070686_100661726 | Not Available | 829 | Open in IMG/M |
| 3300005545|Ga0070695_100670341 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300005547|Ga0070693_101103906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300005549|Ga0070704_101132646 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005553|Ga0066695_10268527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1077 | Open in IMG/M |
| 3300005557|Ga0066704_10949491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300005563|Ga0068855_102483858 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005564|Ga0070664_102344011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300005574|Ga0066694_10112993 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300005576|Ga0066708_10745321 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005578|Ga0068854_101402985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
| 3300005578|Ga0068854_102039722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300005587|Ga0066654_10449764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
| 3300005587|Ga0066654_10759085 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005598|Ga0066706_10970170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
| 3300005616|Ga0068852_100478789 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300005616|Ga0068852_102508292 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005713|Ga0066905_100318809 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300005764|Ga0066903_103221426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 883 | Open in IMG/M |
| 3300005840|Ga0068870_10822030 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005842|Ga0068858_102467417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300005888|Ga0075289_1062939 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005937|Ga0081455_11023257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300006028|Ga0070717_11275580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 668 | Open in IMG/M |
| 3300006046|Ga0066652_100325012 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300006046|Ga0066652_101258283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 699 | Open in IMG/M |
| 3300006173|Ga0070716_100588990 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300006354|Ga0075021_10114748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1608 | Open in IMG/M |
| 3300006572|Ga0074051_11478016 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300006580|Ga0074049_12468550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
| 3300006603|Ga0074064_11552299 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300006604|Ga0074060_11685754 | Not Available | 518 | Open in IMG/M |
| 3300006606|Ga0074062_12329038 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006804|Ga0079221_11043185 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300006844|Ga0075428_100285500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1776 | Open in IMG/M |
| 3300006852|Ga0075433_11370870 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300006854|Ga0075425_100920568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 999 | Open in IMG/M |
| 3300006876|Ga0079217_10127634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1193 | Open in IMG/M |
| 3300006881|Ga0068865_100238484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1430 | Open in IMG/M |
| 3300006881|Ga0068865_100741220 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300006881|Ga0068865_101558521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300006904|Ga0075424_101695061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
| 3300006953|Ga0074063_14139486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300009012|Ga0066710_101620809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 990 | Open in IMG/M |
| 3300009012|Ga0066710_102651448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 718 | Open in IMG/M |
| 3300009012|Ga0066710_104569702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300009088|Ga0099830_10224951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1477 | Open in IMG/M |
| 3300009090|Ga0099827_10050715 | All Organisms → cellular organisms → Bacteria | 3119 | Open in IMG/M |
| 3300009090|Ga0099827_10654772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 907 | Open in IMG/M |
| 3300009090|Ga0099827_10771609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 832 | Open in IMG/M |
| 3300009093|Ga0105240_10298776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1842 | Open in IMG/M |
| 3300009098|Ga0105245_10812266 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300009098|Ga0105245_12347320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 587 | Open in IMG/M |
| 3300009098|Ga0105245_12773947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 543 | Open in IMG/M |
| 3300009101|Ga0105247_10827674 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300009137|Ga0066709_100342776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2050 | Open in IMG/M |
| 3300009137|Ga0066709_100398196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1909 | Open in IMG/M |
| 3300009137|Ga0066709_102275092 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300009137|Ga0066709_103043285 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300009148|Ga0105243_10250721 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300009156|Ga0111538_11482359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 855 | Open in IMG/M |
| 3300009162|Ga0075423_10564582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1198 | Open in IMG/M |
| 3300009176|Ga0105242_11713478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300009176|Ga0105242_13151628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300009177|Ga0105248_12040277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
| 3300009651|Ga0105859_1288373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
| 3300009789|Ga0126307_11666407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300009801|Ga0105056_1066248 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300009818|Ga0105072_1010180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1651 | Open in IMG/M |
| 3300010038|Ga0126315_10358183 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300010041|Ga0126312_10171308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1512 | Open in IMG/M |
| 3300010041|Ga0126312_10738959 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300010042|Ga0126314_10414148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 972 | Open in IMG/M |
| 3300010042|Ga0126314_11224278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300010159|Ga0099796_10469540 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300010304|Ga0134088_10227045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 896 | Open in IMG/M |
| 3300010321|Ga0134067_10056409 | Not Available | 1275 | Open in IMG/M |
| 3300010323|Ga0134086_10367802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300010326|Ga0134065_10080089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1055 | Open in IMG/M |
| 3300010326|Ga0134065_10390930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300010329|Ga0134111_10366659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300010362|Ga0126377_11381286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 777 | Open in IMG/M |
| 3300010371|Ga0134125_12807011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300010379|Ga0136449_103940339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
| 3300010396|Ga0134126_12269868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300010397|Ga0134124_12349665 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300010400|Ga0134122_11970136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300010400|Ga0134122_13145391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300010403|Ga0134123_13036168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300011107|Ga0151490_1624711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300011991|Ga0120153_1011340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2322 | Open in IMG/M |
| 3300011992|Ga0120146_1032297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 921 | Open in IMG/M |
| 3300011994|Ga0120157_1051822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 880 | Open in IMG/M |
| 3300011994|Ga0120157_1088847 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300011998|Ga0120114_1117632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300011999|Ga0120148_1049186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 860 | Open in IMG/M |
| 3300012003|Ga0120163_1004755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5902 | Open in IMG/M |
| 3300012003|Ga0120163_1037369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1258 | Open in IMG/M |
| 3300012008|Ga0120174_1064025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 976 | Open in IMG/M |
| 3300012014|Ga0120159_1013204 | All Organisms → cellular organisms → Bacteria | 3327 | Open in IMG/M |
| 3300012093|Ga0136632_10309502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
| 3300012185|Ga0136619_10028661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2163 | Open in IMG/M |
| 3300012186|Ga0136620_10025359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2814 | Open in IMG/M |
| 3300012198|Ga0137364_10570486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
| 3300012199|Ga0137383_11370710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300012200|Ga0137382_11075881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300012203|Ga0137399_10667914 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300012204|Ga0137374_10370044 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300012206|Ga0137380_10987322 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300012207|Ga0137381_10493400 | Not Available | 1069 | Open in IMG/M |
| 3300012207|Ga0137381_11359104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300012207|Ga0137381_11383255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 596 | Open in IMG/M |
| 3300012208|Ga0137376_10796374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
| 3300012209|Ga0137379_10676064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 938 | Open in IMG/M |
| 3300012209|Ga0137379_11140836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
| 3300012209|Ga0137379_11217568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 660 | Open in IMG/M |
| 3300012210|Ga0137378_10857821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 821 | Open in IMG/M |
| 3300012211|Ga0137377_10514974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1134 | Open in IMG/M |
| 3300012285|Ga0137370_10275613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1000 | Open in IMG/M |
| 3300012285|Ga0137370_10547553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 711 | Open in IMG/M |
| 3300012285|Ga0137370_10882412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300012349|Ga0137387_10780131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300012350|Ga0137372_10447816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 969 | Open in IMG/M |
| 3300012354|Ga0137366_10870662 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012354|Ga0137366_10921156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 613 | Open in IMG/M |
| 3300012357|Ga0137384_11321225 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012359|Ga0137385_11170800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300012359|Ga0137385_11176298 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012360|Ga0137375_10101386 | All Organisms → cellular organisms → Bacteria | 2930 | Open in IMG/M |
| 3300012360|Ga0137375_10138953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2393 | Open in IMG/M |
| 3300012361|Ga0137360_10295144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1344 | Open in IMG/M |
| 3300012582|Ga0137358_10388198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 945 | Open in IMG/M |
| 3300012582|Ga0137358_10597600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 740 | Open in IMG/M |
| 3300012680|Ga0136612_10119464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1338 | Open in IMG/M |
| 3300012680|Ga0136612_10224676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 955 | Open in IMG/M |
| 3300012683|Ga0137398_11065802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300012898|Ga0157293_10069678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
| 3300012898|Ga0157293_10160037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 645 | Open in IMG/M |
| 3300012903|Ga0157289_10343031 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012907|Ga0157283_10206625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300012907|Ga0157283_10375223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300012913|Ga0157298_10338448 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012924|Ga0137413_11022951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300012927|Ga0137416_11872267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 549 | Open in IMG/M |
| 3300012930|Ga0137407_10843895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 866 | Open in IMG/M |
| 3300012930|Ga0137407_11487878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300012930|Ga0137407_11908811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300012961|Ga0164302_11134713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300012971|Ga0126369_12307327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
| 3300012977|Ga0134087_10472630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300012977|Ga0134087_10559973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300012984|Ga0164309_11550852 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012985|Ga0164308_10868639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300012985|Ga0164308_10895525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300012985|Ga0164308_11372283 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300012986|Ga0164304_10300652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 1100 | Open in IMG/M |
| 3300012986|Ga0164304_10379565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 997 | Open in IMG/M |
| 3300012986|Ga0164304_11339129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300012987|Ga0164307_10841684 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300012989|Ga0164305_11117552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300012989|Ga0164305_11333838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300013100|Ga0157373_10561534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 828 | Open in IMG/M |
| 3300013100|Ga0157373_10859437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 671 | Open in IMG/M |
| 3300013306|Ga0163162_11856534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
| 3300013306|Ga0163162_12742349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300013770|Ga0120123_1121871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300013772|Ga0120158_10120693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 1519 | Open in IMG/M |
| 3300014031|Ga0120173_1004525 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300014325|Ga0163163_11490508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 738 | Open in IMG/M |
| 3300014326|Ga0157380_11561365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 715 | Open in IMG/M |
| 3300014497|Ga0182008_10653108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 596 | Open in IMG/M |
| 3300014658|Ga0181519_10165638 | Not Available | 1403 | Open in IMG/M |
| 3300014823|Ga0120170_1015606 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
| 3300014823|Ga0120170_1089617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300014968|Ga0157379_10867341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 855 | Open in IMG/M |
| 3300014969|Ga0157376_12074025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300015068|Ga0167645_114447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300015189|Ga0167667_1042567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1112 | Open in IMG/M |
| 3300015357|Ga0134072_10067341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1034 | Open in IMG/M |
| 3300015371|Ga0132258_10757496 | All Organisms → cellular organisms → Bacteria | 2446 | Open in IMG/M |
| 3300015373|Ga0132257_100182133 | All Organisms → cellular organisms → Bacteria | 2479 | Open in IMG/M |
| 3300016319|Ga0182033_10597224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 958 | Open in IMG/M |
| 3300017959|Ga0187779_10250737 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300017974|Ga0187777_10482822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 864 | Open in IMG/M |
| 3300017974|Ga0187777_10599957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 776 | Open in IMG/M |
| 3300017974|Ga0187777_11342372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
| 3300017994|Ga0187822_10201331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
| 3300018027|Ga0184605_10163926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1003 | Open in IMG/M |
| 3300018073|Ga0184624_10446069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300018079|Ga0184627_10454408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300018082|Ga0184639_10091142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1606 | Open in IMG/M |
| 3300018422|Ga0190265_10238853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1857 | Open in IMG/M |
| 3300018429|Ga0190272_11286497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
| 3300018431|Ga0066655_11000179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
| 3300018468|Ga0066662_10427173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1176 | Open in IMG/M |
| 3300018468|Ga0066662_12660830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
| 3300018469|Ga0190270_10636285 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300018476|Ga0190274_10301449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1491 | Open in IMG/M |
| 3300018476|Ga0190274_10378542 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300018920|Ga0190273_11355458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 618 | Open in IMG/M |
| 3300019279|Ga0184642_1243528 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300019361|Ga0173482_10489485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
| 3300019361|Ga0173482_10560139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300019362|Ga0173479_10330697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300020082|Ga0206353_11046875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
| 3300022213|Ga0224500_10178183 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300023062|Ga0247791_1083261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300024279|Ga0247692_1005149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2132 | Open in IMG/M |
| 3300025898|Ga0207692_10170475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1261 | Open in IMG/M |
| 3300025899|Ga0207642_10041427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2016 | Open in IMG/M |
| 3300025908|Ga0207643_10318254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 971 | Open in IMG/M |
| 3300025913|Ga0207695_10578290 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300025916|Ga0207663_11382915 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300025917|Ga0207660_10849136 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300025920|Ga0207649_10330406 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300025921|Ga0207652_10423356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1201 | Open in IMG/M |
| 3300025921|Ga0207652_10981875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
| 3300025921|Ga0207652_11145130 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300025924|Ga0207694_10468637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1053 | Open in IMG/M |
| 3300025926|Ga0207659_10189567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1635 | Open in IMG/M |
| 3300025928|Ga0207700_11422990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
| 3300025928|Ga0207700_11858674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
| 3300025929|Ga0207664_10820229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
| 3300025934|Ga0207686_11358319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300025935|Ga0207709_11381547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300025938|Ga0207704_11811300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300025939|Ga0207665_10435686 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300025939|Ga0207665_11067171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300025944|Ga0207661_10471598 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300025949|Ga0207667_11130365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
| 3300025961|Ga0207712_11171978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
| 3300025972|Ga0207668_11433795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300025981|Ga0207640_10542682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 975 | Open in IMG/M |
| 3300025981|Ga0207640_11298278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300026035|Ga0207703_12318247 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300026089|Ga0207648_12141015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
| 3300026121|Ga0207683_10155592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2064 | Open in IMG/M |
| 3300026121|Ga0207683_12069009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300026306|Ga0209468_1077869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1109 | Open in IMG/M |
| 3300026312|Ga0209153_1193553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 721 | Open in IMG/M |
| 3300026316|Ga0209155_1190709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 652 | Open in IMG/M |
| 3300026548|Ga0209161_10328408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 703 | Open in IMG/M |
| 3300026550|Ga0209474_10608780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300027517|Ga0209113_1045505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 635 | Open in IMG/M |
| 3300027577|Ga0209874_1001678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6868 | Open in IMG/M |
| 3300027637|Ga0209818_1137107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300027819|Ga0209514_10393597 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300027821|Ga0209811_10274295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300027831|Ga0209797_10056239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1747 | Open in IMG/M |
| 3300027831|Ga0209797_10169352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 936 | Open in IMG/M |
| 3300027875|Ga0209283_10982433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300027886|Ga0209486_10957567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 572 | Open in IMG/M |
| 3300027894|Ga0209068_10150775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1258 | Open in IMG/M |
| 3300028004|Ga0247705_1020681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300028072|Ga0247675_1051800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
| 3300028558|Ga0265326_10154378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 656 | Open in IMG/M |
| 3300028558|Ga0265326_10202252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
| 3300028712|Ga0307285_10185570 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300028715|Ga0307313_10126790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 783 | Open in IMG/M |
| 3300028719|Ga0307301_10272812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
| 3300028720|Ga0307317_10139105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
| 3300028722|Ga0307319_10277111 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300028754|Ga0307297_10118409 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300028771|Ga0307320_10437488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300028784|Ga0307282_10248808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 854 | Open in IMG/M |
| 3300028790|Ga0307283_10047131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1016 | Open in IMG/M |
| 3300028791|Ga0307290_10129268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 924 | Open in IMG/M |
| 3300028796|Ga0307287_10370951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300028796|Ga0307287_10393130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300028799|Ga0307284_10350169 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300028802|Ga0307503_10232187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 892 | Open in IMG/M |
| 3300028802|Ga0307503_10884384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300028819|Ga0307296_10082265 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300028824|Ga0307310_10403902 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300028828|Ga0307312_10154136 | Not Available | 1459 | Open in IMG/M |
| 3300028876|Ga0307286_10151752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 830 | Open in IMG/M |
| 3300028881|Ga0307277_10202116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 871 | Open in IMG/M |
| 3300029957|Ga0265324_10341486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300031226|Ga0307497_10281826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 755 | Open in IMG/M |
| 3300031232|Ga0302323_100830074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1018 | Open in IMG/M |
| 3300031240|Ga0265320_10147779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1062 | Open in IMG/M |
| 3300031251|Ga0265327_10072264 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300031562|Ga0310886_10399009 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300031595|Ga0265313_10254099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 716 | Open in IMG/M |
| 3300031640|Ga0318555_10441070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 706 | Open in IMG/M |
| 3300031720|Ga0307469_11080008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 753 | Open in IMG/M |
| 3300031723|Ga0318493_10696888 | Not Available | 569 | Open in IMG/M |
| 3300031726|Ga0302321_101500628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 777 | Open in IMG/M |
| 3300031731|Ga0307405_10388523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1089 | Open in IMG/M |
| 3300031748|Ga0318492_10335429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 790 | Open in IMG/M |
| 3300031753|Ga0307477_10730286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 661 | Open in IMG/M |
| 3300031764|Ga0318535_10434116 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031799|Ga0318565_10554735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 553 | Open in IMG/M |
| 3300031819|Ga0318568_10282019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1031 | Open in IMG/M |
| 3300031824|Ga0307413_11377142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300031845|Ga0318511_10207407 | Not Available | 872 | Open in IMG/M |
| 3300031846|Ga0318512_10293042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
| 3300031847|Ga0310907_10788016 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031858|Ga0310892_11194548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 542 | Open in IMG/M |
| 3300031890|Ga0306925_11206993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
| 3300031897|Ga0318520_11021249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300031901|Ga0307406_11505006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300031908|Ga0310900_10739963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
| 3300031918|Ga0311367_11653582 | Not Available | 625 | Open in IMG/M |
| 3300031938|Ga0308175_101779204 | Not Available | 690 | Open in IMG/M |
| 3300031938|Ga0308175_101958211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 657 | Open in IMG/M |
| 3300031939|Ga0308174_10594986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 915 | Open in IMG/M |
| 3300031939|Ga0308174_11026738 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300031939|Ga0308174_11118664 | Not Available | 670 | Open in IMG/M |
| 3300031939|Ga0308174_11395499 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300031943|Ga0310885_10436207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 704 | Open in IMG/M |
| 3300031947|Ga0310909_11593919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300031954|Ga0306926_11897907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 673 | Open in IMG/M |
| 3300031996|Ga0308176_10128058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2286 | Open in IMG/M |
| 3300031997|Ga0315278_10979220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 843 | Open in IMG/M |
| 3300032002|Ga0307416_100336026 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300032002|Ga0307416_101322420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 827 | Open in IMG/M |
| 3300032008|Ga0318562_10419445 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300032012|Ga0310902_11026306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300032068|Ga0318553_10198810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1045 | Open in IMG/M |
| 3300032126|Ga0307415_101870059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300032180|Ga0307471_101344460 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300032180|Ga0307471_103064695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300032342|Ga0315286_11702321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
| 3300032770|Ga0335085_11189106 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300032897|Ga0335071_10877939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 845 | Open in IMG/M |
| 3300032898|Ga0335072_10037103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6705 | Open in IMG/M |
| 3300032955|Ga0335076_10130514 | All Organisms → cellular organisms → Bacteria | 2434 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.96% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.33% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.07% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.55% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.55% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.30% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.30% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.04% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.04% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.04% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.04% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.04% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.78% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.52% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.52% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.52% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.26% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.26% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.26% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.26% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.26% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.26% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.26% |
| Permafrost And Active Layer Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil | 0.26% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.26% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.26% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.26% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.26% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.26% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.26% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001532 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002028 | Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_A17 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
| 3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
| 3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014031 | Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015068 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8C, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015189 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028004 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-2-W_N | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKNP_01319990 | 2070309009 | Soil | MEEEFVALGHAGSEHYAGLETFPNPGVALVEMTSDELV |
| E4A_07970000 | 2170459003 | Grass Soil | MDGEFVALGHSGSEAYAGLETFPNPGVTHVDLTSD |
| 2PV_04907330 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | MNERSTDFVALGHAGSEQYAGIETFPNPGVARVEMTSDELVAMCPITNQPDMYVATIDYEPD |
| FE2_07587630 | 2189573003 | Grass Soil | VEASSRSSDFVALGHPGSGHFAGLERFANPGVSQVEMAS |
| ICChiseqgaiiDRAFT_08235691 | 3300000033 | Soil | MEGSTRDTDFVALGQPGSGAFAGIETFPNPGVSHV |
| INPhiseqgaiiFebDRAFT_1049827991 | 3300000364 | Soil | MDXEFVALGHAGSDAYAGLETFPNPGVEVVSMTSDE |
| JGI10216J12902_1059936081 | 3300000956 | Soil | MERPGDFVALGQAGSDAYVGLETFENPGVRRVEMTSDEITAVCPITGQPDMY |
| JGI10216J12902_1150220721 | 3300000956 | Soil | METTTRSTEFVALGHPGSTHYAGLESFPNPGVARVELDSDELTAVCP |
| A20PFW1_12239226 | 3300001532 | Permafrost | METDAPQTEFVALGHAGSEHYAGLETFPNPGVSHVEMT |
| A3PFW1_100760711 | 3300001535 | Permafrost | METDTPQTEFVALGHAGSEHYVGLETFPNPGVSHVEMTSDELSA |
| A2065W1_103299793 | 3300001537 | Permafrost | MESEFVALGHAGSEAYAGLETFPNPGVERVELVSDELTAVCPITSQP |
| A17_10149753 | 3300002028 | Permafrost And Active Layer Soil | METESQQAEFVALGHAGSEHYVGLETFPNPGVSHVEMT |
| C688J35102_1196127431 | 3300002568 | Soil | VGTPSRETDFVALGHAGSEHYAGLETFPSPGVSHVRMVSDELTAI |
| soilH2_100959221 | 3300003324 | Sugarcane Root And Bulk Soil | VEQEFVALGHAGSDAYAGLESFANPGVAHVELVSDELTAFCPITHQPDFY |
| soilH2_103448625 | 3300003324 | Sugarcane Root And Bulk Soil | MTQEFVALGHAGSDAYAGLETFPNPGVAVVEMTSDELTAVCPITSQ |
| Ga0062593_1026863711 | 3300004114 | Soil | MTETTRETEFVALGHAGSEHYAGLETFPSPGIATVSMTSDELV |
| Ga0062593_1033776151 | 3300004114 | Soil | VEQEFVALGHAGSDAYAGLESFPNPGVEQVELVSDELTAVCPITGQ |
| Ga0062589_1009970111 | 3300004156 | Soil | MTETTRETEFVALGHAGSEHYAGLETFPSPGIATVSMTSDELVAVCPIT |
| Ga0062590_1012541071 | 3300004157 | Soil | MEGSTRETDFVALGKPGSEAFAGIETFPNPGVAHVDMTSDELIAIC |
| Ga0062590_1029198302 | 3300004157 | Soil | MAEEFVALGHAGSEHYAGLETFPNPGVALVELTSDELVAMCPVTNQPDM |
| Ga0062595_1004319103 | 3300004479 | Soil | MEFVALGHAGSEHYAGLESFPNPGVTQVEMTSDELTAVCPITAQ |
| Ga0062591_1003553003 | 3300004643 | Soil | MTDSEFVALGHAGSEHYAGLETFDNPGVTRVEMTSDELTAVCPITGQ |
| Ga0062591_1014240961 | 3300004643 | Soil | MESKTRSTEFVALGHAGSDHYAGLETFPNPGVSHVEMTSDELVAVCPIT |
| Ga0062591_1024491931 | 3300004643 | Soil | MEGSTRETDFVALGKPGSEAFAGIETFPNPGVAHVDMTSD |
| Ga0062594_1014595982 | 3300005093 | Soil | VNERSKEFVALGHAGSEHYAGIETFPNPGVARVEMTSDELVAMCPVTNQPD |
| Ga0066677_102581811 | 3300005171 | Soil | MRTVSPMEFVALGHAGSEHYAGLESFPNPGVTEVEMTSDELTAVCP |
| Ga0066688_101651701 | 3300005178 | Soil | VSGDSGPTELVALGHAGSERYAGLETFANPGVARVEMTSDELTTKGPVN |
| Ga0066671_102678623 | 3300005184 | Soil | MRVATRTRSTDFVALGHPGSDHYAGLETFANPGVARVELDGDELTAVCP |
| Ga0066671_106421002 | 3300005184 | Soil | VETDFVALGHAGSDHYAGLETFPNPGVSHVEMTSDELAAICPVTGQP |
| Ga0066676_103428311 | 3300005186 | Soil | MEQEFVALGHAGSDAYIGLETFPNPGVELVEMVSDELTGLCPITNQPDFY |
| Ga0066675_105925351 | 3300005187 | Soil | MEGTTRSTEFVALAHPGSEHYAGLETFANPGVSHVALTSDEL |
| Ga0070658_107844641 | 3300005327 | Corn Rhizosphere | MDHEFVALGHAGSDAYAGLETFPNPGVERVEMVSDELTAFCPITHQPDFYTA |
| Ga0070683_1008243823 | 3300005329 | Corn Rhizosphere | MDHDFVALGHAGSEAYAGLETFPNPGVEVVEMVSDELTAVCPIT |
| Ga0066388_1061815171 | 3300005332 | Tropical Forest Soil | VDQQFVALGHAGSEHYAGLETFSNPGVSVVEMTSDELTAVCPITGQPD |
| Ga0070660_1004794693 | 3300005339 | Corn Rhizosphere | VDQEFVALGHAGSGAYAGLETFPNPGVARVELVSDELTAFCPIT |
| Ga0070660_1012861221 | 3300005339 | Corn Rhizosphere | MNADTRSTEFVALGHAGSENYAGLETFPNPGVSRVELTSDELTAV |
| Ga0070689_1021865041 | 3300005340 | Switchgrass Rhizosphere | MAQEFIALGHDGDAYGGLETFPNPGVAVVELESDELTAMCPITNQPDNYV |
| Ga0070668_1014402261 | 3300005347 | Switchgrass Rhizosphere | VNERSKEFVALGHAGSEHYAGIETFPNPGVARVEMTSDELVAMCPVTNQPDMYIA |
| Ga0070671_1009127301 | 3300005355 | Switchgrass Rhizosphere | VEHEFVALGHAGSDAYVGLETFPNPGVELVEMVSDELTAVC |
| Ga0070674_1015823461 | 3300005356 | Miscanthus Rhizosphere | VEASSSTPQFESLGHAGQQNYAGLETFPNPGVERVEMTSDELAALCP |
| Ga0070667_1022477151 | 3300005367 | Switchgrass Rhizosphere | MAQEFIALGHDGDAYGGLETFPNPGVAVVELESDELTAMCPITNQ |
| Ga0070714_1002087191 | 3300005435 | Agricultural Soil | MEHEFVALGHAGSDAYAGLESFPNPGVERVEMVSDELTAFCPI |
| Ga0070714_1005615141 | 3300005435 | Agricultural Soil | MEQEFVALGHAGSDAYAGLESFPTPGVERVELVSDELTAFCPITHQPDFYTA |
| Ga0070711_1002090451 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEPPGEFVALGHGSDAYAGLETFENPGVALVEMTSDELVA |
| Ga0070711_1019620321 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MEFVALGHAGSEHYAGLESFPNPGVTQVEMTSDELTAVCPI |
| Ga0070694_1014631151 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MTETNEFVALGHAGSEHYAGLETFPNPGVALVEMTSDELVAMCPVTNQPDMYV |
| Ga0070708_1003377411 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VEAGSRSGDFVALGHPGSEHYAGLETFANPGVSQVEMTSDELAAVCPVTRQPDLYVATIEYRP |
| Ga0070678_1016083561 | 3300005456 | Miscanthus Rhizosphere | VETTSRDTDFVALGQPGNDHYAGLETFANPGVAQVELTSDE |
| Ga0070681_104343871 | 3300005458 | Corn Rhizosphere | MGEEFVALGHAGSEHYAGLETFANPGVALVEMTSDELVAMCPVTN |
| Ga0070685_111431321 | 3300005466 | Switchgrass Rhizosphere | MEQEFIALGHDGDAYGGLETFPNPGVSVVELESDELTAMCPITNQPDNY |
| Ga0070706_1011852053 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MEETRSTEFVALGHAGSEHYAGIETFPNPGVGHVQMTSDEL |
| Ga0070707_1011558191 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MGEHEFVALGHAGSDAYVGLETFPNPGVELVEMVSDELTGLCPITNQPD |
| Ga0070707_1015129153 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MEETRSTEFVALGHAGSEHYAGIETFPNPGVSHVQMTSDE |
| Ga0073909_105945441 | 3300005526 | Surface Soil | MTEANEFVALGHAGSEHFAGLETFANPGVSRVEMTSDELTAVCPITGQPDLYLA |
| Ga0070741_103260621 | 3300005529 | Surface Soil | MDTEFVALGHAGSDHYAGLETFPNPGVRQVELTSDELTAVCPITGQP |
| Ga0070684_1008189261 | 3300005535 | Corn Rhizosphere | MESEFVALGHAGSDAYAGLETFPNPGVKSVELVSDELTAV |
| Ga0070684_1016477822 | 3300005535 | Corn Rhizosphere | VETVNDDAPDSPFVALGHAGSRAYAGLETFPNPGIAEVELTSDELTAVCPI |
| Ga0068853_1020365872 | 3300005539 | Corn Rhizosphere | MEQEFVALGHAGSDAYAGLETFSNPGVERVELQSDELTAFCPI |
| Ga0070686_1006617261 | 3300005544 | Switchgrass Rhizosphere | VEHEFVALGHAGSDAYVGLETFPNPGVELVEMVSDELTAVCPIT |
| Ga0070695_1006703411 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEEFVALGHAGSEHYAGLETFPNPGVSLVEMTSDELVAMCPVTNQPDM |
| Ga0070693_1011039062 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VEPASPPSFESLGHAGLQNFAGLETFANPGVDRVEMTSDELAALCPITLQPD |
| Ga0070704_1011326461 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MAETNEFVALGHAGSESYAGLETFANPGVSSVEMTSDELTAVCPITGQP |
| Ga0066695_102685271 | 3300005553 | Soil | MDNEFVALGHAGSDAYFGLETFPNPGVGRVELVSDELTATCPVTNQ |
| Ga0066704_109494912 | 3300005557 | Soil | MDAGTRSTEFVALGHAGPEHYAGLETFPNPGVSQVELVSD |
| Ga0068855_1024838582 | 3300005563 | Corn Rhizosphere | VEQEFVALGHAGSDAYAGLETFPNPGVEVVEMVSDELTAVCPIT |
| Ga0070664_1023440111 | 3300005564 | Corn Rhizosphere | MEREFVALGHAGSDAYAGLETFPNPGVERVELVSDELTAV |
| Ga0066694_101129931 | 3300005574 | Soil | MEQSPRSTGFVALGHAGSGHYAGLESFPNPGVSHVEMTSDELTA |
| Ga0066708_107453213 | 3300005576 | Soil | MEFVALGHAGSEHYAGLESFPNPGVREVEMTSDELTAVCP |
| Ga0068854_1014029851 | 3300005578 | Corn Rhizosphere | MAEEFVALGHAGSEHYAGLETFPNPGVSLVEMTSDELVAMCPV |
| Ga0068854_1020397221 | 3300005578 | Corn Rhizosphere | VLPLTDLRPTDEFVALGHAGSEHYAGLETFENPGVKRVELTSDELTAVCPI |
| Ga0066654_104497642 | 3300005587 | Soil | VEATTRSTEFVALGHPGSEHYAGLETFPNPGVARVELDSDELT |
| Ga0066654_107590851 | 3300005587 | Soil | MADEFVALGHAGSEHYAGLETFPNPGVALVELTSDELVAMCPITNQPD |
| Ga0066706_109701701 | 3300005598 | Soil | MKQRSEEFIALGHAGSEHFAGLETFPNPGVSEVDMRSDELTAVCPIT |
| Ga0068852_1004787891 | 3300005616 | Corn Rhizosphere | MGEEFVALGHAGSEHYAGLETFANPGVALVEMTSDELVAMCPVTNQPDMYV |
| Ga0068852_1025082921 | 3300005616 | Corn Rhizosphere | MAQEFIALGHDGDAYGGLETFPNPGVAVVELESDELTAMCPITNQP |
| Ga0066905_1003188091 | 3300005713 | Tropical Forest Soil | MEQEFVALGHAGSDAYIGLETFPNPGVAVVELVSDELTAVCPITSQPDFY |
| Ga0066903_1032214263 | 3300005764 | Tropical Forest Soil | MEATTRSTEFVALGHPGSTHYAGLESFANPGVARVELDSDELTA |
| Ga0068870_108220303 | 3300005840 | Miscanthus Rhizosphere | MSELPEFTALGHAGSEHYAGLETFPNPGVSLVDLTSDELTAVCPI |
| Ga0068858_1024674173 | 3300005842 | Switchgrass Rhizosphere | MTETHEFVALGHAGSEAYAGLEAFPNPGVSRVEMTSDELTAMCPVT |
| Ga0075289_10629391 | 3300005888 | Rice Paddy Soil | VSEEFVALGHAGSEHYAGLESFPNPGVALVELTSDEL |
| Ga0081455_110232572 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MEEASRSTEFVALGHPGSERYAGLETFPNPGVSHVEMTSDEL |
| Ga0070717_112755802 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSEFVALGHAGSDAYAGLVTFPNPGVAAVELVSDEL |
| Ga0066652_1003250123 | 3300006046 | Soil | METRSKEFVALGHAGSEHYAGLESFENPGVSHVMMRSDEL |
| Ga0066652_1012582831 | 3300006046 | Soil | MKTAPRSTDLEALGHPGFEHFAGLETFPNPGVSHVELRSDELTAICPIT |
| Ga0070716_1005889901 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSEFVALGHAGTYAGLETFPNPGVTEVGMTSDELTAICPVTSQPDLYTA |
| Ga0075021_101147482 | 3300006354 | Watersheds | MEFVALGNAGSEHYAGLESFPNPGVTDVEMTSDELT |
| Ga0074051_114780161 | 3300006572 | Soil | MEGSTRETDFVALGKPGSEAFAGIETFPNPGVSHVEMTSDELTALGPV |
| Ga0074049_124685502 | 3300006580 | Soil | MEGSTRETDFVALGQPGSEAFAGIETFPNPGVSHVEMTSDELTALGPVN |
| Ga0074064_115522993 | 3300006603 | Soil | MGEEFVALGHAGSEHYAGLETFPNPGVAIVELTSDELVAMCPVTNQ |
| Ga0074060_116857542 | 3300006604 | Soil | MEGSTRENDFVALGKPGSEAFAGIETFPNPGVSHVEMTSDELTALGPVNAQPDLYVATIEFWP |
| Ga0074062_123290382 | 3300006606 | Soil | MEQQFVALGHAGSDAYVGLETFPNPGVETVELVSDELTGLCPITNQPDFYTATL |
| Ga0079221_110431853 | 3300006804 | Agricultural Soil | MNEPPGEFVALGHGSDAYAGLETFENPGVARVEMTSDELVAVCPI |
| Ga0075428_1002855001 | 3300006844 | Populus Rhizosphere | VNERSKEFVALGHAGSEHYAGIETFPNPGVARVEMTS |
| Ga0075433_113708702 | 3300006852 | Populus Rhizosphere | MAKAKEEFVALGHAGSDAYAGLETFENPGVSHVEMTSDELTA |
| Ga0075425_1009205681 | 3300006854 | Populus Rhizosphere | MEHEFVALGHAGSDAYVGLETFPNPGVEVVEMLSDELT |
| Ga0079217_101276341 | 3300006876 | Agricultural Soil | MDDAPRGEEFVALGHPGTKHYAGLETFENPGVTRVVMTSDEL |
| Ga0068865_1002384841 | 3300006881 | Miscanthus Rhizosphere | MTETHEFVALGHAGSEAYAGLESFPNPGVSRVEMTSDELTA |
| Ga0068865_1007412201 | 3300006881 | Miscanthus Rhizosphere | VEASSSTPQFESLGHAGQQNYAGLETFPNPGVERVEMTSDELAA |
| Ga0068865_1015585212 | 3300006881 | Miscanthus Rhizosphere | MESDTRSTEFVALGHAGSDHYAGLETFPNPGVSHVEMTSDELVAVCP |
| Ga0075424_1016950612 | 3300006904 | Populus Rhizosphere | MEHEFVALGHAGSDAYVGLETFPNPGVEVVEMLSDELTA |
| Ga0074063_141394862 | 3300006953 | Soil | MEGSTRENDFVALGKPGSEAFAGIETFPNPGVSHVEMTSDELTALGPVN |
| Ga0066710_1016208092 | 3300009012 | Grasslands Soil | MDQAPRSTEFVALGHPGSEHYGGLETFANPGVAQVEMTSDELTAVCPITGQPDLYVAT |
| Ga0066710_1026514482 | 3300009012 | Grasslands Soil | VEARTRSTEFVALGQPGSERYAGLETFPNPGVARVELHSDELTAVCPITGQP |
| Ga0066710_1045697022 | 3300009012 | Grasslands Soil | MSERSTDFVALGRPGSEAYAGLETFENPGVARVEM |
| Ga0099830_102249511 | 3300009088 | Vadose Zone Soil | VETGPRSTDFVALGQPGDRYAGLETFANPGVSHVEMTSDELTAVCPVTGQLDL* |
| Ga0099827_100507155 | 3300009090 | Vadose Zone Soil | MEPPSGSTDFAALGHSGSDHYAGLETFANPGASHVEMTSDELTAVCP |
| Ga0099827_106547721 | 3300009090 | Vadose Zone Soil | MDAGTRSTDFVALGHPGSEHCAGLETFANPGVSQVELTSDELAAVCPITGQPDP* |
| Ga0099827_107716092 | 3300009090 | Vadose Zone Soil | MEPASRSTDFVALGHPGSEHYAGLETFANPGVSQVEMTSDELTAVCPI |
| Ga0105240_102987761 | 3300009093 | Corn Rhizosphere | VDQEFVALGHAGSGAYAGLETFPNPGVARVELVSDELTAFC |
| Ga0105245_108122661 | 3300009098 | Miscanthus Rhizosphere | MGEEFVALGHAGSEHYAGLETFANPGVALVEMTSDELV |
| Ga0105245_123473202 | 3300009098 | Miscanthus Rhizosphere | MAETPEFVALGHAGSEAYAGLESFPNPGVSRVEMTSDELTAACPVTA |
| Ga0105245_127739472 | 3300009098 | Miscanthus Rhizosphere | MGVATTSRDTDFVALGQPGNDHYAGLESFPNPGVADVEL |
| Ga0105247_108276743 | 3300009101 | Switchgrass Rhizosphere | MAEEVVALGHAGSEHYAGLETFPNPGVALVEMTSDELV |
| Ga0066709_1003427761 | 3300009137 | Grasslands Soil | MEQQQFVALGHAGSDAYVGLETFPNPGVELVEMVSDELTGLCPIT |
| Ga0066709_1003981964 | 3300009137 | Grasslands Soil | VERETDFVALGHAGSEHFAGLETFENPGVSSVEMRSDELTAVCPITGQPDLYVA |
| Ga0066709_1022750923 | 3300009137 | Grasslands Soil | MAERTTDFVALGQPGSDAFAGLETFANPGVSRVEMRSDELTAVCPVT |
| Ga0066709_1030432851 | 3300009137 | Grasslands Soil | METGSKEFVALGHAGSEHYAGLESFENPGVSHVVMRSDELVAVCPVTGQ |
| Ga0105243_102507213 | 3300009148 | Miscanthus Rhizosphere | MEGSARETDFVALGQPGNEAFAGIETFPNPGVAHVDMTSDELIAICPVTGQPD |
| Ga0111538_114823591 | 3300009156 | Populus Rhizosphere | MPATGTDRQFVALGHTGSEHYAGLETFENPGVTKVEMTSDELTAVCPITGQP |
| Ga0075423_105645823 | 3300009162 | Populus Rhizosphere | MNEPPGEFVALGHGSDAYAGLEAFENPGVARVEMTSDELVAVCPIT |
| Ga0105242_117134782 | 3300009176 | Miscanthus Rhizosphere | VEAGSRSGDFVALGHPGSENYSGLETFANPGVSQVEMTSDELAAVCPVTG* |
| Ga0105242_131516282 | 3300009176 | Miscanthus Rhizosphere | VEFVALGHAGSEHYVGLESFPNPGVTEVEMTSDELTAVCPITGQADFYV |
| Ga0105248_120402773 | 3300009177 | Switchgrass Rhizosphere | MGEEFVALGHAGSEHYTGLETFANPGVALVEMTSDELVAMC |
| Ga0105859_12883732 | 3300009651 | Permafrost Soil | VAETEFVALGHAGSDAYAGLETFPNPGVRELELTSDELTAVCPIT |
| Ga0126307_116664072 | 3300009789 | Serpentine Soil | MEGSARETDLVALGQPGNEAFAGIETFPNPGVAHVDMTS |
| Ga0105056_10662481 | 3300009801 | Groundwater Sand | MDAGTRSTEFVALGHAGSDRNAGLETFPNPGVSRVEMTSD |
| Ga0105072_10101803 | 3300009818 | Groundwater Sand | MEASSRSTEFVALGHPGSERYVGLETFANPGVSNVEMRSDELTAVCPVTGQPDLYVAT |
| Ga0126315_103581833 | 3300010038 | Serpentine Soil | VNERSTEFVALGHAGSEQYAGIETFPNPGVVRVEMTSDELVAMCPVTNQPDMYVA |
| Ga0126312_101713081 | 3300010041 | Serpentine Soil | MEPGQEFVALGHAGSEHYAGLESFPNPGVSHVEMVSDELTAVCPITGQPDFYI |
| Ga0126312_107389591 | 3300010041 | Serpentine Soil | MDTEFVALGSPGSEAYAGLETFPNPGVSRVEMRSDELTAVCPITGQ |
| Ga0126314_104141483 | 3300010042 | Serpentine Soil | VAGAPRETEFVALGHAGSEHYAGLETFPSPGVSHVSLVSDELTAICPV |
| Ga0126314_112242781 | 3300010042 | Serpentine Soil | MEPGKEFVALGHAGSEHYAGLESFPNPGVSHVELVSDELTAVCPITGQPD |
| Ga0099796_104695401 | 3300010159 | Vadose Zone Soil | VQVEFVALGHAGSEHYAGLESFPNPGVTEIEMTSDELTAVCPITGQADLYVACITY |
| Ga0134088_102270453 | 3300010304 | Grasslands Soil | VERPRSTDFVALGHAGSTHYAGLETFPNPGVSHVEMTSDELTAMCPVTSQPDL |
| Ga0134067_100564093 | 3300010321 | Grasslands Soil | VEARTRSTEFVALGQPGSERYAGLETFPNPGVARVELDSDELT |
| Ga0134086_103678022 | 3300010323 | Grasslands Soil | MDTGTRTTEFVALGHAGSEHYAGLETFPNPGVSYVEMTSDELVAVCPVT |
| Ga0134065_100800892 | 3300010326 | Grasslands Soil | MEGSTRETDFVALGQPGSEAFAGIETFPNPGVSHVEMTSDE |
| Ga0134065_103909301 | 3300010326 | Grasslands Soil | VEESSRSSDFVALGHPGSEHYGGLETFANPGVSQVEMTSDE |
| Ga0134111_103666591 | 3300010329 | Grasslands Soil | MDDGRRSSEFVALGHPGSEHYAGLETFENPGVSQVALTSDELTAV |
| Ga0126377_113812862 | 3300010362 | Tropical Forest Soil | VETTSRHTDFVALGHPGNDHYAGLETFANPGVAQVELTSDELTAVCPIT |
| Ga0134125_128070111 | 3300010371 | Terrestrial Soil | MEKEFVALGHAGSEHYAGLETFANPGVALVEMTSDEL |
| Ga0136449_1039403391 | 3300010379 | Peatlands Soil | LLVATRERSTEFVALGHAGSEHYAGLETFANPGVASVELSGD |
| Ga0134126_122698681 | 3300010396 | Terrestrial Soil | MEQEFVALGHAGSDSYAGLETFPNPGVERVELVSDELTAF |
| Ga0134124_123496651 | 3300010397 | Terrestrial Soil | MKGEFVALGHAGSEHYAGLETFPNPGVALVEMTSDELVAMCPVT |
| Ga0134122_119701362 | 3300010400 | Terrestrial Soil | VEPASPPSFESLGHAGLQNFAGLETFANPGVERVEMTSDELAALCPITLQPDMYVA |
| Ga0134122_131453912 | 3300010400 | Terrestrial Soil | MGEEFVALGHAGSEHYAGLETFANPGVALVEMTSDELVA |
| Ga0134123_130361681 | 3300010403 | Terrestrial Soil | VTGTRSTQFVALGQPGSQAYAGLETFPNPGVRRVEMTSDEL |
| Ga0151490_16247112 | 3300011107 | Soil | MEGSTRETDFVALGKPGSGAFAGIETFPNPGVSHVEMTSDELTALGPVNAQPDLYVAKLE |
| Ga0120153_10113401 | 3300011991 | Permafrost | MDANEFVALGHAGSDAYAGLETFPNPGVALVELTSDELVAVCPLTAQPDFYT |
| Ga0120146_10322973 | 3300011992 | Permafrost | MDAVTRSDEFVALGHAGSGHYAGLETFPNPGVSSVELTSDELVAVCPITG |
| Ga0120157_10518222 | 3300011994 | Permafrost | MEIAPRSTEFVALGHAGSVHYAGFETFANPGVAQVELTSDELTAVCPITGQPDLYQLTIE |
| Ga0120157_10888471 | 3300011994 | Permafrost | VEPASRSSDFVALGHAGSDHYAGLETFANPGVSHVEMTSDELS |
| Ga0120114_11176321 | 3300011998 | Permafrost | VEHEFVALGHAGSDAYVGLETFPNPGVETVEMVSDELTELKK |
| Ga0120148_10491861 | 3300011999 | Permafrost | MDAVTRSDELVALGHAGSGHYAGLETFPNPGVTSVELTSDELVAVC |
| Ga0120163_100475511 | 3300012003 | Permafrost | VEQEFVALGHAGSDAYAGLETFPNPGVEAVEMISDE |
| Ga0120163_10373691 | 3300012003 | Permafrost | VEPPSRSTDFVALGHPGSDHYAGLETFANPGVSHVETTSDELSTICPVTGQPRAAAKVRPERDCL |
| Ga0120174_10640254 | 3300012008 | Permafrost | MSQFSALGHAGSDTYVGLETVDNPGLRSLILHSDEFTAVCPMTGQPDLYEVE |
| Ga0120159_10132046 | 3300012014 | Permafrost | METDAPPTEFVALGHAGSEHYVGLETFPNPGVSHVEMTSDELSAMCPITDQPDFYV |
| Ga0136632_103095022 | 3300012093 | Polar Desert Sand | MRSPAELPEFVALGHAGSEHYAGLETFPNPGVSLVELESDELVAVCPITG |
| Ga0136619_100286611 | 3300012185 | Polar Desert Sand | MLVEQSDPVAEFVALGHAGSSDYAGLETFVNPGVSKVVMTSDELAAICPVTGQPDLYVAT |
| Ga0136620_100253593 | 3300012186 | Polar Desert Sand | MEETTRSTEFVALGHAGSEHYAGIETFPNPGVAHVQLTSDELVAICPITG* |
| Ga0137364_105704862 | 3300012198 | Vadose Zone Soil | VETAPRSTDFVALGQPGSEHYAGLETFANPGVSHVEMTSDEL |
| Ga0137383_113707102 | 3300012199 | Vadose Zone Soil | MDGGTRSTEFVALGHPGSVHYAGLETFANPGVSQVDLTSDELAAVCPITG |
| Ga0137382_110758811 | 3300012200 | Vadose Zone Soil | VEPPSRSSDFVALGHPGSEHYAGLETFANPGVSHVEMTSDELS |
| Ga0137399_106679144 | 3300012203 | Vadose Zone Soil | VEQQFVALGHAGSDAYAGLETFPNPGVEVVELVSDELTAVCPIT |
| Ga0137374_103700443 | 3300012204 | Vadose Zone Soil | MTETNEFVALGHAGSEQYAGLETFPNPGVSHVELTSDELTAVCPITAQPDLYD |
| Ga0137380_109873222 | 3300012206 | Vadose Zone Soil | VEHEFVALGRAGSDAYVGLETFSNPGVERVELVSDELTAVCPITSQ |
| Ga0137381_104934003 | 3300012207 | Vadose Zone Soil | METPSGSTGFAALGHPGSDHYVGLETFANPGVSHVEMTSDELTAVCPVTGQP |
| Ga0137381_113591041 | 3300012207 | Vadose Zone Soil | VEPPSRSTAFVALGHPGSDHYAGLETFANPGVSHVEMTSDELTTICPVTG* |
| Ga0137381_113832551 | 3300012207 | Vadose Zone Soil | MGSDPRSTDFVALSQPGSDHYAGLETFPNPGVTRVEMISDELTAVCPVTEQPDL |
| Ga0137376_107963743 | 3300012208 | Vadose Zone Soil | MDGTRSTELVALGHAGSDHYAGLETFPNPGVAHVELTSDELVSVCPVTGQ |
| Ga0137379_106760643 | 3300012209 | Vadose Zone Soil | MRPTEFVALGHAGSDHYAGLETFPNPGVSRVEMTSD |
| Ga0137379_111408361 | 3300012209 | Vadose Zone Soil | VEPPSRSTAFVALGHPGSDHYAGLETFANPGVSHVEMTSDELS |
| Ga0137379_112175681 | 3300012209 | Vadose Zone Soil | MSADVRLTEFVARGHAGFDHYAGLETFPNPGVSRLEMTSDELA |
| Ga0137378_108578212 | 3300012210 | Vadose Zone Soil | MEQWPRSTEFVALGHAGSGHYAGLETFPNPGVSHVEMTS |
| Ga0137377_105149743 | 3300012211 | Vadose Zone Soil | MEQWPRSTEFVALGHAGSGHYAGLETFPNPGVSHVEMTSDELTAICPVTD |
| Ga0137370_102756131 | 3300012285 | Vadose Zone Soil | VEPPSRASDLIALGHAGSDHYAGLETFANPGVSHVEMTSDELSAVCP |
| Ga0137370_105475532 | 3300012285 | Vadose Zone Soil | VSDSLRTDESVALGVAASEHYAGLETFGNPGVTRVEMTSDELTAICPINAQPDLSKHR* |
| Ga0137370_108824122 | 3300012285 | Vadose Zone Soil | VEHEFVALGHAGSDAYAGLETFPNPGVEVVEMLSDKLTT |
| Ga0137387_107801312 | 3300012349 | Vadose Zone Soil | VGERSTEFVALGQPGSEAYAGLETFENPGVARVEMVVLGEGG* |
| Ga0137372_104478161 | 3300012350 | Vadose Zone Soil | VGTASRSTEFVALGHPCSERYAGLETFANPGVSHVE |
| Ga0137366_108706622 | 3300012354 | Vadose Zone Soil | MEPSSRSTDFAALGHPGSDHYAGLETFANPGASHVKMRS |
| Ga0137366_109211562 | 3300012354 | Vadose Zone Soil | MEQSPRSTEFVALGHAGSEHYAGLESFPNPGVAHVELTSDELTAVCPITAQPD |
| Ga0137384_113212251 | 3300012357 | Vadose Zone Soil | MRDEFVALGHAGSDAYAGLETFANPGVERVEMVSDELTAACPITGQPDF |
| Ga0137385_111708004 | 3300012359 | Vadose Zone Soil | MDATTRSTEFVALGHAGSEHYAGLESFPNPGVSRVELTS |
| Ga0137385_111762981 | 3300012359 | Vadose Zone Soil | MRDEFVALGHAGSDAYAGLETFANPGVERVEMVSDELTAA |
| Ga0137375_101013863 | 3300012360 | Vadose Zone Soil | MTETNEFVALGHAGSEHYAGPETFPNPGVARVELTSDELTAVCPITGQPDLYLAAIE |
| Ga0137375_101389531 | 3300012360 | Vadose Zone Soil | MTETNEFVALGHAGSEHYAGLETFPNPGVSHVELTSDE |
| Ga0137360_102951443 | 3300012361 | Vadose Zone Soil | VDTTERSSEFVALGHAGSDHYGGLETFANPGVSHVEMTSDEL |
| Ga0137358_103881984 | 3300012582 | Vadose Zone Soil | VKQEFVALGHAGSDAYAGLETFPNPGVEVVELVSDELTAMCPITNQP |
| Ga0137358_105976002 | 3300012582 | Vadose Zone Soil | VEPPSRASDFVALGHAGSDHYAGLETFANPGVSHVEMTSD |
| Ga0136612_101194643 | 3300012680 | Polar Desert Sand | MEETTRPTEFVALGHAGSEHYAGIETFPSPGVSHVQLTSDELVAVCPITGQADFY |
| Ga0136612_102246763 | 3300012680 | Polar Desert Sand | MEETTRSTEFVALGHAGSEHYAGIETFPSPGVAHLQLTSDELV |
| Ga0137398_110658021 | 3300012683 | Vadose Zone Soil | MEGEFVALGSPEGYAGLETFSNPGVSHVDLTSDELTAMCPVTGQPDMYVAQI |
| Ga0157293_100696782 | 3300012898 | Soil | VNERSPEFVALGHAGSEHNAGIETFPNPGGARVEMTSDELV |
| Ga0157293_101600371 | 3300012898 | Soil | MTETTRETEFVALGHAGSEHYAGLETFPSPGIATVSMTSDELVAVCP |
| Ga0157289_103430312 | 3300012903 | Soil | MEREFVALGHAGSEHYAGLETFPNPGVALVELTSDEL |
| Ga0157283_102066253 | 3300012907 | Soil | MAETTRSTEFVALGHAGSEHYAGIETFPNPGVSHVQMTSDELTAVCPITGQAD |
| Ga0157283_103752231 | 3300012907 | Soil | MPLQYELMESKTRSTEFVALGHAGSDHYAGLETFPNPGVSHVEMTSDELVAV |
| Ga0157298_103384481 | 3300012913 | Soil | MSELPEFTALGHAGSKHYAGLETFPNPGVSLVDLTSDELTA |
| Ga0137413_110229512 | 3300012924 | Vadose Zone Soil | MEQEFVALGHAGSDAYVGLETFANPGVETVELVSDELTG |
| Ga0137416_118722671 | 3300012927 | Vadose Zone Soil | VEPPSRSSDFVALGHPGSGHYAGLETFANPGVAHVEMTSDELSAI |
| Ga0137407_108438952 | 3300012930 | Vadose Zone Soil | MAPPPRSTDFVALGHPGSDHYAGLETFANPGVSHVEM |
| Ga0137407_114878781 | 3300012930 | Vadose Zone Soil | VSQPPAHFVALGHGPEHYAGLETFPNPGVSRVEMTSDELVAV |
| Ga0137407_119088112 | 3300012930 | Vadose Zone Soil | VEHEFVALGHAGSDAYIGLETFPNPGVETVEMVSDELTGLCPITNQPDFYTATI |
| Ga0164302_111347131 | 3300012961 | Soil | MEGSTRETDFVALGKPGPQAFAEIETFPNPGVSHVEMTSDELTALG |
| Ga0126369_123073271 | 3300012971 | Tropical Forest Soil | MDDPSRSPDLVALGHPGSEHYAGLEAFPNPGVSHVEMTSDE |
| Ga0134087_104726301 | 3300012977 | Grasslands Soil | MMERSEEFVALGHAGSEHFAGLETFPNPGVSEVDMRSDELTAVCPITGQ |
| Ga0134087_105599732 | 3300012977 | Grasslands Soil | MDAGTRSTEFVALGHAGSEHYAGLETFPNPGVSLVELVSDELVAVCPITGQPDLYVASIE |
| Ga0164309_115508521 | 3300012984 | Soil | VQVEFVALGHSGSEHYAGLESFPNPGVTEVEMTSDELTAVCPITGQADF |
| Ga0164308_108686392 | 3300012985 | Soil | MGEEFVALGHAGSEHYAGLESFPNPGVALVEMTSDELVAMCPVTNQPDMYVATIEY* |
| Ga0164308_108955251 | 3300012985 | Soil | MEHEFVALGHAGSDAYVGLETFPNPGVEVVEMVSDELTGLCPITNQP |
| Ga0164308_113722831 | 3300012985 | Soil | MAEEFIALGHDGDAYGGLETFPNPGVAVVELESDELTAMCPITNQPDN |
| Ga0164304_103006523 | 3300012986 | Soil | MEFVALGHTGSEHYAGLESFENPGVTEVEMTSAELTAVARANGRR* |
| Ga0164304_103795654 | 3300012986 | Soil | MEHEFVALGHAGSDAYAGLETFPNPGVDRVELVSDELTAVC |
| Ga0164304_113391291 | 3300012986 | Soil | MEGSKRETDFVALGQPGSEAYAGIETFPNPGVAHVDMTSDELIA |
| Ga0164307_108416843 | 3300012987 | Soil | MPEEFVALGHAGSEHYAGLETFPNPGVALVELTSDELVAMCPVTNQPDMY |
| Ga0164305_111175522 | 3300012989 | Soil | MEGSKRETDFVALGQPGSEAYAGIETFPNPGVSHVELTSDELTAIC |
| Ga0164305_113338382 | 3300012989 | Soil | MEHEFVALGRAGSDAYVGLETFPNPGVELVEMVSDEL |
| Ga0157373_105615343 | 3300013100 | Corn Rhizosphere | MEQEFVALGHAGSDAYAGLETFPNPGVERVELVSDELT |
| Ga0157373_108594373 | 3300013100 | Corn Rhizosphere | MEQEFVALGHAGSDAHAGLETFPNPGVERVEMVSDELTAMCPITSQPDFYVTT |
| Ga0163162_118565341 | 3300013306 | Switchgrass Rhizosphere | VNERSKEFVALGHAGSEHYAGIETFPNPGVARVEMTSDELVAMCPVTNQP |
| Ga0163162_127423492 | 3300013306 | Switchgrass Rhizosphere | VEAGSRSGDFVALGHPGSEHYSGLETFANPGVSQVEMTSDELAAVCPV |
| Ga0120123_11218712 | 3300013770 | Permafrost | VEPPSRSTDFVALGHPGSDHYAGLETFANPGVSHVEMTSDELSTICPVTGQPDLY |
| Ga0120158_101206931 | 3300013772 | Permafrost | VGQEFVALGHAGSDAYAGLETFPNPGVEVVEMISD |
| Ga0120173_10045251 | 3300014031 | Permafrost | METDAPQTEFVALGHAGSDHYAGLETFPNPGVSHVEMTSDELSAMCP |
| Ga0163163_114905081 | 3300014325 | Switchgrass Rhizosphere | MEGSTRETDFVALGQPGSEAFAGIETFPNPGVSRVEMTSDELTAMC |
| Ga0157380_115613652 | 3300014326 | Switchgrass Rhizosphere | MTETHEFVALGHAGSEAYAGLESFPNPGVSRVEMTSDEL |
| Ga0182008_106531081 | 3300014497 | Rhizosphere | MSEAPRLVARSHQGSQHYVGLETFPNPGVAHVEMRSDELTAVCPITGQ |
| Ga0181519_101656381 | 3300014658 | Bog | MAVGTIERPGGFVALGHAGSSHFAGLETFPNPGVAAVEFSGDELAAVCPITGQPDLYRFTVVYQP |
| Ga0120170_10156065 | 3300014823 | Permafrost | METEAQPTEFVALGHAGSEHYVGLETFPNPGVSHVEMTSDELSAMCP |
| Ga0120170_10896172 | 3300014823 | Permafrost | MENEFVALGHAGSDHYAGLETFPNPGVSHVDMTSDELSAICPITSQPD |
| Ga0157379_108673413 | 3300014968 | Switchgrass Rhizosphere | MAQEFIALGHDGDAYGGLETFPTPGVAVVELERDELTAMC |
| Ga0157376_120740252 | 3300014969 | Miscanthus Rhizosphere | VRETGDFVALGHAGSEHYAGLETFPNPGVALVEMTSDELVAMCPVT |
| Ga0167645_1144473 | 3300015068 | Glacier Forefield Soil | MEQQFVALGHAGSDAYVGLETFPNPGVETVELVSDELTWL |
| Ga0167667_10425671 | 3300015189 | Glacier Forefield Soil | MAQEFIALGHDGDAYGGLETFPNPGVTVVELESDELTAMCPITKQP |
| Ga0134072_100673411 | 3300015357 | Grasslands Soil | MEGTTRSTEFVARAHPGSEHYAGLETFANPGVSHVALTSDEL |
| Ga0132258_107574966 | 3300015371 | Arabidopsis Rhizosphere | MEREFVALGHAGSDAYAGLESFPNPGVERVELGSDELTAVCPITNQPDLY |
| Ga0132257_1001821335 | 3300015373 | Arabidopsis Rhizosphere | MEGSTRETDFVALGQPGSEAFAGIETFPNPGVSHVDMTSD |
| Ga0182033_105972242 | 3300016319 | Soil | MERSSDFVALGHPGSQHYAGLEAFPNPGVSHVEMTSDELTALGPVVGYP |
| Ga0187779_102507373 | 3300017959 | Tropical Peatland | VDDARRSEDFVALGHAGSSHYAGLETFENPGVTRVEMTSDELVALGR |
| Ga0187777_104828222 | 3300017974 | Tropical Peatland | VATTSRSTDFVALGHPGNEHYAGLEAFANPGVEDVELV |
| Ga0187777_105999571 | 3300017974 | Tropical Peatland | VSGVEPKSTDFVALGHAGSEHYAGLETFPNPGVVEVELTSDE |
| Ga0187777_113423721 | 3300017974 | Tropical Peatland | MRVSAPSRPAGLVALGNPGSERYAGLETFPNPGVADVELVSDELTAVCPITGQPD |
| Ga0187822_102013312 | 3300017994 | Freshwater Sediment | MATTTRSTDFVALGQPGNDRYAGLETFANPGVARV |
| Ga0184605_101639263 | 3300018027 | Groundwater Sediment | MEPRSTDFVALGHAGSDHFAGIESFPNPGVSHVELTSDELA |
| Ga0184624_104460692 | 3300018073 | Groundwater Sediment | MTETRRETEFVALGHAGSEHYAGLETFPSPGIATVSMTSDELVAVCPIT |
| Ga0184627_104544083 | 3300018079 | Groundwater Sediment | MGLQYGPMEPAPRSSEFVALGHPGSDHYAGLETFANPGVSQV |
| Ga0184639_100911424 | 3300018082 | Groundwater Sediment | VEAGSRSTEFVALGHPGSDRYAGLETFANPGVSHVEMTSDELTAICPI |
| Ga0190265_102388531 | 3300018422 | Soil | VDTERSTEFVALGHAGSEHYAGLETFPNPGVSHVEMTSDELTAVCP |
| Ga0190272_112864973 | 3300018429 | Soil | MAETRSTEFVALGHAGSEHYAGIETCPSPGVSHVLLTSDELVAVCPITGQADFYTA |
| Ga0066655_110001792 | 3300018431 | Grasslands Soil | MEPSSRSTDFAALGHPGSDHYAGLETFANPGASHVKMRSDELAAVCPVTGQPDLY |
| Ga0066662_104271731 | 3300018468 | Grasslands Soil | VETAPRSTDFVALGRPGSELFAGLETFANPGVSHFEMTSDELTA |
| Ga0066662_126608301 | 3300018468 | Grasslands Soil | MDTASRSTEFVALGHAGSDHYAGLETFANPGVAAVEMESDELTAVCPITGQPDCY |
| Ga0190270_106362853 | 3300018469 | Soil | VSDSLPEFVALGHAGSEHYAGLETFPNPGVAHVELESDELVAVCPITGQADMYVAT |
| Ga0190274_103014493 | 3300018476 | Soil | VETSSRDTDLVALGQPGNDAYAGLETFPNPGVEHV |
| Ga0190274_103785421 | 3300018476 | Soil | MSDSLPEFVALGHAGSEHYAGLETFPNPGVAHVELESDELVAVCPITDQADMY |
| Ga0190273_113554581 | 3300018920 | Soil | MEAGSRSTGFVALGHPGSEQYVGLETFPNPGVSHVEMTSDELTAL |
| Ga0184642_12435282 | 3300019279 | Groundwater Sediment | MEPRSTDFVALGHAGSDHFAGLESFPNPGVSHVELTSDELAAVCPVTGQ |
| Ga0173482_104894852 | 3300019361 | Soil | MDETSQLPEFVALGHAGSEHYAGLETFPNPGVALVEMTSDELVAMCPVTNQPD |
| Ga0173482_105601392 | 3300019361 | Soil | MAEEFVALGHAGSEHYAGLETFPNPGVALVEMTSDELVAMC |
| Ga0173479_103306971 | 3300019362 | Soil | MAQEFIALGHDGDAYGGLETFPNPGVAVVELESDELTAMCPITNQPDNYATTIR |
| Ga0206353_110468751 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MEQEFVALGHAGSDAYAGLETFPNPGVDRVELVSD |
| Ga0224500_101781831 | 3300022213 | Sediment | VSGEFVALGHAGSDAYVGLETFANPGVQHVELVSDELTAVCPITNQPDFYTATIVY |
| Ga0247791_10832612 | 3300023062 | Soil | MESPGEFVALGQPGSEHYAGLEMFPNPGVTHVEMTSDELT |
| Ga0247692_10051493 | 3300024279 | Soil | MNEPPGEFVALGHGSDAYAGLEAFENPGVARVEMTSDELVAV |
| Ga0207692_101704752 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VEQEFVALGHAGSDAYAGLETFPNPGVTTVEMVSDELT |
| Ga0207642_100414274 | 3300025899 | Miscanthus Rhizosphere | MEGTTRSTEFVALARSGSEHYAGLETFPNPGVSHVALRSDELSAVCPVTGQP |
| Ga0207643_103182543 | 3300025908 | Miscanthus Rhizosphere | MTETRREIEFVALGHAGSEHYAGLETFPSPGIATV |
| Ga0207695_105782901 | 3300025913 | Corn Rhizosphere | MEHEFVALGHAGSDAYAGLETFPNPGVERVEMVSDELTAFCPITHQP |
| Ga0207663_113829152 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MEFVALGHAGSEHYAGLESFPNPGVTQVEMTSDELTAVCPITAQPDFYVARI |
| Ga0207660_108491361 | 3300025917 | Corn Rhizosphere | MEQQQEFVALGHAGSDAYAGLETFPNPGVEWVELVSDELV |
| Ga0207649_103304064 | 3300025920 | Corn Rhizosphere | VEQEFVALGHAGSDAYAGLETFPNPGVERVEMVSDELTAFCPITH |
| Ga0207652_104233562 | 3300025921 | Corn Rhizosphere | MNADTRSTEFVALGHAGSEHYAGLDTFPNPGVAVV |
| Ga0207652_109818753 | 3300025921 | Corn Rhizosphere | MEREFVALGHAGSDAYAGLESFPNPGVERVELQSDELTAFCPITHQPDF |
| Ga0207652_111451302 | 3300025921 | Corn Rhizosphere | MEQEFVALGHAGSDAYAGLETFPNPGVERVELVSDELTAFCPITHQPDF |
| Ga0207694_104686371 | 3300025924 | Corn Rhizosphere | VEPASPPSFESLGHAGLQNFAGLETFANPGVERVEMTSDELAAL |
| Ga0207659_101895671 | 3300025926 | Miscanthus Rhizosphere | MEGTTRSTEFVALARSGSEHYAGLETFPNPGVSHVALRSDE |
| Ga0207700_114229902 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VEQEFVALGHAGSDAYAGLETFPNPGVKTVVLVSDELTAVCPITNQADFY |
| Ga0207700_118586742 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VDKEFVALGHAGSDAYAGLETFPNPGVATVEMVSDELTAVCP |
| Ga0207664_108202293 | 3300025929 | Agricultural Soil | MEQRFVALGHAGSDAYAGLETFPNPGVTTVELASDEL |
| Ga0207686_113583192 | 3300025934 | Miscanthus Rhizosphere | VETTTRSTEFVALGHPGSDHYAGLETFPNPGVARVELDSDELTAVCPITG |
| Ga0207709_113815471 | 3300025935 | Miscanthus Rhizosphere | MGQFSGAEAYSTRAMEGSTRETDFVALGQPGSEAFAGIETFPNPGVSHVELTSDELTAVCPITGQPDMYVA |
| Ga0207704_118113001 | 3300025938 | Miscanthus Rhizosphere | MESDTRSTEFVALGHAGSDHYAGLETFPNPGVSHVEMTSDELVAVCPITGQP |
| Ga0207665_104356864 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MEFVALGHAGSEHYAGLESFPNPGVAVVEMTSDELTAVCPITGQP |
| Ga0207665_110671712 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VKQQEEFVALGHAGSDAYAGLETFANPGVEVVSMTSDE |
| Ga0207661_104715983 | 3300025944 | Corn Rhizosphere | MAEEFVALGHAGSEHYAGLETFPNPGVALVEMTSDELVAMCPVT |
| Ga0207667_111303651 | 3300025949 | Corn Rhizosphere | VEQEFVALGHAGSGAYAGLETFPNPGVARVELVSDELTAFCPITRQPDFYTA |
| Ga0207712_111719781 | 3300025961 | Switchgrass Rhizosphere | VEASSSTPQFESLGHAGQQNYAGLETFPNPGVERVEMTSDELAALCPITLQPDMY |
| Ga0207668_114337952 | 3300025972 | Switchgrass Rhizosphere | VNERSKEFVALGHAGSEHYAGIETFPNPGVARVEMTSDELVAMCPVTNQPDMY |
| Ga0207640_105426821 | 3300025981 | Corn Rhizosphere | MEREFVALGHAGSDAYAGLESFPNPGVQRVELQSDELTAFCPITHQPDFYTAT |
| Ga0207640_112982781 | 3300025981 | Corn Rhizosphere | VEQEFVALGHAGSDAYAGLETFPNPGVEVVELVSDELTAVCP |
| Ga0207703_123182472 | 3300026035 | Switchgrass Rhizosphere | MTETTRETEFVALGHAGSEHYAGLETFPSPGIATVSM |
| Ga0207648_121410152 | 3300026089 | Miscanthus Rhizosphere | METTPRETELVALGHPGSGAYAGLESFPNPGVSKVELTSDELAALCPVTGQPDLYIAT |
| Ga0207683_101555921 | 3300026121 | Miscanthus Rhizosphere | MAEEFVALGHAGSEHYAGLETFPNPGVALVEMTSDELVAMCPVTNQPDMY |
| Ga0207683_120690091 | 3300026121 | Miscanthus Rhizosphere | MEREFVALGHAGSDAYAGLESFPNPGVERVELVSDELTAV |
| Ga0209468_10778692 | 3300026306 | Soil | MEGSTRETDFVALGQPGSEAFAGIETFPNPGVSHVEMTSD |
| Ga0209153_11935533 | 3300026312 | Soil | VEHEFVALGHAGSDAYAGLETFPNPGVEVVELVSDELTAVCP |
| Ga0209155_11907091 | 3300026316 | Soil | VEPPSRASDLIALGHAGSDHYAGLETFANPGVSRVEMTSDELSAVCPV |
| Ga0209161_103284082 | 3300026548 | Soil | VEPPSRSSDLIALGHAGSDHYAGLETFANPGVSHVEMTSDELSAV |
| Ga0209474_106087801 | 3300026550 | Soil | VEATTRSTEFVALGHPGSEHYAGLETFPNPGVARVE |
| Ga0209113_10455053 | 3300027517 | Forest Soil | VEQDFVALGHAGSDAYAGLESFPNPGVERVELVSDELTAMCPITSQPD |
| Ga0209874_10016781 | 3300027577 | Groundwater Sand | VALGHPGSEHYAGLETFANPGVARVEMTSDELTAVCPVTGQPD |
| Ga0209818_11371071 | 3300027637 | Agricultural Soil | MEETTRTTEFVALGHAGSAHYAGIETFPSPGVTHVQM |
| Ga0209514_103935972 | 3300027819 | Groundwater | MTDSGLPDFVALGHAGSGAYAGLETFPNPGVSLVELE |
| Ga0209811_102742951 | 3300027821 | Surface Soil | MEGSTRETDFVALGKPGSEAFAGIETFPNPGVSHVEMTSDEL |
| Ga0209797_100562391 | 3300027831 | Wetland Sediment | MAQEFIALGHAGSDAYAGLETFPNPGVAVVELESDE |
| Ga0209797_101693522 | 3300027831 | Wetland Sediment | MESGTRTTELVALGTPGNEAYAGLETFQNPGVERVELTSDELTSVCPITGQ |
| Ga0209283_109824332 | 3300027875 | Vadose Zone Soil | MDTGTRSTEFVALGHPGSEHYAGLETFANPGVSQVELTSDELAAVCPIT |
| Ga0209486_109575672 | 3300027886 | Agricultural Soil | MDETTRTTEFVALGHAGSEHYAGIETFPSPGVAHVQMTSDELVAVCPITG |
| Ga0209068_101507751 | 3300027894 | Watersheds | MEFVALGNAGSEHYAGLESFPNPGVTDVEMTSDELTAVCPITGQADFY |
| Ga0247705_10206811 | 3300028004 | Soil | MERAADFVALGHAGSEHYAGLETFPNPGVAHVELTSDELVAVCPITSQPDFY |
| Ga0247675_10518001 | 3300028072 | Soil | MNEPPGEFVALGHGSDAYAGLEAFENPGVARVEMTSDELVAVCPITNQPDM |
| Ga0265326_101543781 | 3300028558 | Rhizosphere | VDKEFVALGHAGSDAYAGLESFPNPGVDRVELVSDELSAMCPITNQPDF |
| Ga0265326_102022522 | 3300028558 | Rhizosphere | VAETGFVALGHAGSDAYAGLETFPNPGVRELELTSDELTA |
| Ga0307285_101855703 | 3300028712 | Soil | VNERSTEFVALGHAGSEHYAGIETFANPGVARVEMT |
| Ga0307313_101267902 | 3300028715 | Soil | VEPASSPQFESLGHAGLQNFAGLETFANPGIERVEMTSDELAALCPITLQPDMYV |
| Ga0307301_102728122 | 3300028719 | Soil | MEGSTRETDFVALGQPGSEAFAGIETFPNPGVSHVEMASDELTA |
| Ga0307317_101391052 | 3300028720 | Soil | MEGSSRETDFVALGKPGNEQFAGIETFPNPGVAHV |
| Ga0307319_102771111 | 3300028722 | Soil | METEAQQTEFVALGHAGSEHYAGLETFPNPGVALVEMTSDELVAMCPVTNQPDMYVAT |
| Ga0307297_101184093 | 3300028754 | Soil | VSESALPEFVALGHAGSEHYAGLETFPNPGAALVELESDELVAVCPITGQADFYLA |
| Ga0307320_104374881 | 3300028771 | Soil | VEPPQEFVALGHAGSDHYAGLETFPNPGVSQVEMVSDELVAVCPI |
| Ga0307282_102488081 | 3300028784 | Soil | VSDASTSNEFVALGHAGSDHYAGLESFPNPGVSQVEMTSDELVAVCPITGQPD |
| Ga0307283_100471313 | 3300028790 | Soil | MAEEFIALGHDGDAYGGLETFPNPGVAVVELESDE |
| Ga0307290_101292683 | 3300028791 | Soil | VSDASTSNEFVALGHAGSDHYAGLESFPNPGVSQVEMTSDELVAVCPIT |
| Ga0307287_103709512 | 3300028796 | Soil | VSDASTSNEFVALGHAGSDHYAGLESFPNPGVSQVEMTSDELVAVCPITGQPDLYVAVIEYS |
| Ga0307287_103931301 | 3300028796 | Soil | MESDTRSTEFVALGHAGSHHYAGLETFANPGVSHVEMTSD |
| Ga0307284_103501691 | 3300028799 | Soil | METEAQQSEFVALGHAGSEHYAGLETFPNPGVRHVEMTSDELSAMCPITD |
| Ga0307503_102321871 | 3300028802 | Soil | MTEFVALGHAGSEHYAGLETFPNPGVRHVEMTSDEVTAMCPVT |
| Ga0307503_108843841 | 3300028802 | Soil | MAQEFIALGHGSDAYGGLETFPNPGVAVVELQSDELTAMCPITDQPDNYIATIR |
| Ga0307296_100822653 | 3300028819 | Soil | VEPASPPQFESLGHAGLQNFAGLETFANPGVERVEMTSDELAALCPITLQPDMYVA |
| Ga0307310_104039021 | 3300028824 | Soil | MAEEFVALGHAGSEHYAGLETFPNPGVALVELTSDELVAMCPVTSQPDM |
| Ga0307312_101541361 | 3300028828 | Soil | MDRSPGSTDFAALGHPGSDHYAGLETFVNPGASHVEMASDELT |
| Ga0307286_101517523 | 3300028876 | Soil | MSLQYELMESETRSTEFVALGHAGSNHYAGLETFANPGVSHVEMTSDELVAVCPITGQP |
| Ga0307277_102021162 | 3300028881 | Soil | MDGTRSDEFVALGHAGSGHYAGLETFPNPGVTSVELTS |
| Ga0265324_103414861 | 3300029957 | Rhizosphere | VEPSSPPRFESLGHAGLQRFAGLETFPNPGVERVEMTSDELAALCPITLQPDMYI |
| Ga0307497_102818261 | 3300031226 | Soil | MSEPPGEFVALGHAGPDAYAGLETFENPGVARVEMTSDELVAVCPITNQPDMY |
| Ga0302323_1008300743 | 3300031232 | Fen | VESSSSPQFESLGHAGLQNFAGLETFPNPGVTRVEMTSDELAALCPI |
| Ga0265320_101477791 | 3300031240 | Rhizosphere | MSRVLRMEKTEFVALGHSGTSAYAGLETFPNPGVRELELTSDELTAVCPITAQPDF |
| Ga0265327_100722644 | 3300031251 | Rhizosphere | VDKEFVALGHAGSDAYAGLESFPNPGVDRVELVSDELTAMCPITNQ |
| Ga0310886_103990091 | 3300031562 | Soil | VSELPEFTALGHAGSEHYAGLETFPNPGVSLVDLTS |
| Ga0265313_102540991 | 3300031595 | Rhizosphere | VAETGFVALGHAGSDAYAGLETFPNPGVRELELTSDE |
| Ga0318555_104410702 | 3300031640 | Soil | MTMASTERSTEFVALGHPGNDHYAGLETFANPGVEEVEMAGDELTA |
| Ga0307469_110800083 | 3300031720 | Hardwood Forest Soil | VTSEFVALGQAGTYAGLETFPNPGVAQVEMTSDELTAICPVTSQPDLYT |
| Ga0318493_106968882 | 3300031723 | Soil | MGVATTPRSTEFVALGHPGNDHYTGLETFANPGVVDVELL |
| Ga0302321_1015006281 | 3300031726 | Fen | VEQEFVALGHAGSDAYAGLETFPNPGVTAVSLVSDE |
| Ga0307405_103885231 | 3300031731 | Rhizosphere | VEETTRTTEFVALGHAGSEHYAGLETFASPGVSQVVMTSDELVAVCPITAQPDFY |
| Ga0318492_103354291 | 3300031748 | Soil | MAVATTPRSTEFVALGHPGNDHYAGLETFPNPGVADVELRSDE |
| Ga0307477_107302862 | 3300031753 | Hardwood Forest Soil | VDTTSRSTEFVALGHAGSEHYAGLETFANPGVKRVELASDELTAVCPITGQPDLYMARIE |
| Ga0318535_104341161 | 3300031764 | Soil | MTDTHEFVALGHAGSEAYAGLETFPNPGVARVELRSDELT |
| Ga0318565_105547352 | 3300031799 | Soil | MERSSDFVALGHPGSQHYAGLEAFPNPGVSHVEMTSDELTALGP |
| Ga0318568_102820193 | 3300031819 | Soil | MTMGSTERSTEFVALGHPGNEHYAGLETFANPGVEEVEMAGDELTA |
| Ga0307413_113771423 | 3300031824 | Rhizosphere | VEETTRTTEFVALGHAGSEHYAGLETFASPGVSQVVMTSD |
| Ga0318511_102074072 | 3300031845 | Soil | MATPRDTDLVALGHPGFEHYGGLESFPNPGVERVEMTSDELTSV |
| Ga0318512_102930421 | 3300031846 | Soil | MERSSDFVALGHPGSQHYAGLEAFPNPGVSHVEMT |
| Ga0310907_107880161 | 3300031847 | Soil | VSELPEFTALGHAGSEHYAGLETFPNPGVSLVDLTSDELTAVCPIT |
| Ga0310892_111945482 | 3300031858 | Soil | MTETTRETEFVALGHAGSEHYAGLETFPSPGIATVSMTSDEL |
| Ga0306925_112069933 | 3300031890 | Soil | VEFVALGHAGSEHYAGLESFPNPGVTEVEMKSDELTAVCPITGQADFYIARIAY |
| Ga0318520_110212491 | 3300031897 | Soil | MERSSDFVALGHPGSQHYAGLEAFPNPGVSHVEMTSDELTALGPVVGYPDLYVAAIEYW |
| Ga0307406_115050061 | 3300031901 | Rhizosphere | MEPGQEFVALGHAGSEHYAGLESFPNPGVSHVEMVSDELTAVCP |
| Ga0310900_107399633 | 3300031908 | Soil | MTETRRETEFVALGHPGSEHYAGLETFPSPGIATVSMTSDELVAV |
| Ga0311367_116535822 | 3300031918 | Fen | VSDTTEPTGFVALGSSGSHAYAGLETFPNPGVGEVELVS |
| Ga0308175_1017792042 | 3300031938 | Soil | MEQEFVALGHAGSDAYAGLETFPNPGVEVVELVSDELT |
| Ga0308175_1019582112 | 3300031938 | Soil | MTETHEFVALGHAGSEAYAGLESFPNPGVARVEMTSDELTATCPITAQPD |
| Ga0308174_105949861 | 3300031939 | Soil | MTETHEFVALGHAGSEAYAGLESFPNPGVSRVEMTS |
| Ga0308174_110267381 | 3300031939 | Soil | MEQEFIALGHDGDAYGGLETFPNPGVAVVELESDELTAMCPITNQ |
| Ga0308174_111186642 | 3300031939 | Soil | VEQEFVALGHAGSDAYAGLESFPNPGIARVELVSDELSAMCPITGQPDFYT |
| Ga0308174_113954992 | 3300031939 | Soil | MEQEFVALGHAGSDAYAGLESFPNPGVERVELVSDELTAICPITHQPD |
| Ga0310885_104362073 | 3300031943 | Soil | MNEPPGEFVALGHGSDAYAGLETFENPGVARVEMTSDELVAVCPITNQPDM |
| Ga0310909_115939191 | 3300031947 | Soil | MERSSDFVALGHPGSQHYAGLEAFPNPGVSHVEMTSDELTALGPVVGY |
| Ga0306926_118979072 | 3300031954 | Soil | MKQEFVALGHAGSDAYIGLETFPNPGVESVQMVSDELTGLCPITNQPDFYTATIE |
| Ga0308176_101280581 | 3300031996 | Soil | VEQEFVALGHAGSDAYAGLESFPNPGIARVELVSDE |
| Ga0315278_109792201 | 3300031997 | Sediment | MDPAARSTEFVALGHAGSDHYAGLETFANPGVSHVEMTSDELTAIC |
| Ga0307416_1003360261 | 3300032002 | Rhizosphere | VNERSTEFVALGHAGSEQYAGIETFPNPGVVRVEMTSDE |
| Ga0307416_1013224201 | 3300032002 | Rhizosphere | MERMEQEFVALGHAGSEHYAGLETFPNPGVATVSMTSD |
| Ga0318562_104194451 | 3300032008 | Soil | MATTRRDTDFVALGSPGSSAYAGLETFPNPGVAEVEMVSDELTAVCPITGQPDLYRLT |
| Ga0310902_110263062 | 3300032012 | Soil | VSELPEFTALGHAGSEHYAGLETFPNPGVSVVDLTSDELTAVCPITGQP |
| Ga0318553_101988103 | 3300032068 | Soil | MGVATTPRSTEFVALGHPGNAHYAGLETFANPGVADVELRSDELTA |
| Ga0307415_1018700591 | 3300032126 | Rhizosphere | MEPGQEFVALGHAGSENYAGLESFPNPGASHVEMVSDELTAVCPIT |
| Ga0307471_1013444603 | 3300032180 | Hardwood Forest Soil | VEFVALGHAGSEHYAGLESFPNPGVTEVEMTSDELTAVCPITAQPDF |
| Ga0307471_1030646952 | 3300032180 | Hardwood Forest Soil | MEGSTRETDFVALGKPGSEAFAGIETFPNPGVSHVEMTSDELT |
| Ga0315286_117023212 | 3300032342 | Sediment | MDPAARSTEFVALGHAGSDHYAGLETFANPGVSHVEMTSDELTAICPVTGQPDLYAA |
| Ga0335085_111891062 | 3300032770 | Soil | MEPPSTEFVALGHAGSDHYAGLEAFPNPGVSHVELQSDELAAICPVT |
| Ga0335071_108779391 | 3300032897 | Soil | MGVSAKIRSTEFAALGHAGPDHYAGLESFANPGVADVSLVSDELTAVCPI |
| Ga0335072_100371031 | 3300032898 | Soil | VESGFVALGHAGSEHYAGLETFANPGVSLVSLESDELSAVCP |
| Ga0335076_101305144 | 3300032955 | Soil | VEPKSTDFVALGHAGSEHYAGLETFPNPGVLEVEMTSDELTAVC |
| ⦗Top⦘ |